NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F019738

Metagenome Family F019738

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019738
Family Type Metagenome
Number of Sequences 228
Average Sequence Length 42 residues
Representative Sequence MLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIKKYLD
Number of Associated Samples 205
Number of Associated Scaffolds 228

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 77.63 %
% of genes near scaffold ends (potentially truncated) 95.18 %
% of genes from short scaffolds (< 2000 bps) 94.30 %
Associated GOLD sequencing projects 193
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.772 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(8.333 % of family members)
Environment Ontology (ENVO) Unclassified
(20.614 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.789 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.65%    β-sheet: 0.00%    Coil/Unstructured: 57.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 228 Family Scaffolds
PF02371Transposase_20 1.32
PF12705PDDEXK_1 1.32
PF00589Phage_integrase 0.88
PF05116S6PP 0.44
PF14319Zn_Tnp_IS91 0.44
PF04796RepA_C 0.44
PF00239Resolvase 0.44
PF01339CheB_methylest 0.44
PF00665rve 0.44
PF01609DDE_Tnp_1 0.44
PF02781G6PD_C 0.44
PF00872Transposase_mut 0.44
PF13700DUF4158 0.44
PF00999Na_H_Exchanger 0.44
PF00069Pkinase 0.44

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 228 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.75
COG3547TransposaseMobilome: prophages, transposons [X] 1.32
COG2201Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domainsSignal transduction mechanisms [T] 0.88
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.44
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.44
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.44
COG5421TransposaseMobilome: prophages, transposons [X] 0.44
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.44
COG4584TransposaseMobilome: prophages, transposons [X] 0.44
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.44
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.44
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.44
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.44
COG3293TransposaseMobilome: prophages, transposons [X] 0.44
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.44
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.44
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.44
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.44
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.44
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.44
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.44
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.44
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.44
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.44
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 0.44


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.77 %
UnclassifiedrootN/A16.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_109025971Not Available565Open in IMG/M
3300001356|JGI12269J14319_10188300All Organisms → cellular organisms → Bacteria → Proteobacteria826Open in IMG/M
3300001526|A105W1_1168178All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300002072|JGIcombinedJ21914_10125092Not Available764Open in IMG/M
3300004024|Ga0055436_10236557Not Available580Open in IMG/M
3300004635|Ga0062388_100894206Not Available852Open in IMG/M
3300005434|Ga0070709_11718920Not Available512Open in IMG/M
3300005466|Ga0070685_10912395All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300005573|Ga0078972_1089059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.1847Open in IMG/M
3300005587|Ga0066654_10573432All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005591|Ga0070761_10614475All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300005921|Ga0070766_10518195All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300006028|Ga0070717_10969739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300006041|Ga0075023_100618177All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300006052|Ga0075029_100550314All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300006086|Ga0075019_10357961All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300006162|Ga0075030_100219701All Organisms → cellular organisms → Bacteria1527Open in IMG/M
3300006163|Ga0070715_10429429All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.741Open in IMG/M
3300006173|Ga0070716_101050795Not Available647Open in IMG/M
3300006174|Ga0075014_100367024All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300006176|Ga0070765_101879088All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300006176|Ga0070765_102058384Not Available534Open in IMG/M
3300006224|Ga0079037_101050778All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300006755|Ga0079222_11126921All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300006795|Ga0075520_1192707All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300006844|Ga0075428_102670995Not Available509Open in IMG/M
3300006904|Ga0075424_100995015All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300009012|Ga0066710_103536212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.590Open in IMG/M
3300009088|Ga0099830_10777777All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300009183|Ga0114974_10609273All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300009503|Ga0123519_10158885All Organisms → cellular organisms → Bacteria → Acidobacteria1686Open in IMG/M
3300009524|Ga0116225_1402697Not Available609Open in IMG/M
3300009525|Ga0116220_10196172All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300009631|Ga0116115_1105464All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300009636|Ga0116112_1237696All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium502Open in IMG/M
3300009637|Ga0116118_1073278All Organisms → cellular organisms → Bacteria → Acidobacteria1180Open in IMG/M
3300009665|Ga0116135_1371468All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300010046|Ga0126384_12257810Not Available525Open in IMG/M
3300010341|Ga0074045_10188494All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1386Open in IMG/M
3300010356|Ga0116237_10850690All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium773Open in IMG/M
3300010359|Ga0126376_12722100Not Available544Open in IMG/M
3300010362|Ga0126377_10899133Not Available948Open in IMG/M
3300010379|Ga0136449_104561295Not Available508Open in IMG/M
3300010398|Ga0126383_11295157All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300012038|Ga0137431_1125185All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300012199|Ga0137383_10240487All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1327Open in IMG/M
