Basic Information | |
---|---|
Family ID | F019859 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 227 |
Average Sequence Length | 44 residues |
Representative Sequence | LKEWDRVKDRVRDESQLEAWQKVKQMAETCRLDRDLYLRFVGN |
Number of Associated Samples | 211 |
Number of Associated Scaffolds | 227 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.44 % |
% of genes near scaffold ends (potentially truncated) | 97.36 % |
% of genes from short scaffolds (< 2000 bps) | 88.99 % |
Associated GOLD sequencing projects | 199 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.449 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.894 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.145 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.899 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 227 Family Scaffolds |
---|---|---|
PF14520 | HHH_5 | 49.34 |
PF01244 | Peptidase_M19 | 25.11 |
PF01850 | PIN | 4.85 |
PF07499 | RuvA_C | 4.41 |
PF04337 | DUF480 | 1.32 |
PF05496 | RuvB_N | 0.88 |
PF13751 | DDE_Tnp_1_6 | 0.88 |
PF00216 | Bac_DNA_binding | 0.88 |
PF01425 | Amidase | 0.44 |
PF04014 | MazE_antitoxin | 0.44 |
PF13895 | Ig_2 | 0.44 |
PF00698 | Acyl_transf_1 | 0.44 |
PF06452 | CBM9_1 | 0.44 |
PF02518 | HATPase_c | 0.44 |
PF01330 | RuvA_N | 0.44 |
PF14534 | DUF4440 | 0.44 |
PF01809 | YidD | 0.44 |
PF03796 | DnaB_C | 0.44 |
PF01467 | CTP_transf_like | 0.44 |
PF05227 | CHASE3 | 0.44 |
PF00589 | Phage_integrase | 0.44 |
PF00578 | AhpC-TSA | 0.44 |
PF11412 | DsbC | 0.44 |
PF13462 | Thioredoxin_4 | 0.44 |
PF04120 | Iron_permease | 0.44 |
COG ID | Name | Functional Category | % Frequency in 227 Family Scaffolds |
---|---|---|---|
COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 25.11 |
COG0632 | Holliday junction resolvasome RuvABC DNA-binding subunit | Replication, recombination and repair [L] | 4.85 |
COG3132 | Uncharacterized conserved protein YceH, UPF0502 family | Function unknown [S] | 1.32 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.88 |
COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.88 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.44 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.44 |
COG0759 | Membrane-anchored protein YidD, putatitve component of membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.44 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.45 % |
Unclassified | root | N/A | 25.55 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10301189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 578 | Open in IMG/M |
3300002911|JGI25390J43892_10002773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3792 | Open in IMG/M |
3300004082|Ga0062384_100547099 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300004643|Ga0062591_100954203 | Not Available | 810 | Open in IMG/M |
3300005093|Ga0062594_101004664 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300005167|Ga0066672_10890911 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 552 | Open in IMG/M |
3300005172|Ga0066683_10885862 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 512 | Open in IMG/M |
3300005174|Ga0066680_10115275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1657 | Open in IMG/M |
3300005174|Ga0066680_10370879 | Not Available | 911 | Open in IMG/M |
3300005331|Ga0070670_100074540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2915 | Open in IMG/M |
3300005335|Ga0070666_10166656 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
3300005336|Ga0070680_101365922 | Not Available | 613 | Open in IMG/M |
3300005366|Ga0070659_100181936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1725 | Open in IMG/M |
3300005434|Ga0070709_10325599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1129 | Open in IMG/M |
3300005439|Ga0070711_100428249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1079 | Open in IMG/M |
3300005451|Ga0066681_10434240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 806 | Open in IMG/M |
3300005455|Ga0070663_101279986 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300005468|Ga0070707_100801266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 906 | Open in IMG/M |
3300005529|Ga0070741_11082342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 682 | Open in IMG/M |
3300005536|Ga0070697_102031434 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 515 | Open in IMG/M |
3300005538|Ga0070731_10580411 | Not Available | 746 | Open in IMG/M |
3300005555|Ga0066692_10690400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
3300005569|Ga0066705_10350628 | Not Available | 931 | Open in IMG/M |
3300005569|Ga0066705_10376573 | Not Available | 892 | Open in IMG/M |
3300005591|Ga0070761_10954037 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005602|Ga0070762_10073861 | All Organisms → cellular organisms → Bacteria | 1925 | Open in IMG/M |
3300005615|Ga0070702_100235994 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300005712|Ga0070764_10393753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 817 | Open in IMG/M |
3300005718|Ga0068866_10105289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1564 | Open in IMG/M |
3300005764|Ga0066903_108543338 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 522 | Open in IMG/M |
3300005843|Ga0068860_102770754 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005844|Ga0068862_102545332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 523 | Open in IMG/M |
3300005921|Ga0070766_10082733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1871 | Open in IMG/M |
3300006028|Ga0070717_10322499 | Not Available | 1376 | Open in IMG/M |
3300006041|Ga0075023_100459198 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300006046|Ga0066652_100056641 | All Organisms → cellular organisms → Bacteria | 2984 | Open in IMG/M |
3300006046|Ga0066652_101289782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 689 | Open in IMG/M |
