NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019859

Metagenome / Metatranscriptome Family F019859

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019859
Family Type Metagenome / Metatranscriptome
Number of Sequences 227
Average Sequence Length 44 residues
Representative Sequence LKEWDRVKDRVRDESQLEAWQKVKQMAETCRLDRDLYLRFVGN
Number of Associated Samples 211
Number of Associated Scaffolds 227

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.44 %
% of genes near scaffold ends (potentially truncated) 97.36 %
% of genes from short scaffolds (< 2000 bps) 88.99 %
Associated GOLD sequencing projects 199
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.449 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.894 % of family members)
Environment Ontology (ENVO) Unclassified
(21.145 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.899 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.89%    β-sheet: 0.00%    Coil/Unstructured: 52.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 227 Family Scaffolds
PF14520HHH_5 49.34
PF01244Peptidase_M19 25.11
PF01850PIN 4.85
PF07499RuvA_C 4.41
PF04337DUF480 1.32
PF05496RuvB_N 0.88
PF13751DDE_Tnp_1_6 0.88
PF00216Bac_DNA_binding 0.88
PF01425Amidase 0.44
PF04014MazE_antitoxin 0.44
PF13895Ig_2 0.44
PF00698Acyl_transf_1 0.44
PF06452CBM9_1 0.44
PF02518HATPase_c 0.44
PF01330RuvA_N 0.44
PF14534DUF4440 0.44
PF01809YidD 0.44
PF03796DnaB_C 0.44
PF01467CTP_transf_like 0.44
PF05227CHASE3 0.44
PF00589Phage_integrase 0.44
PF00578AhpC-TSA 0.44
PF11412DsbC 0.44
PF13462Thioredoxin_4 0.44
PF04120Iron_permease 0.44

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 227 Family Scaffolds
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 25.11
COG0632Holliday junction resolvasome RuvABC DNA-binding subunitReplication, recombination and repair [L] 4.85
COG3132Uncharacterized conserved protein YceH, UPF0502 familyFunction unknown [S] 1.32
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.88
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 0.88
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.44
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.44
COG0759Membrane-anchored protein YidD, putatitve component of membrane protein insertase Oxa1/YidC/SpoIIIJCell wall/membrane/envelope biogenesis [M] 0.44
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.44


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.45 %
UnclassifiedrootN/A25.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10301189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium578Open in IMG/M
3300002911|JGI25390J43892_10002773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3792Open in IMG/M
3300004082|Ga0062384_100547099All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300004643|Ga0062591_100954203Not Available810Open in IMG/M
3300005093|Ga0062594_101004664All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300005167|Ga0066672_10890911All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium552Open in IMG/M
3300005172|Ga0066683_10885862All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium512Open in IMG/M
3300005174|Ga0066680_10115275All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1657Open in IMG/M
3300005174|Ga0066680_10370879Not Available911Open in IMG/M
3300005331|Ga0070670_100074540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2915Open in IMG/M
3300005335|Ga0070666_10166656All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300005336|Ga0070680_101365922Not Available613Open in IMG/M
3300005366|Ga0070659_100181936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1725Open in IMG/M
3300005434|Ga0070709_10325599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1129Open in IMG/M
3300005439|Ga0070711_100428249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1079Open in IMG/M
3300005451|Ga0066681_10434240All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae806Open in IMG/M
3300005455|Ga0070663_101279986All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300005468|Ga0070707_100801266All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae906Open in IMG/M
3300005529|Ga0070741_11082342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter682Open in IMG/M
3300005536|Ga0070697_102031434All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium515Open in IMG/M
3300005538|Ga0070731_10580411Not Available746Open in IMG/M
3300005555|Ga0066692_10690400All Organisms → cellular organisms → Bacteria → Proteobacteria634Open in IMG/M
3300005569|Ga0066705_10350628Not Available931Open in IMG/M
3300005569|Ga0066705_10376573Not Available892Open in IMG/M
3300005591|Ga0070761_10954037All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005602|Ga0070762_10073861All Organisms → cellular organisms → Bacteria1925Open in IMG/M
3300005615|Ga0070702_100235994All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300005712|Ga0070764_10393753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter817Open in IMG/M
3300005718|Ga0068866_10105289All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1564Open in IMG/M
3300005764|Ga0066903_108543338All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium522Open in IMG/M
3300005843|Ga0068860_102770754All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300005844|Ga0068862_102545332All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae523Open in IMG/M
3300005921|Ga0070766_10082733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1871Open in IMG/M
3300006028|Ga0070717_10322499Not Available1376Open in IMG/M