3300012202|Ga0137363_10806682All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium796Open in IMG/M
3300012202|Ga0137363_11457350All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300012206|Ga0137380_11639690Not Available527Open in IMG/M
3300012930|Ga0137407_11256233All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300012944|Ga0137410_10595879All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300012948|Ga0126375_10435808All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.958Open in IMG/M
3300012964|Ga0153916_10908905All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium961Open in IMG/M
3300013308|Ga0157375_11038609All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium958Open in IMG/M
3300013770|Ga0120123_1023593All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300014155|Ga0181524_10254063All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300014158|Ga0181521_10577943All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300014165|Ga0181523_10790880All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.517Open in IMG/M
3300014200|Ga0181526_10492384Not Available776Open in IMG/M
3300014201|Ga0181537_10936586All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300014201|Ga0181537_11122294All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.531Open in IMG/M
3300014490|Ga0182010_10828393All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium525Open in IMG/M
3300014492|Ga0182013_10704776All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium505Open in IMG/M
3300014493|Ga0182016_10686587All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300014498|Ga0182019_10880253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.644Open in IMG/M
3300014498|Ga0182019_11425891Not Available514Open in IMG/M
3300014501|Ga0182024_10240197All Organisms → cellular organisms → Bacteria → Acidobacteria2439Open in IMG/M
3300014502|Ga0182021_12591492All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300014655|Ga0181516_10232829All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300014657|Ga0181522_10430769Not Available791Open in IMG/M
3300014745|Ga0157377_10609404All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.780Open in IMG/M
3300014839|Ga0182027_10036386All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Trichlorobacter → Trichlorobacter thiogenes6330Open in IMG/M
3300015245|Ga0137409_10739502All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300015371|Ga0132258_11733576Not Available1575Open in IMG/M
3300015372|Ga0132256_101898814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.703Open in IMG/M
3300016387|Ga0182040_11410865Not Available590Open in IMG/M
3300016404|Ga0182037_10768632All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300016422|Ga0182039_10630011All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.940Open in IMG/M
3300017789|Ga0136617_10580750All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300017933|Ga0187801_10135098All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300017934|Ga0187803_10325945Not Available615Open in IMG/M
3300017966|Ga0187776_10726694All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.705Open in IMG/M
3300017975|Ga0187782_10755875All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.751Open in IMG/M
3300017975|Ga0187782_11563005All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300017995|Ga0187816_10506105All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300018007|Ga0187805_10395253All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300018019|Ga0187874_10189976All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300018026|Ga0187857_10468116All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300018026|Ga0187857_10522754All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium531Open in IMG/M
3300018030|Ga0187869_10359961Not Available696Open in IMG/M
3300018033|Ga0187867_10548220Not Available634Open in IMG/M
3300018034|Ga0187863_10447226All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300018043|Ga0187887_10714751All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300018044|Ga0187890_10552683All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300018047|Ga0187859_10467521All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300018062|Ga0187784_10705342All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300018081|Ga0184625_10233252All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.964Open in IMG/M
3300018481|Ga0190271_12706913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.595Open in IMG/M
3300020002|Ga0193730_1155106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.602Open in IMG/M
3300020021|Ga0193726_1022788All Organisms → cellular organisms → Bacteria3167Open in IMG/M
3300021372|Ga0213877_10216187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.627Open in IMG/M
3300021377|Ga0213874_10267659All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300021406|Ga0210386_11708349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300021420|Ga0210394_11304092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.620Open in IMG/M
3300021477|Ga0210398_10738519All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300021477|Ga0210398_11138318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.619Open in IMG/M
3300022756|Ga0222622_10605572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.791Open in IMG/M
3300022875|Ga0224553_1050524All Organisms → cellular organisms → Bacteria909Open in IMG/M
(restricted) 3300023060|Ga0224519_1045092All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium547Open in IMG/M
3300024056|Ga0124853_1243914All Organisms → cellular organisms → Bacteria3989Open in IMG/M
3300025507|Ga0208188_1131281All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300025527|Ga0208714_1064893Not Available765Open in IMG/M
3300025527|Ga0208714_1078972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium671Open in IMG/M
3300025878|Ga0209584_10238118All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300025888|Ga0209540_10444817All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300025891|Ga0209585_10090754All Organisms → cellular organisms → Bacteria → Acidobacteria1151Open in IMG/M
3300025891|Ga0209585_10451115All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium530Open in IMG/M
3300025910|Ga0207684_10531004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.1007Open in IMG/M
3300025911|Ga0207654_11136634All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium569Open in IMG/M
3300025924|Ga0207694_10159382All Organisms → cellular organisms → Bacteria1822Open in IMG/M