3300006086|Ga0075019_10889084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300006162|Ga0075030_100467189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1004 | Open in IMG/M |
3300006176|Ga0070765_100746784 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300006755|Ga0079222_11893191 | Not Available | 581 | Open in IMG/M |
3300006791|Ga0066653_10283899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 838 | Open in IMG/M |
3300006797|Ga0066659_10381250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1103 | Open in IMG/M |
3300006893|Ga0073928_10035054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4742 | Open in IMG/M |
3300006954|Ga0079219_11322278 | Not Available | 636 | Open in IMG/M |
3300007076|Ga0075435_100949850 | Not Available | 750 | Open in IMG/M |
3300009090|Ga0099827_10972244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
3300009093|Ga0105240_10586626 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300009137|Ga0066709_102157478 | Not Available | 769 | Open in IMG/M |
3300009143|Ga0099792_10870429 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300009521|Ga0116222_1152002 | Not Available | 996 | Open in IMG/M |
3300009523|Ga0116221_1206689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 850 | Open in IMG/M |
3300009524|Ga0116225_1565549 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300009548|Ga0116107_1207621 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300009628|Ga0116125_1077031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 872 | Open in IMG/M |
3300009629|Ga0116119_1165868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 551 | Open in IMG/M |
3300009632|Ga0116102_1154671 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300009635|Ga0116117_1015592 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
3300009643|Ga0116110_1113360 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
3300009700|Ga0116217_10056000 | All Organisms → cellular organisms → Bacteria | 2831 | Open in IMG/M |
3300009824|Ga0116219_10567572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 625 | Open in IMG/M |
3300009839|Ga0116223_10014236 | All Organisms → cellular organisms → Bacteria | 5837 | Open in IMG/M |
3300009839|Ga0116223_10239253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1098 | Open in IMG/M |
3300010043|Ga0126380_10106916 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
3300010048|Ga0126373_10450626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1321 | Open in IMG/M |
3300010321|Ga0134067_10135461 | Not Available | 869 | Open in IMG/M |
3300010341|Ga0074045_10083892 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
3300010341|Ga0074045_10132060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1707 | Open in IMG/M |
3300010343|Ga0074044_10076471 | Not Available | 2264 | Open in IMG/M |
3300010358|Ga0126370_11917503 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300010359|Ga0126376_12711365 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300010360|Ga0126372_10023318 | All Organisms → cellular organisms → Bacteria | 3708 | Open in IMG/M |
3300010361|Ga0126378_10941016 | Not Available | 969 | Open in IMG/M |
3300010361|Ga0126378_13113761 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 528 | Open in IMG/M |
3300010366|Ga0126379_10169276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2063 | Open in IMG/M |
3300010379|Ga0136449_100823081 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300010398|Ga0126383_11556681 | Not Available | 751 | Open in IMG/M |
3300011120|Ga0150983_14354016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 551 | Open in IMG/M |
3300012096|Ga0137389_10982259 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300012189|Ga0137388_11156003 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300012203|Ga0137399_10047821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3086 | Open in IMG/M |
3300012205|Ga0137362_11542732 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300012212|Ga0150985_112222353 | Not Available | 636 | Open in IMG/M |
3300012353|Ga0137367_10862170 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 626 | Open in IMG/M |
3300012356|Ga0137371_11273754 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 545 | Open in IMG/M |
3300012361|Ga0137360_11444957 | Not Available | 591 | Open in IMG/M |
3300012363|Ga0137390_11412381 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300012917|Ga0137395_10904361 | Not Available | 638 | Open in IMG/M |
3300012918|Ga0137396_10704426 | Not Available | 745 | Open in IMG/M |
3300012923|Ga0137359_10341520 | Not Available | 1331 | Open in IMG/M |
3300012927|Ga0137416_11516650 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 609 | Open in IMG/M |
3300012930|Ga0137407_11229474 | Not Available | 711 | Open in IMG/M |
3300012930|Ga0137407_11448627 | Not Available | 653 | Open in IMG/M |
3300012955|Ga0164298_10173131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1236 | Open in IMG/M |
3300012960|Ga0164301_10985346 | All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Fibrobacteria → Fibrobacterales → Fibrobacteraceae → Fibrobacter → unclassified Fibrobacter → Fibrobacter sp. | 661 | Open in IMG/M |
3300012971|Ga0126369_10737868 | Not Available | 1064 | Open in IMG/M |
3300012971|Ga0126369_11673969 | Not Available | 726 | Open in IMG/M |
3300012986|Ga0164304_11878482 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 501 | Open in IMG/M |
3300012989|Ga0164305_10842500 | Not Available | 765 | Open in IMG/M |
3300013306|Ga0163162_12563958 | Not Available | 586 | Open in IMG/M |
3300014169|Ga0181531_10421548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 821 | Open in IMG/M |
3300014200|Ga0181526_10659631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 660 | Open in IMG/M |
3300014201|Ga0181537_10516187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 817 | Open in IMG/M |