3300006041|Ga0075023_100459198All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300006046|Ga0066652_100056641All Organisms → cellular organisms → Bacteria2984Open in IMG/M
3300006046|Ga0066652_101289782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae689Open in IMG/M
3300006086|Ga0075019_10889084All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300006162|Ga0075030_100467189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1004Open in IMG/M
3300006176|Ga0070765_100746784All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300006755|Ga0079222_11893191Not Available581Open in IMG/M
3300006791|Ga0066653_10283899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae838Open in IMG/M
3300006797|Ga0066659_10381250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1103Open in IMG/M
3300006893|Ga0073928_10035054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4742Open in IMG/M
3300006954|Ga0079219_11322278Not Available636Open in IMG/M
3300007076|Ga0075435_100949850Not Available750Open in IMG/M
3300009090|Ga0099827_10972244All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium736Open in IMG/M
3300009093|Ga0105240_10586626All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300009137|Ga0066709_102157478Not Available769Open in IMG/M
3300009143|Ga0099792_10870429All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300009521|Ga0116222_1152002Not Available996Open in IMG/M
3300009523|Ga0116221_1206689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter850Open in IMG/M
3300009524|Ga0116225_1565549All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300009548|Ga0116107_1207621All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300009628|Ga0116125_1077031All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter872Open in IMG/M
3300009629|Ga0116119_1165868All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter551Open in IMG/M
3300009632|Ga0116102_1154671All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300009635|Ga0116117_1015592All Organisms → cellular organisms → Bacteria1935Open in IMG/M
3300009643|Ga0116110_1113360All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300009700|Ga0116217_10056000All Organisms → cellular organisms → Bacteria2831Open in IMG/M
3300009824|Ga0116219_10567572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter625Open in IMG/M
3300009839|Ga0116223_10014236All Organisms → cellular organisms → Bacteria5837Open in IMG/M
3300009839|Ga0116223_10239253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1098Open in IMG/M
3300010043|Ga0126380_10106916All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300010048|Ga0126373_10450626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1321Open in IMG/M
3300010321|Ga0134067_10135461Not Available869Open in IMG/M
3300010341|Ga0074045_10083892All Organisms → cellular organisms → Bacteria2226Open in IMG/M
3300010341|Ga0074045_10132060All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1707Open in IMG/M
3300010343|Ga0074044_10076471Not Available2264Open in IMG/M
3300010358|Ga0126370_11917503All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300010359|Ga0126376_12711365All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300010360|Ga0126372_10023318All Organisms → cellular organisms → Bacteria3708Open in IMG/M
3300010361|Ga0126378_10941016Not Available969Open in IMG/M
3300010361|Ga0126378_13113761All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium528Open in IMG/M
3300010366|Ga0126379_10169276All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2063Open in IMG/M
3300010379|Ga0136449_100823081All Organisms → cellular organisms → Bacteria1529Open in IMG/M
3300010398|Ga0126383_11556681Not Available751Open in IMG/M
3300011120|Ga0150983_14354016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium551Open in IMG/M
3300012096|Ga0137389_10982259All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300012189|Ga0137388_11156003All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300012203|Ga0137399_10047821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3086Open in IMG/M
3300012205|Ga0137362_11542732All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300012212|Ga0150985_112222353Not Available636Open in IMG/M
3300012353|Ga0137367_10862170All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium626Open in IMG/M
3300012356|Ga0137371_11273754All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium545Open in IMG/M
3300012361|Ga0137360_11444957Not Available591Open in IMG/M
3300012363|Ga0137390_11412381All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300012917|Ga0137395_10904361Not Available638Open in IMG/M
3300012918|Ga0137396_10704426Not Available745Open in IMG/M
3300012923|Ga0137359_10341520Not Available1331Open in IMG/M
3300012927|Ga0137416_11516650All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium609Open in IMG/M
3300012930|Ga0137407_11229474Not Available711Open in IMG/M
3300012930|Ga0137407_11448627Not Available653Open in IMG/M
3300012955|Ga0164298_10173131All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1236Open in IMG/M
3300012960|Ga0164301_10985346All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Fibrobacteria → Fibrobacterales → Fibrobacteraceae → Fibrobacter → unclassified Fibrobacter → Fibrobacter sp.661Open in IMG/M
3300012971|Ga0126369_10737868Not Available1064Open in IMG/M
3300012971|Ga0126369_11673969Not Available726Open in IMG/M
3300012986|Ga0164304_11878482All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium501Open in IMG/M
3300012989|Ga0164305_10842500Not Available765Open in IMG/M