3300025930|Ga0207701_11521433All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300026035|Ga0207703_12147708All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300026216|Ga0209903_1049269All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300026527|Ga0209059_1350456Not Available501Open in IMG/M
3300026550|Ga0209474_10561448All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300026953|Ga0207835_1033820All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300027024|Ga0207819_1030469All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300027266|Ga0209215_1052892All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300027394|Ga0209904_1020372All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium520Open in IMG/M
3300027568|Ga0208042_1176529Not Available531Open in IMG/M
3300027676|Ga0209333_1113865All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300027680|Ga0207826_1172444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.588Open in IMG/M
3300027706|Ga0209581_1045848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1764Open in IMG/M
3300027767|Ga0209655_10295447Not Available523Open in IMG/M
3300027853|Ga0209274_10464708All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.655Open in IMG/M
3300027855|Ga0209693_10620247All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300027863|Ga0207433_10152488All Organisms → cellular organisms → Bacteria1911Open in IMG/M
3300027874|Ga0209465_10450523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.644Open in IMG/M
3300027889|Ga0209380_10569252All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300027895|Ga0209624_10871363All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.589Open in IMG/M
3300027903|Ga0209488_10162449Not Available1686Open in IMG/M
3300027910|Ga0209583_10219369All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300027911|Ga0209698_10065939All Organisms → cellular organisms → Bacteria → Proteobacteria3112Open in IMG/M
3300028047|Ga0209526_10574772All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300028552|Ga0302149_1177926Not Available555Open in IMG/M
3300028572|Ga0302152_10147657All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300028572|Ga0302152_10289917Not Available537Open in IMG/M
3300028775|Ga0302231_10188362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.862Open in IMG/M
3300028776|Ga0302303_10157374All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300028776|Ga0302303_10327144Not Available514Open in IMG/M
3300028795|Ga0302227_10217314All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300028800|Ga0265338_10615571All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300028860|Ga0302199_1249171All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium534Open in IMG/M
3300029883|Ga0311327_10488227All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300029914|Ga0311359_10730027All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300029944|Ga0311352_11273451All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium556Open in IMG/M
3300029951|Ga0311371_11174159All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300029952|Ga0311346_10790074All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300029982|Ga0302277_1033052All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42682Open in IMG/M
3300029986|Ga0302188_10031898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42622Open in IMG/M
3300030007|Ga0311338_10779052All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300030044|Ga0302281_10360045All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium568Open in IMG/M
3300030053|Ga0302177_10506760All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.623Open in IMG/M
3300030057|Ga0302176_10182460All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300030114|Ga0311333_10864142All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium762Open in IMG/M
3300030399|Ga0311353_10449704All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300030399|Ga0311353_10695297All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.878Open in IMG/M
3300030503|Ga0311370_11370768All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300030520|Ga0311372_11737634All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300030520|Ga0311372_12527711All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300030580|Ga0311355_11019912All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300030688|Ga0311345_10986256All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300030746|Ga0302312_10305691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300031228|Ga0299914_10491120All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus1061Open in IMG/M
3300031231|Ga0170824_117817492All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300031232|Ga0302323_100920510All Organisms → cellular organisms → Bacteria → Acidobacteria967Open in IMG/M
3300031234|Ga0302325_10691751All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.1471Open in IMG/M
3300031235|Ga0265330_10217608All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300031235|Ga0265330_10508957All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.513Open in IMG/M
3300031236|Ga0302324_101721302All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300031241|Ga0265325_10439238All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300031463|Ga0272448_1078451All Organisms → cellular organisms → Bacteria → Acidobacteria2240Open in IMG/M
3300031524|Ga0302320_11519440All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300031525|Ga0302326_13348419Not Available537Open in IMG/M
3300031545|Ga0318541_10242805All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.1000Open in IMG/M
3300031572|Ga0318515_10466354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.675Open in IMG/M
3300031668|Ga0318542_10403856All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.706Open in IMG/M
3300031708|Ga0310686_105623639Not Available909Open in IMG/M
3300031708|Ga0310686_105911304All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300031712|Ga0265342_10135806All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300031712|Ga0265342_10307567All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300031716|Ga0310813_10082485All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2457Open in IMG/M
3300031719|Ga0306917_10751850Not Available765Open in IMG/M
3300031747|Ga0318502_10544376All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300031788|Ga0302319_10183819All Organisms → cellular organisms → Bacteria2694Open in IMG/M
3300031788|Ga0302319_10227042All Organisms → cellular organisms → Bacteria → Proteobacteria2308Open in IMG/M
3300031788|Ga0302319_10626710All Organisms → cellular organisms → Bacteria → Acidobacteria1111Open in IMG/M
3300031788|Ga0302319_11717937All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300031873|Ga0315297_11222413All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300031880|Ga0318544_10310851Not Available612Open in IMG/M