3300014489|Ga0182018_10572946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300014502|Ga0182021_10446190 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300014657|Ga0181522_10916989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 541 | Open in IMG/M |
3300014745|Ga0157377_11668122 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 513 | Open in IMG/M |
3300014969|Ga0157376_10754716 | Not Available | 982 | Open in IMG/M |
3300015052|Ga0137411_1316644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1261 | Open in IMG/M |
3300015054|Ga0137420_1475346 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
3300015241|Ga0137418_10445663 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300015264|Ga0137403_11314219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300015372|Ga0132256_102223569 | Not Available | 653 | Open in IMG/M |
3300016319|Ga0182033_11188913 | Not Available | 683 | Open in IMG/M |
3300016357|Ga0182032_10207457 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
3300016387|Ga0182040_10532620 | Not Available | 943 | Open in IMG/M |
3300016422|Ga0182039_11671568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300016730|Ga0181515_1431258 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300017927|Ga0187824_10002022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5244 | Open in IMG/M |
3300017927|Ga0187824_10041796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1400 | Open in IMG/M |
3300017930|Ga0187825_10093762 | Not Available | 1036 | Open in IMG/M |
3300017936|Ga0187821_10085241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1155 | Open in IMG/M |
3300017946|Ga0187879_10729828 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300017948|Ga0187847_10548199 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300017970|Ga0187783_10037475 | All Organisms → cellular organisms → Bacteria | 3594 | Open in IMG/M |
3300018016|Ga0187880_1373953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 600 | Open in IMG/M |
3300018024|Ga0187881_10487889 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300018030|Ga0187869_10597893 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300018034|Ga0187863_10510347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 673 | Open in IMG/M |
3300018037|Ga0187883_10422204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 684 | Open in IMG/M |
3300018042|Ga0187871_10106471 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
3300018044|Ga0187890_10350931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 827 | Open in IMG/M |
3300018062|Ga0187784_11210549 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300018085|Ga0187772_11362495 | Not Available | 526 | Open in IMG/M |
3300018433|Ga0066667_11078468 | Not Available | 694 | Open in IMG/M |
3300019082|Ga0187852_1020751 | All Organisms → cellular organisms → Bacteria | 3294 | Open in IMG/M |
3300019785|Ga0182022_1092281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1563 | Open in IMG/M |
3300019787|Ga0182031_1028093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 524 | Open in IMG/M |
3300019877|Ga0193722_1064361 | Not Available | 915 | Open in IMG/M |
3300019879|Ga0193723_1069608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1016 | Open in IMG/M |
3300019888|Ga0193751_1183896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 716 | Open in IMG/M |
3300020170|Ga0179594_10195045 | Not Available | 758 | Open in IMG/M |
3300020170|Ga0179594_10427102 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 503 | Open in IMG/M |
3300020581|Ga0210399_10046745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3472 | Open in IMG/M |
3300020581|Ga0210399_10947443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
3300021086|Ga0179596_10601498 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300021088|Ga0210404_10710287 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 573 | Open in IMG/M |
3300021168|Ga0210406_10774403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 732 | Open in IMG/M |
3300021178|Ga0210408_10291543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1301 | Open in IMG/M |
3300021181|Ga0210388_11453168 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300021404|Ga0210389_10048332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3263 | Open in IMG/M |
3300021404|Ga0210389_10831991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 720 | Open in IMG/M |
3300021407|Ga0210383_11246818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 623 | Open in IMG/M |
3300021432|Ga0210384_10073861 | All Organisms → cellular organisms → Bacteria | 3068 | Open in IMG/M |
3300021433|Ga0210391_10690389 | Not Available | 800 | Open in IMG/M |
3300022512|Ga0242676_1043661 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300023101|Ga0224557_1238308 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300024227|Ga0228598_1021007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1285 | Open in IMG/M |
3300025442|Ga0208034_1023005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1650 | Open in IMG/M |
3300025442|Ga0208034_1063764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 713 | Open in IMG/M |
3300025899|Ga0207642_10060777 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
3300025906|Ga0207699_10035039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2853 | Open in IMG/M |
3300025906|Ga0207699_11182742 | All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Fibrobacteria → Fibrobacterales → Fibrobacteraceae → Fibrobacter → unclassified Fibrobacter → Fibrobacter sp. | 566 | Open in IMG/M |
3300025914|Ga0207671_10468552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1004 | Open in IMG/M |
3300025930|Ga0207701_10299622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1396 | Open in IMG/M |
3300025932|Ga0207690_10020615 | All Organisms → cellular organisms → Bacteria | 4076 | Open in IMG/M |
3300025939|Ga0207665_10184026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1514 | Open in IMG/M |