3300013306|Ga0163162_12563958Not Available586Open in IMG/M
3300014169|Ga0181531_10421548All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter821Open in IMG/M
3300014200|Ga0181526_10659631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter660Open in IMG/M
3300014201|Ga0181537_10516187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter817Open in IMG/M
3300014489|Ga0182018_10572946All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300014502|Ga0182021_10446190All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300014657|Ga0181522_10916989All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter541Open in IMG/M
3300014745|Ga0157377_11668122All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium513Open in IMG/M
3300014969|Ga0157376_10754716Not Available982Open in IMG/M
3300015052|Ga0137411_1316644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1261Open in IMG/M
3300015054|Ga0137420_1475346All Organisms → cellular organisms → Bacteria2643Open in IMG/M
3300015241|Ga0137418_10445663All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300015264|Ga0137403_11314219All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300015372|Ga0132256_102223569Not Available653Open in IMG/M
3300016319|Ga0182033_11188913Not Available683Open in IMG/M
3300016357|Ga0182032_10207457All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300016387|Ga0182040_10532620Not Available943Open in IMG/M
3300016422|Ga0182039_11671568All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300016730|Ga0181515_1431258All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300017927|Ga0187824_10002022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5244Open in IMG/M
3300017927|Ga0187824_10041796All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171400Open in IMG/M
3300017930|Ga0187825_10093762Not Available1036Open in IMG/M
3300017936|Ga0187821_10085241All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1155Open in IMG/M
3300017946|Ga0187879_10729828All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300017948|Ga0187847_10548199All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300017970|Ga0187783_10037475All Organisms → cellular organisms → Bacteria3594Open in IMG/M
3300018016|Ga0187880_1373953All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter600Open in IMG/M
3300018024|Ga0187881_10487889All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300018030|Ga0187869_10597893All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300018034|Ga0187863_10510347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter673Open in IMG/M
3300018037|Ga0187883_10422204All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter684Open in IMG/M
3300018042|Ga0187871_10106471All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300018044|Ga0187890_10350931All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter827Open in IMG/M
3300018062|Ga0187784_11210549All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300018085|Ga0187772_11362495Not Available526Open in IMG/M
3300018433|Ga0066667_11078468Not Available694Open in IMG/M
3300019082|Ga0187852_1020751All Organisms → cellular organisms → Bacteria3294Open in IMG/M
3300019785|Ga0182022_1092281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1563Open in IMG/M
3300019787|Ga0182031_1028093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter524Open in IMG/M
3300019877|Ga0193722_1064361Not Available915Open in IMG/M
3300019879|Ga0193723_1069608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1016Open in IMG/M
3300019888|Ga0193751_1183896All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter716Open in IMG/M
3300020170|Ga0179594_10195045Not Available758Open in IMG/M
3300020170|Ga0179594_10427102All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium503Open in IMG/M
3300020581|Ga0210399_10046745All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3472Open in IMG/M
3300020581|Ga0210399_10947443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300021086|Ga0179596_10601498All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300021088|Ga0210404_10710287All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium573Open in IMG/M
3300021168|Ga0210406_10774403All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter732Open in IMG/M
3300021178|Ga0210408_10291543All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1301Open in IMG/M
3300021181|Ga0210388_11453168All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300021404|Ga0210389_10048332All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3263Open in IMG/M
3300021404|Ga0210389_10831991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter720Open in IMG/M
3300021407|Ga0210383_11246818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter623Open in IMG/M
3300021432|Ga0210384_10073861All Organisms → cellular organisms → Bacteria3068Open in IMG/M
3300021433|Ga0210391_10690389Not Available800Open in IMG/M
3300022512|Ga0242676_1043661All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300023101|Ga0224557_1238308All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300024227|Ga0228598_1021007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1285Open in IMG/M
3300025442|Ga0208034_1023005All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1650Open in IMG/M
3300025442|Ga0208034_1063764All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter713Open in IMG/M
3300025899|Ga0207642_10060777All Organisms → cellular organisms → Bacteria1754Open in IMG/M
3300025906|Ga0207699_10035039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2853Open in IMG/M