3300025990|Ga0208527_1021617 | Not Available | 772 | Open in IMG/M |
3300026309|Ga0209055_1096291 | Not Available | 1193 | Open in IMG/M |
3300026354|Ga0257180_1053215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300026467|Ga0257154_1034058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 769 | Open in IMG/M |
3300026514|Ga0257168_1014855 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
3300026537|Ga0209157_1032028 | All Organisms → cellular organisms → Bacteria | 3027 | Open in IMG/M |
3300026547|Ga0209156_10088681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1555 | Open in IMG/M |
3300027061|Ga0209729_1011285 | Not Available | 1016 | Open in IMG/M |
3300027545|Ga0209008_1099038 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300027559|Ga0209222_1087508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 602 | Open in IMG/M |
3300027587|Ga0209220_1153817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 594 | Open in IMG/M |
3300027783|Ga0209448_10000111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 29302 | Open in IMG/M |
3300027825|Ga0209039_10168668 | Not Available | 903 | Open in IMG/M |
3300027842|Ga0209580_10606291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 543 | Open in IMG/M |
3300027869|Ga0209579_10518543 | Not Available | 647 | Open in IMG/M |
3300027875|Ga0209283_10030892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3342 | Open in IMG/M |
3300027882|Ga0209590_10826776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300027898|Ga0209067_10168249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1168 | Open in IMG/M |
3300027903|Ga0209488_10219839 | Not Available | 1429 | Open in IMG/M |
3300027905|Ga0209415_11006544 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300028037|Ga0265349_1023092 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 569 | Open in IMG/M |
3300028047|Ga0209526_10373540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 951 | Open in IMG/M |
3300028381|Ga0268264_11836184 | Not Available | 616 | Open in IMG/M |
3300028536|Ga0137415_11096544 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 609 | Open in IMG/M |
3300028780|Ga0302225_10115109 | Not Available | 1311 | Open in IMG/M |
3300028780|Ga0302225_10228079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 891 | Open in IMG/M |
3300028799|Ga0307284_10159376 | Not Available | 874 | Open in IMG/M |
3300029882|Ga0311368_10306251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1202 | Open in IMG/M |
3300029943|Ga0311340_10133545 | All Organisms → cellular organisms → Bacteria | 2641 | Open in IMG/M |
3300029951|Ga0311371_10331011 | Not Available | 2122 | Open in IMG/M |
3300029984|Ga0311332_10162300 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
3300029984|Ga0311332_10295881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1239 | Open in IMG/M |
3300030007|Ga0311338_11649560 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300030048|Ga0302273_1086845 | Not Available | 927 | Open in IMG/M |
3300030053|Ga0302177_10363363 | Not Available | 762 | Open in IMG/M |
3300030743|Ga0265461_12850225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300030838|Ga0311335_10619657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 758 | Open in IMG/M |
3300030943|Ga0311366_10355601 | Not Available | 1273 | Open in IMG/M |
3300031028|Ga0302180_10217006 | Not Available | 1020 | Open in IMG/M |
3300031234|Ga0302325_13098479 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300031236|Ga0302324_102560590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 621 | Open in IMG/M |
3300031249|Ga0265339_10144823 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300031679|Ga0318561_10213218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1049 | Open in IMG/M |
3300031680|Ga0318574_10129604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1421 | Open in IMG/M |
3300031708|Ga0310686_119005825 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300031720|Ga0307469_11716610 | Not Available | 605 | Open in IMG/M |
3300031754|Ga0307475_11583447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300031823|Ga0307478_10336468 | Not Available | 1242 | Open in IMG/M |
3300031938|Ga0308175_101928727 | Not Available | 662 | Open in IMG/M |
3300031954|Ga0306926_11752886 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 707 | Open in IMG/M |
3300032001|Ga0306922_11184070 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 779 | Open in IMG/M |
3300032025|Ga0318507_10258871 | Not Available | 755 | Open in IMG/M |
3300032042|Ga0318545_10307102 | Not Available | 570 | Open in IMG/M |
3300032261|Ga0306920_101973624 | Not Available | 818 | Open in IMG/M |
3300032783|Ga0335079_10781811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 990 | Open in IMG/M |
3300033004|Ga0335084_11162061 | Not Available | 772 | Open in IMG/M |
3300033433|Ga0326726_12213455 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 534 | Open in IMG/M |
3300033475|Ga0310811_10982342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300033561|Ga0371490_1137725 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300033982|Ga0371487_0459112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 541 