3300025906|Ga0207699_11182742All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Fibrobacteria → Fibrobacterales → Fibrobacteraceae → Fibrobacter → unclassified Fibrobacter → Fibrobacter sp.566Open in IMG/M
3300025914|Ga0207671_10468552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1004Open in IMG/M
3300025930|Ga0207701_10299622All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1396Open in IMG/M
3300025932|Ga0207690_10020615All Organisms → cellular organisms → Bacteria4076Open in IMG/M
3300025939|Ga0207665_10184026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1514Open in IMG/M
3300025990|Ga0208527_1021617Not Available772Open in IMG/M
3300026309|Ga0209055_1096291Not Available1193Open in IMG/M
3300026354|Ga0257180_1053215All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300026467|Ga0257154_1034058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter769Open in IMG/M
3300026514|Ga0257168_1014855All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300026537|Ga0209157_1032028All Organisms → cellular organisms → Bacteria3027Open in IMG/M
3300026547|Ga0209156_10088681All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1555Open in IMG/M
3300027061|Ga0209729_1011285Not Available1016Open in IMG/M
3300027545|Ga0209008_1099038All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300027559|Ga0209222_1087508All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter602Open in IMG/M
3300027587|Ga0209220_1153817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium594Open in IMG/M
3300027783|Ga0209448_10000111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae29302Open in IMG/M
3300027825|Ga0209039_10168668Not Available903Open in IMG/M
3300027842|Ga0209580_10606291All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117543Open in IMG/M
3300027869|Ga0209579_10518543Not Available647Open in IMG/M
3300027875|Ga0209283_10030892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3342Open in IMG/M
3300027882|Ga0209590_10826776All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300027898|Ga0209067_10168249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1168Open in IMG/M
3300027903|Ga0209488_10219839Not Available1429Open in IMG/M
3300027905|Ga0209415_11006544All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300028037|Ga0265349_1023092All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium569Open in IMG/M
3300028047|Ga0209526_10373540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter951Open in IMG/M
3300028381|Ga0268264_11836184Not Available616Open in IMG/M
3300028536|Ga0137415_11096544All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium609Open in IMG/M
3300028780|Ga0302225_10115109Not Available1311Open in IMG/M
3300028780|Ga0302225_10228079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter891Open in IMG/M
3300028799|Ga0307284_10159376Not Available874Open in IMG/M
3300029882|Ga0311368_10306251All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1202Open in IMG/M
3300029943|Ga0311340_10133545All Organisms → cellular organisms → Bacteria2641Open in IMG/M
3300029951|Ga0311371_10331011Not Available2122Open in IMG/M
3300029984|Ga0311332_10162300All Organisms → cellular organisms → Bacteria1665Open in IMG/M
3300029984|Ga0311332_10295881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1239Open in IMG/M
3300030007|Ga0311338_11649560All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300030048|Ga0302273_1086845Not Available927Open in IMG/M
3300030053|Ga0302177_10363363Not Available762Open in IMG/M
3300030743|Ga0265461_12850225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300030838|Ga0311335_10619657All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter758Open in IMG/M
3300030943|Ga0311366_10355601Not Available1273Open in IMG/M
3300031028|Ga0302180_10217006Not Available1020Open in IMG/M
3300031234|Ga0302325_13098479All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300031236|Ga0302324_102560590All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter621Open in IMG/M
3300031249|Ga0265339_10144823All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300031679|Ga0318561_10213218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1049Open in IMG/M
3300031680|Ga0318574_10129604All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1421Open in IMG/M
3300031708|Ga0310686_119005825All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300031720|Ga0307469_11716610Not Available605Open in IMG/M
3300031754|Ga0307475_11583447All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300031823|Ga0307478_10336468Not Available1242Open in IMG/M
3300031938|Ga0308175_101928727Not Available662Open in IMG/M
3300031954|Ga0306926_11752886All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium707Open in IMG/M
3300032001|Ga0306922_11184070All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium779Open in IMG/M
3300032025|Ga0318507_10258871Not Available755Open in IMG/M
3300032042|Ga0318545_10307102Not Available570Open in IMG/M
3300032261|Ga0306920_101973624Not Available818Open in IMG/M
3300032783|Ga0335079_10781811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium990Open in IMG/M
3300033004|Ga0335084_11162061Not Available772Open in IMG/M
3300033433|Ga0326726_12213455All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium534Open in IMG/M
3300033475|Ga0310811_10982342All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300033561|Ga0371490_1137725All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300033982|Ga0371487_0459112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter541Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.41%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.41%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.08%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.64%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.20%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.76%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.76%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.76%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.32%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.32%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.32%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.32%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.32%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.88%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.88%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.88%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.44%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.44%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.44%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.44%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.44%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.44%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.44%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.44%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.44%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.44%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.44%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.44%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300022512Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025990Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026354Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-BEnvironmentalOpen in IMG/M
3300026467Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-AEnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027061Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028037Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030048Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1030118913300001356Peatlands SoilRVRDESQLEAWQKVKQMAETCRHDRDLYLRFVGN*
JGI25390J43892_1000277313300002911Grasslands SoilDLYGKTVFNHLQMEIFLEEWERIRERAHDESQVDAWQKVKDMGLACQGDRDLYLKFLGN*
Ga0062384_10054709933300004082Bog Forest SoilFLREWDLAKDRVRDDSQLEAWQKVKQMAETCRKDRDLYLRFVGN*
Ga0062591_10095420323300004643SoilEEWGRVRDRAKDDSQQQAWQRVQEMALACKDDRDLYLRFVGN*
Ga0062594_10100466413300005093SoilFNHLQMERFLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN*
Ga0066672_1089091123300005167SoilWEKVRERAHDESQKEAWSKIKEMARTCEGDRDLYLRFVEH*
Ga0066683_1088586213300005172SoilQMETFLEEWERVRDRAKDESQQEAWQKVKEMAQTCKSDRDLYLRFVGN*
Ga0066680_1011527513300005174SoilNHLQMESFLEEWDRVRDRAHDESQQDAWQKVKNMAVACQVDRDLYLKFVGN*
Ga0066680_1037087923300005174SoilFLEEWERVRDRAKDESQQEAWQKVKEMAQTCKSDRDLYLRFVGN*
Ga0070670_10007454033300005331Switchgrass RhizosphereFLEEWGRVRDRAKDDSQQQAWQRVQEMALACKEDRDLYLRFVGN*
Ga0070666_1016665633300005335Switchgrass RhizosphereQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN*
Ga0070680_10136592223300005336Corn RhizosphereMESFLEEWDRVRDRARDDSQVEAWQKVKDMGEKCRADRDLYLRFVGN*
Ga0070659_10018193613300005366Corn RhizosphereLFNHLQMESFLEEWDRVRDRARDDSQVEAWQKVKDMGEKCRADRDLYLRFVGN*
Ga0070709_1032559913300005434Corn, Switchgrass And Miscanthus RhizosphereDRVQDRARDDSQADAWKRIRQMAETCRKDRDLYLKFVGN*
Ga0070711_10042824933300005439Corn, Switchgrass And Miscanthus RhizosphereFLLEWERVKDRAKDESQREAWQKVKEMAEHCKADRDLYLRFVGH*
Ga0066681_1043424013300005451SoilMESFLEEWERVRDRAHDESQIDAWQKVKNMALACQDDRDLYLKFVGN*
Ga0070663_10127998613300005455Corn RhizosphereVFNHLQMERFLEEWGRVRDRAKDDSQQQAWQRVQEMALACKDDRDLYLRFVGN*
Ga0070707_10080126613300005468Corn, Switchgrass And Miscanthus RhizosphereERVRERAHDESQKDAWRKVKDMALACQGDRDLYLKFVGN*
Ga0070741_1108234213300005529Surface SoilHLQMEIFLEEWDRVRERAKDESQIEAWQKIKEMAEKCRADRDLYLRFVGN*
Ga0070697_10203143423300005536Corn, Switchgrass And Miscanthus RhizosphereFLEEWERVRDRARDESQKEAWQKVKDMALACQGDRDLYLKFVGN*
Ga0070731_1058041113300005538Surface SoilEWDRVQNRAKDESQREAWQKVKEMAEICRLDRDLYLRFVGH*
Ga0066692_1069040013300005555SoilEPFLKEWDRAKDRVRDDTQLEAWEKVKHMAETCRHDRDLYLRFVGN*
Ga0066705_1035062813300005569SoilWERVRDRARDESQKEAWGKIKEMARTCENDRDLYLRFVGH*
Ga0066705_1037657323300005569SoilDRAKDESQREAWQKVKEMAEHCKADRDLYLRFVGH*
Ga0070761_1095403723300005591SoilHLQMEAFLGEWERAKDRVHDDSQLEGWEKVKQMAETCKTDRDLYLRFVGN*
Ga0070762_1007386133300005602SoilWERAKDRVHDDSQLEGWEKVKQMAETCKTDRDLYLRFVGN*
Ga0070702_10023599413300005615Corn, Switchgrass And Miscanthus RhizosphereVFNHLQMERFLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN*
Ga0070764_1039375313300005712SoilQEWERIQDRIRDESQKEAWKKVKEMAEACRQDRDLYLRFVGN*
Ga0068866_1010528913300005718Miscanthus RhizosphereLQMERFLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN*
Ga0066903_10854333813300005764Tropical Forest SoilLEEWARVEDRARDESQREAWRKVKEMAETCKGDRDLYLRFVGH*
Ga0068860_10277075423300005843Switchgrass RhizosphereNHLQMERFLEEWGRVRDRAKDDSQQQAWQRVQEMALACKDDRDLYLRFVGN*
Ga0068862_10254533223300005844Switchgrass RhizosphereQMERFLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN*
Ga0070766_1008273343300005921SoilNHLQMEPFLEEWDRTRDRIRDDSQKDAWQKVKEMAETCRADRDLYLRFVGN*
Ga0070717_1032249913300006028Corn, Switchgrass And Miscanthus RhizosphereEWERVKDRAKDESQREAWQKVKEMAEHCKADRDLYLRFVGH*
Ga0075023_10045919823300006041WatershedsGIDPFGKTVFNHLQIEAFLQEWDRAKDRVHDDSQLEAWQKVRQMAETCRDDRDLYLRFVGN*