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.61% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.85% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.41% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.41% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.08% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.64% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.20% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.76% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.76% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.76% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.76% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.76% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.32% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.32% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.32% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.32% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.32% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.88% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.88% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.44% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.44% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.44% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.44% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.44% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.44% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.44% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.44% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.44% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.44% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.44% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.44% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.44% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025990 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030048 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_103011891 | 3300001356 | Peatlands Soil | RVRDESQLEAWQKVKQMAETCRHDRDLYLRFVGN* |
JGI25390J43892_100027731 | 3300002911 | Grasslands Soil | DLYGKTVFNHLQMEIFLEEWERIRERAHDESQVDAWQKVKDMGLACQGDRDLYLKFLGN* |
Ga0062384_1005470993 | 3300004082 | Bog Forest Soil | FLREWDLAKDRVRDDSQLEAWQKVKQMAETCRKDRDLYLRFVGN* |
Ga0062591_1009542032 | 3300004643 | Soil | EEWGRVRDRAKDDSQQQAWQRVQEMALACKDDRDLYLRFVGN* |
Ga0062594_1010046641 | 3300005093 | Soil | FNHLQMERFLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN* |
Ga0066672_108909112 | 3300005167 | Soil | WEKVRERAHDESQKEAWSKIKEMARTCEGDRDLYLRFVEH* |
Ga0066683_108858621 | 3300005172 | Soil | QMETFLEEWERVRDRAKDESQQEAWQKVKEMAQTCKSDRDLYLRFVGN* |
Ga0066680_101152751 | 3300005174 | Soil | NHLQMESFLEEWDRVRDRAHDESQQDAWQKVKNMAVACQVDRDLYLKFVGN* |
Ga0066680_103708792 | 3300005174 | Soil | FLEEWERVRDRAKDESQQEAWQKVKEMAQTCKSDRDLYLRFVGN* |
Ga0070670_1000745403 | 3300005331 | Switchgrass Rhizosphere | FLEEWGRVRDRAKDDSQQQAWQRVQEMALACKEDRDLYLRFVGN* |
Ga0070666_101666563 | 3300005335 | Switchgrass Rhizosphere | QRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN* |
Ga0070680_1013659222 | 3300005336 | Corn Rhizosphere | MESFLEEWDRVRDRARDDSQVEAWQKVKDMGEKCRADRDLYLRFVGN* |
Ga0070659_1001819361 | 3300005366 | Corn Rhizosphere | LFNHLQMESFLEEWDRVRDRARDDSQVEAWQKVKDMGEKCRADRDLYLRFVGN* |
Ga0070709_103255991 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DRVQDRARDDSQADAWKRIRQMAETCRKDRDLYLKFVGN* |
Ga0070711_1004282493 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FLLEWERVKDRAKDESQREAWQKVKEMAEHCKADRDLYLRFVGH* |
Ga0066681_104342401 | 3300005451 | Soil | MESFLEEWERVRDRAHDESQIDAWQKVKNMALACQDDRDLYLKFVGN* |
Ga0070663_1012799861 | 3300005455 | Corn Rhizosphere | VFNHLQMERFLEEWGRVRDRAKDDSQQQAWQRVQEMALACKDDRDLYLRFVGN* |
Ga0070707_1008012661 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ERVRERAHDESQKDAWRKVKDMALACQGDRDLYLKFVGN* |
Ga0070741_110823421 | 3300005529 | Surface Soil | HLQMEIFLEEWDRVRERAKDESQIEAWQKIKEMAEKCRADRDLYLRFVGN* |
Ga0070697_1020314342 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | FLEEWERVRDRARDESQKEAWQKVKDMALACQGDRDLYLKFVGN* |
Ga0070731_105804111 | 3300005538 | Surface Soil | EWDRVQNRAKDESQREAWQKVKEMAEICRLDRDLYLRFVGH* |
Ga0066692_106904001 | 3300005555 | Soil | EPFLKEWDRAKDRVRDDTQLEAWEKVKHMAETCRHDRDLYLRFVGN* |
Ga0066705_103506281 | 3300005569 | Soil | WERVRDRARDESQKEAWGKIKEMARTCENDRDLYLRFVGH* |
Ga0066705_103765732 | 3300005569 | Soil | DRAKDESQREAWQKVKEMAEHCKADRDLYLRFVGH* |
Ga0070761_109540372 | 3300005591 | Soil | HLQMEAFLGEWERAKDRVHDDSQLEGWEKVKQMAETCKTDRDLYLRFVGN* |
Ga0070762_100738613 | 3300005602 | Soil | WERAKDRVHDDSQLEGWEKVKQMAETCKTDRDLYLRFVGN* |
Ga0070702_1002359941 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VFNHLQMERFLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN* |
Ga0070764_103937531 | 3300005712 | Soil | QEWERIQDRIRDESQKEAWKKVKEMAEACRQDRDLYLRFVGN* |
Ga0068866_101052891 | 3300005718 | Miscanthus Rhizosphere | LQMERFLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN* |
Ga0066903_1085433381 | 3300005764 | Tropical Forest Soil | LEEWARVEDRARDESQREAWRKVKEMAETCKGDRDLYLRFVGH* |
Ga0068860_1027707542 | 3300005843 | Switchgrass Rhizosphere | NHLQMERFLEEWGRVRDRAKDDSQQQAWQRVQEMALACKDDRDLYLRFVGN* |
Ga0068862_1025453322 | 3300005844 | Switchgrass Rhizosphere | QMERFLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN* |
Ga0070766_100827334 | 3300005921 | Soil | NHLQMEPFLEEWDRTRDRIRDDSQKDAWQKVKEMAETCRADRDLYLRFVGN* |
Ga0070717_103224991 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EWERVKDRAKDESQREAWQKVKEMAEHCKADRDLYLRFVGH* |
Ga0075023_1004591982 | 3300006041 | Watersheds | GIDPFGKTVFNHLQIEAFLQEWDRAKDRVHDDSQLEAWQKVRQMAETCRDDRDLYLRFVGN* |
Ga0066652_1000566415 | 3300006046 | Soil | GRAHDESQVEAWQKIKEMAQICQQDRDLYLRFVGN* |
Ga0066652_1012897821 | 3300006046 | Soil | IFLEEWERIRDRAHDESQQDAWQKVKDMALACQDDRDLYLKFLGN* |
Ga0075019_108890841 | 3300006086 | Watersheds | LKDRAKDESQRDAWQKVKEMAETCKSDRDLYLRFVGH* |
Ga0075030_1004671891 | 3300006162 | Watersheds | LQMEAFLIEWDRAKERVKDDTQLEAWEKVKHMAETCRHDRDLYLRFVGN* |
Ga0070765_1007467843 | 3300006176 | Soil | HLQMEAFLKEWDRAKDRVRDDTELEAWQKVKQMAETCRNDRDLYLRFVGN* |
Ga0079222_118931912 | 3300006755 | Agricultural Soil | RERAHDESQKQAWEKIKEMAQTCQADRDLYLRFVGN* |
Ga0066653_102838992 | 3300006791 | Soil | FNHLQMEMLLEEWERVHERAHDEAQKDAWQKVKDMALACQQDRDLYLKFVGN* |
Ga0066659_103812501 | 3300006797 | Soil | IFLEEWERIRERAHDESQVDAWQKVKDMGLACQGDRDLYLKFLGN* |
Ga0073928_100350547 | 3300006893 | Iron-Sulfur Acid Spring | QMEPFLKEWDRAKDRVRDDTQLQAWEKVKQMAETCRHDRDLYLRFVGN* |
Ga0079219_113222781 | 3300006954 | Agricultural Soil | FLQEWERIRDRAKDESQKEAWQKVKEMAEACKSDRDLYLRFVGN* |