Ga0066652_10005664153300006046SoilGRAHDESQVEAWQKIKEMAQICQQDRDLYLRFVGN*
Ga0066652_10128978213300006046SoilIFLEEWERIRDRAHDESQQDAWQKVKDMALACQDDRDLYLKFLGN*
Ga0075019_1088908413300006086WatershedsLKDRAKDESQRDAWQKVKEMAETCKSDRDLYLRFVGH*
Ga0075030_10046718913300006162WatershedsLQMEAFLIEWDRAKERVKDDTQLEAWEKVKHMAETCRHDRDLYLRFVGN*
Ga0070765_10074678433300006176SoilHLQMEAFLKEWDRAKDRVRDDTELEAWQKVKQMAETCRNDRDLYLRFVGN*
Ga0079222_1189319123300006755Agricultural SoilRERAHDESQKQAWEKIKEMAQTCQADRDLYLRFVGN*
Ga0066653_1028389923300006791SoilFNHLQMEMLLEEWERVHERAHDEAQKDAWQKVKDMALACQQDRDLYLKFVGN*
Ga0066659_1038125013300006797SoilIFLEEWERIRERAHDESQVDAWQKVKDMGLACQGDRDLYLKFLGN*
Ga0073928_1003505473300006893Iron-Sulfur Acid SpringQMEPFLKEWDRAKDRVRDDTQLQAWEKVKQMAETCRHDRDLYLRFVGN*
Ga0079219_1132227813300006954Agricultural SoilFLQEWERIRDRAKDESQKEAWQKVKEMAEACKSDRDLYLRFVGN*
Ga0075435_10094985013300007076Populus RhizosphereEGFLEEWERVKDRAHDDSQKEAWQKVREMAQSCQQDRDLFLRFVGN*
Ga0099827_1097224423300009090Vadose Zone SoilMESFLEEWDRVRDCAHDESQQDAWQKVKNMAVACQVDRDLYLKFVGN*
Ga0105240_1058662613300009093Corn RhizosphereEWERIHERARDESQKEAWQKVKEMAATCKQDRDLYLRFVGN*
Ga0066709_10215747813300009137Grasslands SoilQVRERAHDESQKEAWEKIKQMAQTCQADRDLYLRFVGN*
Ga0099792_1087042923300009143Vadose Zone SoilLQMEPFLKEWDRAKDRVRDDTQLQAWEKVKNMAETCLHDRDLYLRFVGN*
Ga0116222_115200223300009521Peatlands SoilAKDRARDESQLEAWEKVKQMAETCRHDRDLYLRFVGN*
Ga0116221_120668913300009523Peatlands SoilVFNHLQMEAFLKEWDRAKDRVRDESQLEAWQKIKQMAETCRHDRDLYLRFVGN*
Ga0116225_156554913300009524Peatlands SoilDRVRDESQLEAWQKVKQMAETCRDDRDLYLRFVGN*
Ga0116107_120762123300009548PeatlandRARDDSELEAWHKVKQMAETCRHDRDLYLRFVGN*
Ga0116125_107703113300009628PeatlandIKDRVRDETQREAWQKVKQMAETCRQDRDLYLRFLGN*
Ga0116119_116586823300009629PeatlandLQMEAFLKEWDRAKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN*
Ga0116102_115467113300009632PeatlandDRAKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN*
Ga0116117_101559223300009635PeatlandVKDRVRDDSQLEAWGKVKHMAETCRDDRDLYLRFVGN*
Ga0116110_111336043300009643PeatlandAKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN*
Ga0116217_1005600033300009700Peatlands SoilEAFLKEWDRVKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN*
Ga0116219_1056757213300009824Peatlands SoilAFLQEWDRAKERVRDESQLEAWQKVKQMAETCRDDRDLYLRFVGN*
Ga0116223_1001423663300009839Peatlands SoilFNHLQMEAFLKEWDRVKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN*
Ga0116223_1023925323300009839Peatlands SoilFNHLQMEAFLKEWDRVKDRVRDDSQLEAWEKVKHMAETCRRDRDLYLRFVGN*
Ga0126380_1010691633300010043Tropical Forest SoilFLEEWERVKDRARDESQRQAWQKVKQMAETCKSDRDLYLRFVGH*
Ga0126373_1045062623300010048Tropical Forest SoilQDRAKDESQREAWQKIKEMAEICKLDRDLYLRFVGH*
Ga0134067_1013546123300010321Grasslands SoilMEAFLGEWERVRDRAKDEAQREAWQKVKDMAQHCQRDRDLYLRFVGN*
Ga0074045_1008389233300010341Bog Forest SoilLKEWDRVKDRVRDESQLEAWQKVKQMAETCRLDRDLYLRFVGN*
Ga0074045_1013206023300010341Bog Forest SoilENFLKEWDRVKDRVRDDSQLDAWGKVKHMAETCRDDRDLYLRFVGN*
Ga0074044_1007647113300010343Bog Forest SoilMAAFLQEWDRAKDRVHDDSQLEAWQKVKQMAETCRDNRDLYLRFVGN*
Ga0126370_1191750323300010358Tropical Forest SoilDRALDDPQKDAWQKIKEIAQTCKEDRDLYLRFVGN*
Ga0126376_1271136523300010359Tropical Forest SoilVFNHRQMEEFLREWELVKARVKDDSQMEAWERVKKMAESCAQDRDLYLRFVGN*
Ga0126372_1002331843300010360Tropical Forest SoilVQDRAKDESQREAWQKVKEMAEICKLDRDLYLRFVGH*
Ga0126378_1094101613300010361Tropical Forest SoilLQMEAFLEEWDRIQHRAEDDSQKQAWQKVKDMARSCQSDRDLYLRFVGN*
Ga0126378_1311376123300010361Tropical Forest SoilVFNHLQMEAFLEEWDRIQHRAEDDSQKQAWQKVKDMARNCQSDRDLYLRFVGN*
Ga0126379_1016927613300010366Tropical Forest SoilRAKDESQREAWQKVKEMAETCKSDRDLYLRFVGH*
Ga0136449_10082308113300010379Peatlands SoilEWDRVKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN*
Ga0126383_1155668113300010398Tropical Forest SoilHLQMEPFLAEWHRIEGRARDESQRQAWRKVKEMAETCGADRDLYLRFVGH*
Ga0150983_1435401623300011120Forest SoilVFNHLQMEPFLKEWDRAKDRVRDDTQLEAWQKVKQMAETCRHDRDLYLRFVGN*
Ga0137389_1098225913300012096Vadose Zone SoilREWDRAKDRAHDDTQLQAWQKVKHMAETCRHDRDLYLRFVGN*
Ga0137388_1115600333300012189Vadose Zone SoilFLREWDRAKDRAHDDTQLQAWQKVKHMAETCRHDRDLYLRFVGN*
Ga0137399_1004782133300012203Vadose Zone SoilAEAFLEEWERVQDRARDDSQREAWQKVKEMAEICKSDRDLYLRFVGH*
Ga0137362_1154273213300012205Vadose Zone SoilPFLEEWQRARERAKDDSQNQAWERVKGMAETCQKDRDLYLKFVGN*
Ga0150985_11222235313300012212Avena Fatua RhizosphereVFNHLQMDAFLEEWERIHVRARDESQKEAWQKVKEMAATCKQDRDLYLRFVGN*
Ga0137367_1086217013300012353Vadose Zone SoilLQMHEFLREWENVKDRIRDESQMEAWARVKQMAETCRDDRDLYLRFVGN*
Ga0137371_1127375423300012356Vadose Zone SoilETFLAEWEQVRERAHDESQKEAWEKIKQMAQTCQADRDLYLRFVGS*
Ga0137360_1144495723300012361Vadose Zone SoilQMEMFLEEWERVRERARDESQKEAWQKVKDMAMACQQDRDLYLKFVGN*
Ga0137390_1141238123300012363Vadose Zone SoilLQMELFLREWDRAKDRAHDDTQLQAWQKVKHMAETCRHDRDLYLRFVGN*
Ga0137395_1090436113300012917Vadose Zone SoilTFLEEWERVRERAKDEPQQEAWKKVKEMAQTCKSDRDLYLRFVGN*
Ga0137396_1070442623300012918Vadose Zone SoilEWERVQDRARDDSQREAWQRVKEMAEICKSDRDLYLRFVGH*
Ga0137359_1034152023300012923Vadose Zone SoilFLAEWDRVKDRARDESQMEAWHKVRQMAETCSEDRDLYLRFVGN*
Ga0137416_1151665023300012927Vadose Zone SoilIRGFERVKDRARDESQREAWQKVKEMAATCKSDRDLYLRFVGH*
Ga0137407_1122947413300012930Vadose Zone SoilVFLAEWERVKDRARDESQTEAWQKVRQMAETCREDRDLYLRFVGN*
Ga0137407_1144862713300012930Vadose Zone SoilEEWERVRDRAHDESQQDAWQKVKNMAVACQVDRDLYLKFVGN*
Ga0164298_1017313133300012955SoilAEWDRVQDRARDDSQADAWKRIRQMAETCRKDRDLYLKFVGN*
Ga0164301_1098534623300012960SoilQMEPFLAEWDRVQDRARDDSQADAWKRIRQMAETCRKDRDLYLKFVGN*
Ga0126369_1073786813300012971Tropical Forest SoilDRAHDDSQKEAWQKVREMAQSCQQDRDLFLRFVGN*
Ga0126369_1167396923300012971Tropical Forest SoilQVKDRARDQSQMEAWQKIKEMAETCREDRDLYLRFVGN*
Ga0164304_1187848223300012986SoilVRDRARDDSQVEAWQKVKEMGEKCRADRDLYLRFVGN*
Ga0164305_1084250023300012989SoilHLQMESFLEEWDRVRERARDDSQVEAWQKVKEMGEKCRADRDLYLRFVGN*
Ga0163162_1256395823300013306Switchgrass RhizosphereWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN*
Ga0181531_1042154813300014169BogTVFNHLQMEAFLKEWERAKDRVRDDNQLEGWKKVKQMAETCKTDRDLYLRFVGN*
Ga0181526_1065963123300014200BogRVRDDSQLEAWNRVKGMAEACRKDRDLYLRFVGN*
Ga0181537_1051618723300014201BogFLQEWERAKERARDESQMEAWSKVKEMAEACRHDRDLYLRFVGN*
Ga0182018_1057294623300014489PalsaKDRVRDDSQLEAWEKVKNMAETCRHDRDLYLRFVGN*
Ga0182021_1044619033300014502FenVFNHLQMEAFLKEWDRAKDRVRDDSQLEAWEKVKQMAETCRDDRDLYLRFVGN*
Ga0181522_1091698913300014657BogRARDESQMEAWNKVKEMAEACRHDRDLYLRFVGN*
Ga0157377_1166812213300014745Miscanthus RhizosphereRDRARDDSQVEAWQKVKDMGEKCRADRDLYLRFVGN*
Ga0157376_1075471633300014969Miscanthus RhizosphereLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN*
Ga0137411_131664413300015052Vadose Zone SoilQDRARDDSQREAWQRVKEMAEICKSDRDLYLRFVGH*
Ga0137420_147534653300015054Vadose Zone SoilMETFLEEWERVRDRAKDEPQQEAWKKVKEMAENCKGDRDLYLRFVGN*
Ga0137418_1044566313300015241Vadose Zone SoilKERARDESQIEAWRKVKEMAETCREDRDLYLRFVGN*
Ga0137403_1131421913300015264Vadose Zone SoilRAREFAKDDSQYQDWERVKGMAETCQKDRDLYLKFVGN*
Ga0132256_10222356923300015372Arabidopsis RhizosphereLEEWERIHERARDESQKEAWQKVKEMAATCKQDRDLYLRFVGN*
Ga0182033_1118891313300016319SoilNHLQMESFLEEWERIQHRAEDDSQKEAWQKVKDMARNCQSDRDLYLRFVGN
Ga0182032_1020745723300016357SoilMESFLEEWGRVQERAKDDTQREAWQKVKDMAETCRQDRDLYLRFVGHGH
Ga0182040_1053262013300016387SoilQAETFLAEWERVKDRAKDESQSEAWQKVKEMAEACKSDRDLYLKFIGH
Ga0182039_1167156823300016422SoilVRDRAKDESQREAWQKVKEMAETCKSDRDLYLRFVGH
Ga0181515_143125813300016730PeatlandETFLREWDRAKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN
Ga0187824_1000202213300017927Freshwater SedimentMERAKDRAKDESQTEAWQKVKEMAEACKSDRDLYLKFIGH
Ga0187824_1004179613300017927Freshwater SedimentERARDDSQQQVWNKIKEMAESCRDDRDLFLRFVGN
Ga0187825_1009376223300017930Freshwater SedimentLVEWERAKDRAKDESQTEAWQKVKEMAEACKSDRDLYLKFIGH
Ga0187821_1008524113300017936Freshwater SedimentTRAEWERVKDRAKDESQSEAWQKVKEMAEACKSDRDLYLKFIGH
Ga0187879_1072982813300017946PeatlandLQMEAFLKEWERAKDRVRDDNQLEAWEKVKHMAETCRHDRDLYLRFVGN
Ga0187847_1054819923300017948PeatlandVKDRVRDESQLEAWEKVKHMAETCRDDRDLYLRFLGN
Ga0187783_1003747513300017970Tropical PeatlandFGKTVFNHLQMEAFLQEWERAKERVRDESQMEAWEKIKGMAEACRKDRDLFLRFVGH
Ga0187880_137395313300018016PeatlandERVHDDSQLEAWEKVKQMAETCRRDRDLYLRFVGN
Ga0187881_1048788923300018024PeatlandKEWDRAKARVRDESQLEAWEKVKQMAEICRHDRDLYLRFVGN
Ga0187869_1059789313300018030PeatlandVFNHLQMEAFLKEWDRAKDRVRDESQLEAWQKIKQMAETCRHDRDLYLRFVGN
Ga0187863_1051034723300018034PeatlandLKEWDRAKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN
Ga0187883_1042220413300018037PeatlandVFLKEWERARERVHDENQLEAWEKVKQMAETCRQDRDLYLRFVGN
Ga0187871_1010647113300018042PeatlandTFLQEWDRAKDRVRDDSELEAWEKVKHMAETCRHDRDLYLRFVGN
Ga0187890_1035093113300018044PeatlandRIKDRVRDETQREAWQKVKQMAETCRQDRDLYLRFLGN
Ga0187784_1121054923300018062Tropical PeatlandENFLKEWERVKERARDDSQLEAWQKVKQMAETCRDDRDLYLRFVGN
Ga0187772_1136249523300018085Tropical PeatlandWNRAKNRVRDEQQMEAWQKVKQMAEACRDDRDLYLRFVGH
Ga0066667_1107846813300018433Grasslands SoilTVFNHLQMEIFLEEWERIRDRAHDESQQDAWQKVKDMALACQDDRDLYLKFLGN
Ga0187852_102075113300019082PeatlandTVFNHLQMEAFLEEWDRVKDRVHDDSQLEAWEKVKLMAETCRHDRDLYLRFVGN
Ga0182022_109228113300019785FenMTAFLEEWDRVKDRVHDDSQLEAWERVKHMAETCRDDRDLYLRFVGN
Ga0182031_102809313300019787BogAWGSDDSQLEAWGKVKHMAETCRDDRDLYLRFVGN
Ga0193722_106436123300019877SoilERVKDRAKDESQSAAWQKVKEMAETCKSDRDLYLRFVGH
Ga0193723_106960833300019879SoilSFLEEWERVRDRAHDESQIDAWQKVKNMALACQDDRDLYLKFLGN
Ga0193751_118389613300019888SoilFLKEWDRAKDRVRDDTQLEAWQKVKQMAETCRHDRDLYLRFVGN
Ga0179594_1019504523300020170Vadose Zone SoilWERVKDRARDESQREAWQKVKEMAATCKSDRDLYLRFVGH
Ga0179594_1042710223300020170Vadose Zone SoilEQVRERAHDESQKEAWEKIKQMAQTCQTDRDLYLRFVGN
Ga0210399_1004674513300020581SoilRAKDRVRDDTQLEAWQKVKQMAETCSHDRDLYLRFVGN
Ga0210399_1094744323300020581SoilHLQAETFLLEWERVKDRAKDESQREAWQKVKEMAEHCKADRDLYLRFVGH
Ga0179596_1060149813300021086Vadose Zone SoilWDRAKDRAHDDTQLQAWQKVKHMAETCRHDRDLYLRFVGN
Ga0210404_1071028723300021088SoilHLQAETFLVEWERVQDRAKDESQREAWQKVKEMAENCKADRDLYLRFVGH
Ga0210406_1077440313300021168SoilAKDRVRDDTQLEAWLKVKQMAETCRHDRDLYLRFVGN
Ga0210408_1029154333300021178SoilQVVGFLEEWERVKDRAKDESQREAWQKVKEMAEACKTDRDLYLRFVGH
Ga0210388_1145316813300021181SoilRAKDLVRDDTELEAWQKVKQMAETCRNDRDLYLRFVGN
Ga0210389_1004833213300021404SoilHLQMESFLEEWVRVQECAKDDTQREAWQKVKDMAETCSQDRDLFLRFVGHGH
Ga0210389_1083199123300021404SoilRDRAKDESQREAWQKIKEMAEICRLDRDLYLRFVGH
Ga0210383_1124681823300021407SoilLLKEWERVKDRVKDDSQKEAWEKVKEMAETCRHDRDLYLRFVGN
Ga0210384_1007386113300021432SoilDRAKDRVRDDTQLEAWQKVKQMAETCRHDRDLYLRFVGN
Ga0210391_1069038913300021433SoilEWDRAKDRVRDDTELEAWQKVKQMAETCRNDRDLYLRFVGN
Ga0242676_104366123300022512SoilSFGKTVFNHLQMESFLEEWERIRDRAHDDTQRDAWQKVKDLALACQQDRDLYLRFVGN
Ga0224557_123830813300023101SoilLKEWDCVRERARDDSQVEAWQRVKTMAEACREDRDLYLRFVGH
Ga0228598_102100713300024227RhizosphereIRVRARDDTQQDAWQKVKDLALVCQQDRDLYLRFVGN
Ga0208034_102300533300025442PeatlandKEWDRAKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN
Ga0208034_106376413300025442PeatlandKDRARDESQLEAWEKVKQMAETCRRDRDLYLRFVGN
Ga0207642_1006077733300025899Miscanthus RhizosphereEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN
Ga0207699_1003503933300025906Corn, Switchgrass And Miscanthus RhizosphereEWERVEERAHDESQKEAWRKVKEMAESCQADRDLYLRFVGN