Ga0075435_1009498501 | 3300007076 | Populus Rhizosphere | EGFLEEWERVKDRAHDDSQKEAWQKVREMAQSCQQDRDLFLRFVGN* |
Ga0099827_109722442 | 3300009090 | Vadose Zone Soil | MESFLEEWDRVRDCAHDESQQDAWQKVKNMAVACQVDRDLYLKFVGN* |
Ga0105240_105866261 | 3300009093 | Corn Rhizosphere | EWERIHERARDESQKEAWQKVKEMAATCKQDRDLYLRFVGN* |
Ga0066709_1021574781 | 3300009137 | Grasslands Soil | QVRERAHDESQKEAWEKIKQMAQTCQADRDLYLRFVGN* |
Ga0099792_108704292 | 3300009143 | Vadose Zone Soil | LQMEPFLKEWDRAKDRVRDDTQLQAWEKVKNMAETCLHDRDLYLRFVGN* |
Ga0116222_11520022 | 3300009521 | Peatlands Soil | AKDRARDESQLEAWEKVKQMAETCRHDRDLYLRFVGN* |
Ga0116221_12066891 | 3300009523 | Peatlands Soil | VFNHLQMEAFLKEWDRAKDRVRDESQLEAWQKIKQMAETCRHDRDLYLRFVGN* |
Ga0116225_15655491 | 3300009524 | Peatlands Soil | DRVRDESQLEAWQKVKQMAETCRDDRDLYLRFVGN* |
Ga0116107_12076212 | 3300009548 | Peatland | RARDDSELEAWHKVKQMAETCRHDRDLYLRFVGN* |
Ga0116125_10770311 | 3300009628 | Peatland | IKDRVRDETQREAWQKVKQMAETCRQDRDLYLRFLGN* |
Ga0116119_11658682 | 3300009629 | Peatland | LQMEAFLKEWDRAKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN* |
Ga0116102_11546711 | 3300009632 | Peatland | DRAKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN* |
Ga0116117_10155922 | 3300009635 | Peatland | VKDRVRDDSQLEAWGKVKHMAETCRDDRDLYLRFVGN* |
Ga0116110_11133604 | 3300009643 | Peatland | AKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN* |
Ga0116217_100560003 | 3300009700 | Peatlands Soil | EAFLKEWDRVKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN* |
Ga0116219_105675721 | 3300009824 | Peatlands Soil | AFLQEWDRAKERVRDESQLEAWQKVKQMAETCRDDRDLYLRFVGN* |
Ga0116223_100142366 | 3300009839 | Peatlands Soil | FNHLQMEAFLKEWDRVKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN* |
Ga0116223_102392532 | 3300009839 | Peatlands Soil | FNHLQMEAFLKEWDRVKDRVRDDSQLEAWEKVKHMAETCRRDRDLYLRFVGN* |
Ga0126380_101069163 | 3300010043 | Tropical Forest Soil | FLEEWERVKDRARDESQRQAWQKVKQMAETCKSDRDLYLRFVGH* |
Ga0126373_104506262 | 3300010048 | Tropical Forest Soil | QDRAKDESQREAWQKIKEMAEICKLDRDLYLRFVGH* |
Ga0134067_101354612 | 3300010321 | Grasslands Soil | MEAFLGEWERVRDRAKDEAQREAWQKVKDMAQHCQRDRDLYLRFVGN* |
Ga0074045_100838923 | 3300010341 | Bog Forest Soil | LKEWDRVKDRVRDESQLEAWQKVKQMAETCRLDRDLYLRFVGN* |
Ga0074045_101320602 | 3300010341 | Bog Forest Soil | ENFLKEWDRVKDRVRDDSQLDAWGKVKHMAETCRDDRDLYLRFVGN* |
Ga0074044_100764711 | 3300010343 | Bog Forest Soil | MAAFLQEWDRAKDRVHDDSQLEAWQKVKQMAETCRDNRDLYLRFVGN* |
Ga0126370_119175032 | 3300010358 | Tropical Forest Soil | DRALDDPQKDAWQKIKEIAQTCKEDRDLYLRFVGN* |
Ga0126376_127113652 | 3300010359 | Tropical Forest Soil | VFNHRQMEEFLREWELVKARVKDDSQMEAWERVKKMAESCAQDRDLYLRFVGN* |
Ga0126372_100233184 | 3300010360 | Tropical Forest Soil | VQDRAKDESQREAWQKVKEMAEICKLDRDLYLRFVGH* |
Ga0126378_109410161 | 3300010361 | Tropical Forest Soil | LQMEAFLEEWDRIQHRAEDDSQKQAWQKVKDMARSCQSDRDLYLRFVGN* |
Ga0126378_131137612 | 3300010361 | Tropical Forest Soil | VFNHLQMEAFLEEWDRIQHRAEDDSQKQAWQKVKDMARNCQSDRDLYLRFVGN* |
Ga0126379_101692761 | 3300010366 | Tropical Forest Soil | RAKDESQREAWQKVKEMAETCKSDRDLYLRFVGH* |
Ga0136449_1008230811 | 3300010379 | Peatlands Soil | EWDRVKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN* |
Ga0126383_115566811 | 3300010398 | Tropical Forest Soil | HLQMEPFLAEWHRIEGRARDESQRQAWRKVKEMAETCGADRDLYLRFVGH* |
Ga0150983_143540162 | 3300011120 | Forest Soil | VFNHLQMEPFLKEWDRAKDRVRDDTQLEAWQKVKQMAETCRHDRDLYLRFVGN* |
Ga0137389_109822591 | 3300012096 | Vadose Zone Soil | REWDRAKDRAHDDTQLQAWQKVKHMAETCRHDRDLYLRFVGN* |
Ga0137388_111560033 | 3300012189 | Vadose Zone Soil | FLREWDRAKDRAHDDTQLQAWQKVKHMAETCRHDRDLYLRFVGN* |
Ga0137399_100478213 | 3300012203 | Vadose Zone Soil | AEAFLEEWERVQDRARDDSQREAWQKVKEMAEICKSDRDLYLRFVGH* |
Ga0137362_115427321 | 3300012205 | Vadose Zone Soil | PFLEEWQRARERAKDDSQNQAWERVKGMAETCQKDRDLYLKFVGN* |
Ga0150985_1122223531 | 3300012212 | Avena Fatua Rhizosphere | VFNHLQMDAFLEEWERIHVRARDESQKEAWQKVKEMAATCKQDRDLYLRFVGN* |
Ga0137367_108621701 | 3300012353 | Vadose Zone Soil | LQMHEFLREWENVKDRIRDESQMEAWARVKQMAETCRDDRDLYLRFVGN* |
Ga0137371_112737542 | 3300012356 | Vadose Zone Soil | ETFLAEWEQVRERAHDESQKEAWEKIKQMAQTCQADRDLYLRFVGS* |
Ga0137360_114449572 | 3300012361 | Vadose Zone Soil | QMEMFLEEWERVRERARDESQKEAWQKVKDMAMACQQDRDLYLKFVGN* |
Ga0137390_114123812 | 3300012363 | Vadose Zone Soil | LQMELFLREWDRAKDRAHDDTQLQAWQKVKHMAETCRHDRDLYLRFVGN* |
Ga0137395_109043611 | 3300012917 | Vadose Zone Soil | TFLEEWERVRERAKDEPQQEAWKKVKEMAQTCKSDRDLYLRFVGN* |
Ga0137396_107044262 | 3300012918 | Vadose Zone Soil | EWERVQDRARDDSQREAWQRVKEMAEICKSDRDLYLRFVGH* |
Ga0137359_103415202 | 3300012923 | Vadose Zone Soil | FLAEWDRVKDRARDESQMEAWHKVRQMAETCSEDRDLYLRFVGN* |
Ga0137416_115166502 | 3300012927 | Vadose Zone Soil | IRGFERVKDRARDESQREAWQKVKEMAATCKSDRDLYLRFVGH* |
Ga0137407_112294741 | 3300012930 | Vadose Zone Soil | VFLAEWERVKDRARDESQTEAWQKVRQMAETCREDRDLYLRFVGN* |
Ga0137407_114486271 | 3300012930 | Vadose Zone Soil | EEWERVRDRAHDESQQDAWQKVKNMAVACQVDRDLYLKFVGN* |
Ga0164298_101731313 | 3300012955 | Soil | AEWDRVQDRARDDSQADAWKRIRQMAETCRKDRDLYLKFVGN* |
Ga0164301_109853462 | 3300012960 | Soil | QMEPFLAEWDRVQDRARDDSQADAWKRIRQMAETCRKDRDLYLKFVGN* |
Ga0126369_107378681 | 3300012971 | Tropical Forest Soil | DRAHDDSQKEAWQKVREMAQSCQQDRDLFLRFVGN* |
Ga0126369_116739692 | 3300012971 | Tropical Forest Soil | QVKDRARDQSQMEAWQKIKEMAETCREDRDLYLRFVGN* |
Ga0164304_118784822 | 3300012986 | Soil | VRDRARDDSQVEAWQKVKEMGEKCRADRDLYLRFVGN* |
Ga0164305_108425002 | 3300012989 | Soil | HLQMESFLEEWDRVRERARDDSQVEAWQKVKEMGEKCRADRDLYLRFVGN* |
Ga0163162_125639582 | 3300013306 | Switchgrass Rhizosphere | WQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN* |
Ga0181531_104215481 | 3300014169 | Bog | TVFNHLQMEAFLKEWERAKDRVRDDNQLEGWKKVKQMAETCKTDRDLYLRFVGN* |
Ga0181526_106596312 | 3300014200 | Bog | RVRDDSQLEAWNRVKGMAEACRKDRDLYLRFVGN* |
Ga0181537_105161872 | 3300014201 | Bog | FLQEWERAKERARDESQMEAWSKVKEMAEACRHDRDLYLRFVGN* |