Ga0207699_1118274213300025906Corn, Switchgrass And Miscanthus RhizosphereLAEWDRVQDRARDDSQADAWKRIRQMAETCRKDRDLYLKFVGN
Ga0207671_1046855233300025914Corn RhizosphereLEEWDRVRDRARDDSQVEAWQKVKDMGEKCRADRDLYLRFVGN
Ga0207701_1029962213300025930Corn, Switchgrass And Miscanthus RhizosphereFLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN
Ga0207690_1002061513300025932Corn RhizosphereRFLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN
Ga0207665_1018402613300025939Corn, Switchgrass And Miscanthus RhizosphereLAEWERVRERARDESQKEAWEKIKQMAQTCQTDRDLYLRFVGN
Ga0208527_102161713300025990Rice Paddy SoilKVRGRAHDDSQVLAWSKVKEMAQVCQKDRDLYLKFVGN
Ga0209055_109629123300026309SoilWERVKDRAKDESQREAWQKVKEMAEHCKADRDLYLRFVGH
Ga0257180_105321523300026354SoilQMSVFLAEWERVKDRARDESQTEAWQKVRQMAETCREDRDLYLRFVGN
Ga0257154_103405823300026467SoilMEFFLQEWERIQDRIRDESQKEAWKKVKEMAEACRQDRDLYLRFVGN
Ga0257168_101485543300026514SoilELFLREWDRAKDRAHDDTQLQAWQKVKHMAETCRHDRDLYLRFVGN
Ga0209157_103202813300026537SoilQVRERAHDESQKEAWEKIKQMAQTCQTDRDLYLRFVGN
Ga0209156_1008868113300026547SoilVRGRAHDESQVEAWQKIKEMAQICQQDRDLYLRFVGN
Ga0209729_101128513300027061Forest SoilVKDRAKDESQREAWQKVKEMAEHCKADRDLYLRFVGH
Ga0209008_109903823300027545Forest SoilEWDRAKDRVHDDSQLEAWEKVKHMAESCLQDRDLYLRFVGN
Ga0209222_108750823300027559Forest SoilHLQMEAFLAEWDRIRDRVRDDAQLEAWQKVKQMAETCRQDRDLYLRFVGN
Ga0209220_115381723300027587Forest SoilLKEWDRAKDRVRDDTQLEAWQKVKQMAETCRHDRDLYLRFVGN
Ga0209448_1000011113300027783Bog Forest SoilKDRARDESQLEAWGKVKQMAETCRHDRDLYLRFVGN
Ga0209039_1016866823300027825Bog Forest SoilLQMEAFLKEWDRAKDRVHDDSQLAAWEKVKHMAEICRHDRDLYLRFVGN
Ga0209580_1060629123300027842Surface SoilLQAAEFLEEWNRVKERARDDSQQQVWNKIKEMAESCRDDRDLFLRFVGN
Ga0209579_1051854323300027869Surface SoilEWDRVQNRAKDESQREAWQKVKEMAEICRLDRDLYLRFVGH
Ga0209283_1003089233300027875Vadose Zone SoilDRAKDESQQEAWQKVKEMAQTCKSDRDLYLRFVGN
Ga0209590_1082677613300027882Vadose Zone SoilKRVRDRAKDEPQQEAWKKVKEMAENCKGDRDLYLRFVGN
Ga0209067_1016824913300027898WatershedsLKDRAKDESQRDAWQKVKEMAETCKSDRDLYLRFVGH
Ga0209488_1021983923300027903Vadose Zone SoilQMTVFLAEWERVKDRARDESQVEAWQKVKQMAESCRDDRDLYLRFVGN
Ga0209415_1100654413300027905Peatlands SoilFNHLQMEAFLKEWDRAKDRVRDESQLEAWQKVKQMAETCRHDRDLYLRFVGN
Ga0265349_102309223300028037SoilKTVFNHLQMESFLEEWERIRDRAHDDTQRDAWQKVKDLALACQQDRDLYLRFVGN
Ga0209526_1037354023300028047Forest SoilHLQMEPFLKEWDRVKDRVRDDTQLEAWQKVKQMAETCRHDRDLYLRFVGN
Ga0268264_1183618413300028381Switchgrass RhizosphereVFNHLQMERFLEEWGRVRDRAKDDSQQQAWQRVQEMALACKDDRDLYLRFVGN
Ga0137415_1109654413300028536Vadose Zone SoilLEEWERVKDRARDESQREAWQKVKEMAATCKSDRDLYLRFVGH
Ga0302225_1011510933300028780PalsaHLQMEAFLKEWDRAKDRVRDDSQLDAWEKVKHMAETCRHDRDLYLRFVGN
Ga0302225_1022807923300028780PalsaTVFNHLQMEAFLQEWERAKDRVRDDSQLEGWGKVKQMAETCRTDRDLYLRFVGN
Ga0307284_1015937613300028799SoilIFLEEWERIRERAHDESQVDAWQKVKDMGLACQGDRDLYLKFLGN
Ga0311368_1030625113300029882PalsaETFLEEWERVRDRARDDAQRDAWQKIKDLALACQQDRDLYLRFVGN
Ga0311340_1013354513300029943PalsaFLQEWERAKDRVRDDSQLEGWGKVKQMAETCRTDRDLYLRFVGN
Ga0311371_1033101113300029951PalsaMEVFLKEWDRAKDRVRDESQLEAWEKVKHMAETCRHDRDLYLRFVGN
Ga0311332_1016230033300029984FenLAEWERAKDRARDDSQVEAWKRVKEMAEACRQDRDLYLRFVGN
Ga0311332_1029588133300029984FenGFLDEWERVRDRATDDPQKDAWQKIKEMAETCKEDRDLYLRFIGN
Ga0311338_1164956013300030007PalsaETFLREWDRAKDHARDESQLEAWEKVKTMAETCRQDRDLYLRFVGN
Ga0302273_108684523300030048BogMEAFLREWERAKDRARDESQMEAWEKIKKMAEACRQDRDLYLRFVGN
Ga0302177_1036336313300030053PalsaPFGKTVFNHLQMEAFLKEWDRAKDRVRDDSQLDAWEKVKHMAETCRHDRDLYLRFVGN
Ga0265461_1285022523300030743SoilAKDRVRDDSQLEGWEKVKQMAETCKQDRDLYLRFVGN
Ga0311335_1061965723300030838FenPFGKTVFNHLQMAALLAEWERAKDRARDDSQVEAWKRVKEMAEACRQDRDLYLRFVGN
Ga0311366_1035560113300030943FenKTVFNHLQMAVFLSEWERVKDRARDESQMEAWQKVKEMAEHCSSDRDLYLRFVGN
Ga0302180_1021700623300031028PalsaKEWDRAKDRVRDDSQLDAWEKVKHMAETCRHDRDLYLRFVGN
Ga0302325_1309847913300031234PalsaLREWDRAKDRVRDDSQKEAWQKVKEMAETCRHDRDLYLRFVGN
Ga0302324_10256059023300031236PalsaHRQMEAFLKEWDRVKDRVHDENQLEAWKKVKEMAETCRQDRDLYLRFVGN
Ga0265339_1014482313300031249RhizosphereQMEAFLKEWDRIKARVHDDSQLEAWEKVKAMAETCRDDRDLYLRFVGN
Ga0318561_1021321813300031679SoilKDRAKDESQSEAWQKVKEMAEACKSDRDLYLKFIGH
Ga0318574_1012960433300031680SoilEWGRVHERAKDDTQREAWQKVKDMAETCRQDRDLYLRFVGHGH
Ga0310686_11900582513300031708SoilKDRVRDDSQKDAWQKVKEMAETCRADRDLYLRFVGN
Ga0307469_1171661013300031720Hardwood Forest SoilTFLTEWERVKERAKDESQREAWQKVKEMAETCKSDRDLYLRFVGH
Ga0307475_1158344723300031754Hardwood Forest SoilVFNHLQADEFLAEWERVRDRAKDESQREAWQKVKEMAEICKLDRDLYLRFVGH
Ga0307478_1033646823300031823Hardwood Forest SoilREWDRAKDRVRDDNQLEAWNKVKSMAELCRDDRDLYLRFVGN
Ga0308175_10192872713300031938SoilEWDRVRDRARDDSQVEAWQKVKEMGEKCRADRDLYLRFVGN
Ga0306926_1175288613300031954SoilWERVRDRAKDESQREAWQKVKEMAETCKSDRDLYLRFVGH
Ga0306922_1118407013300032001SoilTVFNHLQAEVFLEEWERVRDRAKDESQREAWEKVKEMAEICKSDRDLYLRFVGH
Ga0318507_1025887113300032025SoilFLAEWERVKDRAKDESQSEAWQKVKEMAEACKSDRDLYLKFIGH
Ga0318545_1030710213300032042SoilVKDRAKDESQSEAWQKVKEMAEACKSDRDLYLKFIGH
Ga0306920_10197362413300032261SoilERVRDRAKDESQREAWEKVKEMAEICKSDRDLYLRFVGH
Ga0335079_1078181123300032783SoilFNHMQMEAFLKEWERIKERVRDDSQLEAWQRVKQMAETCRLDRDLYLRFVGH
Ga0335084_1116206113300033004SoilWDRVKERARDESQAEAWKKVREMAEACREDRDLYLRFVGN
Ga0326726_1221345523300033433Peat SoilLQMETFLEEWERVRHRAQDESQKEAWQKVKEMAQTCQTDRDLYLRFVGN
Ga0310811_1098234223300033475SoilDEWERIRDRARDESQKAGWQKVKEMAEKCRDDRDLYLRFVGN
Ga0371490_113772523300033561Peat SoilNHLQMEAFLKEWDRVKDRARDDSELEAWHKVKHMAETCRHDRDLYLRFVGN
Ga0371487_0459112_403_5403300033982Peat SoilAFLEEWERVKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.