Ga0182018_105729462 | 3300014489 | Palsa | KDRVRDDSQLEAWEKVKNMAETCRHDRDLYLRFVGN* |
Ga0182021_104461903 | 3300014502 | Fen | VFNHLQMEAFLKEWDRAKDRVRDDSQLEAWEKVKQMAETCRDDRDLYLRFVGN* |
Ga0181522_109169891 | 3300014657 | Bog | RARDESQMEAWNKVKEMAEACRHDRDLYLRFVGN* |
Ga0157377_116681221 | 3300014745 | Miscanthus Rhizosphere | RDRARDDSQVEAWQKVKDMGEKCRADRDLYLRFVGN* |
Ga0157376_107547163 | 3300014969 | Miscanthus Rhizosphere | LEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN* |
Ga0137411_13166441 | 3300015052 | Vadose Zone Soil | QDRARDDSQREAWQRVKEMAEICKSDRDLYLRFVGH* |
Ga0137420_14753465 | 3300015054 | Vadose Zone Soil | METFLEEWERVRDRAKDEPQQEAWKKVKEMAENCKGDRDLYLRFVGN* |
Ga0137418_104456631 | 3300015241 | Vadose Zone Soil | KERARDESQIEAWRKVKEMAETCREDRDLYLRFVGN* |
Ga0137403_113142191 | 3300015264 | Vadose Zone Soil | RAREFAKDDSQYQDWERVKGMAETCQKDRDLYLKFVGN* |
Ga0132256_1022235692 | 3300015372 | Arabidopsis Rhizosphere | LEEWERIHERARDESQKEAWQKVKEMAATCKQDRDLYLRFVGN* |
Ga0182033_111889131 | 3300016319 | Soil | NHLQMESFLEEWERIQHRAEDDSQKEAWQKVKDMARNCQSDRDLYLRFVGN |
Ga0182032_102074572 | 3300016357 | Soil | MESFLEEWGRVQERAKDDTQREAWQKVKDMAETCRQDRDLYLRFVGHGH |
Ga0182040_105326201 | 3300016387 | Soil | QAETFLAEWERVKDRAKDESQSEAWQKVKEMAEACKSDRDLYLKFIGH |
Ga0182039_116715682 | 3300016422 | Soil | VRDRAKDESQREAWQKVKEMAETCKSDRDLYLRFVGH |
Ga0181515_14312581 | 3300016730 | Peatland | ETFLREWDRAKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN |
Ga0187824_100020221 | 3300017927 | Freshwater Sediment | MERAKDRAKDESQTEAWQKVKEMAEACKSDRDLYLKFIGH |
Ga0187824_100417961 | 3300017927 | Freshwater Sediment | ERARDDSQQQVWNKIKEMAESCRDDRDLFLRFVGN |
Ga0187825_100937622 | 3300017930 | Freshwater Sediment | LVEWERAKDRAKDESQTEAWQKVKEMAEACKSDRDLYLKFIGH |
Ga0187821_100852411 | 3300017936 | Freshwater Sediment | TRAEWERVKDRAKDESQSEAWQKVKEMAEACKSDRDLYLKFIGH |
Ga0187879_107298281 | 3300017946 | Peatland | LQMEAFLKEWERAKDRVRDDNQLEAWEKVKHMAETCRHDRDLYLRFVGN |
Ga0187847_105481992 | 3300017948 | Peatland | VKDRVRDESQLEAWEKVKHMAETCRDDRDLYLRFLGN |
Ga0187783_100374751 | 3300017970 | Tropical Peatland | FGKTVFNHLQMEAFLQEWERAKERVRDESQMEAWEKIKGMAEACRKDRDLFLRFVGH |
Ga0187880_13739531 | 3300018016 | Peatland | ERVHDDSQLEAWEKVKQMAETCRRDRDLYLRFVGN |
Ga0187881_104878892 | 3300018024 | Peatland | KEWDRAKARVRDESQLEAWEKVKQMAEICRHDRDLYLRFVGN |
Ga0187869_105978931 | 3300018030 | Peatland | VFNHLQMEAFLKEWDRAKDRVRDESQLEAWQKIKQMAETCRHDRDLYLRFVGN |
Ga0187863_105103472 | 3300018034 | Peatland | LKEWDRAKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN |
Ga0187883_104222041 | 3300018037 | Peatland | VFLKEWERARERVHDENQLEAWEKVKQMAETCRQDRDLYLRFVGN |
Ga0187871_101064711 | 3300018042 | Peatland | TFLQEWDRAKDRVRDDSELEAWEKVKHMAETCRHDRDLYLRFVGN |
Ga0187890_103509311 | 3300018044 | Peatland | RIKDRVRDETQREAWQKVKQMAETCRQDRDLYLRFLGN |
Ga0187784_112105492 | 3300018062 | Tropical Peatland | ENFLKEWERVKERARDDSQLEAWQKVKQMAETCRDDRDLYLRFVGN |
Ga0187772_113624952 | 3300018085 | Tropical Peatland | WNRAKNRVRDEQQMEAWQKVKQMAEACRDDRDLYLRFVGH |
Ga0066667_110784681 | 3300018433 | Grasslands Soil | TVFNHLQMEIFLEEWERIRDRAHDESQQDAWQKVKDMALACQDDRDLYLKFLGN |
Ga0187852_10207511 | 3300019082 | Peatland | TVFNHLQMEAFLEEWDRVKDRVHDDSQLEAWEKVKLMAETCRHDRDLYLRFVGN |
Ga0182022_10922811 | 3300019785 | Fen | MTAFLEEWDRVKDRVHDDSQLEAWERVKHMAETCRDDRDLYLRFVGN |
Ga0182031_10280931 | 3300019787 | Bog | AWGSDDSQLEAWGKVKHMAETCRDDRDLYLRFVGN |
Ga0193722_10643612 | 3300019877 | Soil | ERVKDRAKDESQSAAWQKVKEMAETCKSDRDLYLRFVGH |
Ga0193723_10696083 | 3300019879 | Soil | SFLEEWERVRDRAHDESQIDAWQKVKNMALACQDDRDLYLKFLGN |
Ga0193751_11838961 | 3300019888 | Soil | FLKEWDRAKDRVRDDTQLEAWQKVKQMAETCRHDRDLYLRFVGN |
Ga0179594_101950452 | 3300020170 | Vadose Zone Soil | WERVKDRARDESQREAWQKVKEMAATCKSDRDLYLRFVGH |
Ga0179594_104271022 | 3300020170 | Vadose Zone Soil | EQVRERAHDESQKEAWEKIKQMAQTCQTDRDLYLRFVGN |
Ga0210399_100467451 | 3300020581 | Soil | RAKDRVRDDTQLEAWQKVKQMAETCSHDRDLYLRFVGN |
Ga0210399_109474432 | 3300020581 | Soil | HLQAETFLLEWERVKDRAKDESQREAWQKVKEMAEHCKADRDLYLRFVGH |
Ga0179596_106014981 | 3300021086 | Vadose Zone Soil | WDRAKDRAHDDTQLQAWQKVKHMAETCRHDRDLYLRFVGN |
Ga0210404_107102872 | 3300021088 | Soil | HLQAETFLVEWERVQDRAKDESQREAWQKVKEMAENCKADRDLYLRFVGH |
Ga0210406_107744031 | 3300021168 | Soil | AKDRVRDDTQLEAWLKVKQMAETCRHDRDLYLRFVGN |
Ga0210408_102915433 | 3300021178 | Soil | QVVGFLEEWERVKDRAKDESQREAWQKVKEMAEACKTDRDLYLRFVGH |
Ga0210388_114531681 | 3300021181 | Soil | RAKDLVRDDTELEAWQKVKQMAETCRNDRDLYLRFVGN |
Ga0210389_100483321 | 3300021404 | Soil | HLQMESFLEEWVRVQECAKDDTQREAWQKVKDMAETCSQDRDLFLRFVGHGH |
Ga0210389_108319912 | 3300021404 | Soil | RDRAKDESQREAWQKIKEMAEICRLDRDLYLRFVGH |
Ga0210383_112468182 | 3300021407 | Soil | LLKEWERVKDRVKDDSQKEAWEKVKEMAETCRHDRDLYLRFVGN |
Ga0210384_100738611 | 3300021432 | Soil | DRAKDRVRDDTQLEAWQKVKQMAETCRHDRDLYLRFVGN |
Ga0210391_106903891 | 3300021433 | Soil | EWDRAKDRVRDDTELEAWQKVKQMAETCRNDRDLYLRFVGN |
Ga0242676_10436612 | 3300022512 | Soil | SFGKTVFNHLQMESFLEEWERIRDRAHDDTQRDAWQKVKDLALACQQDRDLYLRFVGN |
Ga0224557_12383081 | 3300023101 | Soil | LKEWDCVRERARDDSQVEAWQRVKTMAEACREDRDLYLRFVGH |
Ga0228598_10210071 | 3300024227 | Rhizosphere | IRVRARDDTQQDAWQKVKDLALVCQQDRDLYLRFVGN |
Ga0208034_10230053 | 3300025442 | Peatland | KEWDRAKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN |
Ga0208034_10637641 | 3300025442 | Peatland | KDRARDESQLEAWEKVKQMAETCRRDRDLYLRFVGN |
Ga0207642_100607773 | 3300025899 | Miscanthus Rhizosphere | EWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN |
Ga0207699_100350393 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | EWERVEERAHDESQKEAWRKVKEMAESCQADRDLYLRFVGN |
Ga0207699_111827421 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEWDRVQDRARDDSQADAWKRIRQMAETCRKDRDLYLKFVGN |
Ga0207671_104685523 | 3300025914 | Corn Rhizosphere | LEEWDRVRDRARDDSQVEAWQKVKDMGEKCRADRDLYLRFVGN |
Ga0207701_102996221 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | FLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN |
Ga0207690_100206151 | 3300025932 | Corn Rhizosphere | RFLEEWQRVHERARDESQQEAWQRVRDMATACKEDRDLYLRFVGN |
Ga0207665_101840261 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEWERVRERARDESQKEAWEKIKQMAQTCQTDRDLYLRFVGN |
Ga0208527_10216171 | 3300025990 | Rice Paddy Soil | KVRGRAHDDSQVLAWSKVKEMAQVCQKDRDLYLKFVGN |
Ga0209055_10962912 | 3300026309 | Soil | WERVKDRAKDESQREAWQKVKEMAEHCKADRDLYLRFVGH |
Ga0257180_10532152 | 3300026354 | Soil | QMSVFLAEWERVKDRARDESQTEAWQKVRQMAETCREDRDLYLRFVGN |
Ga0257154_10340582 | 3300026467 | Soil | MEFFLQEWERIQDRIRDESQKEAWKKVKEMAEACRQDRDLYLRFVGN |
Ga0257168_10148554 | 3300026514 | Soil | ELFLREWDRAKDRAHDDTQLQAWQKVKHMAETCRHDRDLYLRFVGN |
Ga0209157_10320281 | 3300026537 | Soil | QVRERAHDESQKEAWEKIKQMAQTCQTDRDLYLRFVGN |
Ga0209156_100886811 | 3300026547 | Soil | VRGRAHDESQVEAWQKIKEMAQICQQDRDLYLRFVGN |
Ga0209729_10112851 | 3300027061 | Forest Soil | VKDRAKDESQREAWQKVKEMAEHCKADRDLYLRFVGH |
Ga0209008_10990382 | 3300027545 | Forest Soil | EWDRAKDRVHDDSQLEAWEKVKHMAESCLQDRDLYLRFVGN |
Ga0209222_10875082 | 3300027559 | Forest Soil | HLQMEAFLAEWDRIRDRVRDDAQLEAWQKVKQMAETCRQDRDLYLRFVGN |
Ga0209220_11538172 | 3300027587 | Forest Soil | LKEWDRAKDRVRDDTQLEAWQKVKQMAETCRHDRDLYLRFVGN |
Ga0209448_100001111 | 3300027783 | Bog Forest Soil | KDRARDESQLEAWGKVKQMAETCRHDRDLYLRFVGN |
Ga0209039_101686682 | 3300027825 | Bog Forest Soil | LQMEAFLKEWDRAKDRVHDDSQLAAWEKVKHMAEICRHDRDLYLRFVGN |
Ga0209580_106062912 | 3300027842 | Surface Soil | LQAAEFLEEWNRVKERARDDSQQQVWNKIKEMAESCRDDRDLFLRFVGN |
Ga0209579_105185432 | 3300027869 | Surface Soil | EWDRVQNRAKDESQREAWQKVKEMAEICRLDRDLYLRFVGH |
Ga0209283_100308923 | 3300027875 | Vadose Zone Soil | DRAKDESQQEAWQKVKEMAQTCKSDRDLYLRFVGN |
Ga0209590_108267761 | 3300027882 | Vadose Zone Soil | KRVRDRAKDEPQQEAWKKVKEMAENCKGDRDLYLRFVGN |
Ga0209067_101682491 | 3300027898 | Watersheds | LKDRAKDESQRDAWQKVKEMAETCKSDRDLYLRFVGH |
Ga0209488_102198392 | 3300027903 | Vadose Zone Soil | QMTVFLAEWERVKDRARDESQVEAWQKVKQMAESCRDDRDLYLRFVGN |
Ga0209415_110065441 | 3300027905 | Peatlands Soil | FNHLQMEAFLKEWDRAKDRVRDESQLEAWQKVKQMAETCRHDRDLYLRFVGN |
Ga0265349_10230922 | 3300028037 | Soil | KTVFNHLQMESFLEEWERIRDRAHDDTQRDAWQKVKDLALACQQDRDLYLRFVGN |
Ga0209526_103735402 | 3300028047 | Forest Soil | HLQMEPFLKEWDRVKDRVRDDTQLEAWQKVKQMAETCRHDRDLYLRFVGN |
Ga0268264_118361841 | 3300028381 | Switchgrass Rhizosphere | VFNHLQMERFLEEWGRVRDRAKDDSQQQAWQRVQEMALACKDDRDLYLRFVGN |
Ga0137415_110965441 | 3300028536 | Vadose Zone Soil | LEEWERVKDRARDESQREAWQKVKEMAATCKSDRDLYLRFVGH |
Ga0302225_101151093 | 3300028780 | Palsa | HLQMEAFLKEWDRAKDRVRDDSQLDAWEKVKHMAETCRHDRDLYLRFVGN |
Ga0302225_102280792 | 3300028780 | Palsa | TVFNHLQMEAFLQEWERAKDRVRDDSQLEGWGKVKQMAETCRTDRDLYLRFVGN |
Ga0307284_101593761 | 3300028799 | Soil | IFLEEWERIRERAHDESQVDAWQKVKDMGLACQGDRDLYLKFLGN |
Ga0311368_103062511 | 3300029882 | Palsa | ETFLEEWERVRDRARDDAQRDAWQKIKDLALACQQDRDLYLRFVGN |
Ga0311340_101335451 | 3300029943 | Palsa | FLQEWERAKDRVRDDSQLEGWGKVKQMAETCRTDRDLYLRFVGN |
Ga0311371_103310111 | 3300029951 | Palsa | MEVFLKEWDRAKDRVRDESQLEAWEKVKHMAETCRHDRDLYLRFVGN |
Ga0311332_101623003 | 3300029984 | Fen | LAEWERAKDRARDDSQVEAWKRVKEMAEACRQDRDLYLRFVGN |
Ga0311332_102958813 | 3300029984 | Fen | GFLDEWERVRDRATDDPQKDAWQKIKEMAETCKEDRDLYLRFIGN |
Ga0311338_116495601 | 3300030007 | Palsa | ETFLREWDRAKDHARDESQLEAWEKVKTMAETCRQDRDLYLRFVGN |
Ga0302273_10868452 | 3300030048 | Bog | MEAFLREWERAKDRARDESQMEAWEKIKKMAEACRQDRDLYLRFVGN |
Ga0302177_103633631 | 3300030053 | Palsa | PFGKTVFNHLQMEAFLKEWDRAKDRVRDDSQLDAWEKVKHMAETCRHDRDLYLRFVGN |
Ga0265461_128502252 | 3300030743 | Soil | AKDRVRDDSQLEGWEKVKQMAETCKQDRDLYLRFVGN |
Ga0311335_106196572 | 3300030838 | Fen | PFGKTVFNHLQMAALLAEWERAKDRARDDSQVEAWKRVKEMAEACRQDRDLYLRFVGN |
Ga0311366_103556011 | 3300030943 | Fen | KTVFNHLQMAVFLSEWERVKDRARDESQMEAWQKVKEMAEHCSSDRDLYLRFVGN |
Ga0302180_102170062 | 3300031028 | Palsa | KEWDRAKDRVRDDSQLDAWEKVKHMAETCRHDRDLYLRFVGN |
Ga0302325_130984791 | 3300031234 | Palsa | LREWDRAKDRVRDDSQKEAWQKVKEMAETCRHDRDLYLRFVGN |
Ga0302324_1025605902 | 3300031236 | Palsa | HRQMEAFLKEWDRVKDRVHDENQLEAWKKVKEMAETCRQDRDLYLRFVGN |
Ga0265339_101448231 | 3300031249 | Rhizosphere | QMEAFLKEWDRIKARVHDDSQLEAWEKVKAMAETCRDDRDLYLRFVGN |
Ga0318561_102132181 | 3300031679 | Soil | KDRAKDESQSEAWQKVKEMAEACKSDRDLYLKFIGH |
Ga0318574_101296043 | 3300031680 | Soil | EWGRVHERAKDDTQREAWQKVKDMAETCRQDRDLYLRFVGHGH |
Ga0310686_1190058251 | 3300031708 | Soil | KDRVRDDSQKDAWQKVKEMAETCRADRDLYLRFVGN |
Ga0307469_117166101 | 3300031720 | Hardwood Forest Soil | TFLTEWERVKERAKDESQREAWQKVKEMAETCKSDRDLYLRFVGH |
Ga0307475_115834472 | 3300031754 | Hardwood Forest Soil | VFNHLQADEFLAEWERVRDRAKDESQREAWQKVKEMAEICKLDRDLYLRFVGH |
Ga0307478_103364682 | 3300031823 | Hardwood Forest Soil | REWDRAKDRVRDDNQLEAWNKVKSMAELCRDDRDLYLRFVGN |
Ga0308175_1019287271 | 3300031938 | Soil | EWDRVRDRARDDSQVEAWQKVKEMGEKCRADRDLYLRFVGN |
Ga0306926_117528861 | 3300031954 | Soil | WERVRDRAKDESQREAWQKVKEMAETCKSDRDLYLRFVGH |
Ga0306922_111840701 | 3300032001 | Soil | TVFNHLQAEVFLEEWERVRDRAKDESQREAWEKVKEMAEICKSDRDLYLRFVGH |
Ga0318507_102588711 | 3300032025 | Soil | FLAEWERVKDRAKDESQSEAWQKVKEMAEACKSDRDLYLKFIGH |
Ga0318545_103071021 | 3300032042 | Soil | VKDRAKDESQSEAWQKVKEMAEACKSDRDLYLKFIGH |
Ga0306920_1019736241 | 3300032261 | Soil | ERVRDRAKDESQREAWEKVKEMAEICKSDRDLYLRFVGH |
Ga0335079_107818112 | 3300032783 | Soil | FNHMQMEAFLKEWERIKERVRDDSQLEAWQRVKQMAETCRLDRDLYLRFVGH |
Ga0335084_111620611 | 3300033004 | Soil | WDRVKERARDESQAEAWKKVREMAEACREDRDLYLRFVGN |
Ga0326726_122134552 | 3300033433 | Peat Soil | LQMETFLEEWERVRHRAQDESQKEAWQKVKEMAQTCQTDRDLYLRFVGN |
Ga0310811_109823422 | 3300033475 | Soil | DEWERIRDRARDESQKAGWQKVKEMAEKCRDDRDLYLRFVGN |
Ga0371490_11377252 | 3300033561 | Peat Soil | NHLQMEAFLKEWDRVKDRARDDSELEAWHKVKHMAETCRHDRDLYLRFVGN |
Ga0371487_0459112_403_540 | 3300033982 | Peat Soil | AFLEEWERVKDRVRDDSQLEAWEKVKHMAETCRHDRDLYLRFVGN |
⦗Top⦘ |