3300031912|Ga0306921_10873471All Organisms → cellular organisms → Bacteria → Acidobacteria1023Open in IMG/M
3300031954|Ga0306926_11836739All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300032009|Ga0318563_10583634All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300032076|Ga0306924_11238383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.805Open in IMG/M
3300032094|Ga0318540_10294429All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300032160|Ga0311301_10185902All Organisms → cellular organisms → Bacteria3613Open in IMG/M
3300032173|Ga0315268_11296307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300032401|Ga0315275_11563980All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium706Open in IMG/M
3300032770|Ga0335085_10213959All Organisms → cellular organisms → Bacteria → Proteobacteria2348Open in IMG/M
3300032782|Ga0335082_11469154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.553Open in IMG/M
3300032805|Ga0335078_11248149All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300032828|Ga0335080_10859939All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.933Open in IMG/M
3300032828|Ga0335080_11099946All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium804Open in IMG/M
3300032892|Ga0335081_10469215All Organisms → cellular organisms → Bacteria → Proteobacteria1594Open in IMG/M
3300032892|Ga0335081_11883852All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300032892|Ga0335081_12408642Not Available547Open in IMG/M
3300032898|Ga0335072_10942036All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300032955|Ga0335076_11432786All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.577Open in IMG/M
3300032955|Ga0335076_11715884Not Available517Open in IMG/M
3300033004|Ga0335084_10944712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.870Open in IMG/M
3300033134|Ga0335073_11069151All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.826Open in IMG/M
3300033405|Ga0326727_11198762Not Available529Open in IMG/M
3300033557|Ga0316617_101216054All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.748Open in IMG/M
3300033827|Ga0334848_096448All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium523Open in IMG/M
3300034113|Ga0364937_118438All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300034124|Ga0370483_0204931All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300034149|Ga0364929_0113668All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300034150|Ga0364933_171678All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium565Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.33%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog6.58%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.82%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.95%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.95%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.51%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.51%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.07%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.63%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.63%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.19%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.19%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.19%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.75%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.75%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.32%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.32%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.32%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.32%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.32%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.88%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.88%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.88%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.44%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.44%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.44%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.44%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.44%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.44%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.44%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.44%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.44%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.44%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.44%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.44%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.44%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.44%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.44%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.44%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.44%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.44%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.44%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.44%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001526Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002072Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005)EnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005573Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly)EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009503Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010356AD_USDEcaEngineeredOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022875Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 10-14EnvironmentalOpen in IMG/M
3300023060 (restricted)Peat soil microbial communities from Stordalen Mire, Sweden - IR.B.S.T0EnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025891Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026216Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026953Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 8 (SPAdes)EnvironmentalOpen in IMG/M
3300027024Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes)EnvironmentalOpen in IMG/M
3300027266Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027394Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3DEnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027863Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028552Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031463Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300033827Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9EnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10902597123300001213WetlandMLTTEQINDLHRFYWSDHWPIRKIERHLHMGWKTSKKYLDAPAQ
JGI12269J14319_1018830033300001356Peatlands SoilMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKKYLDMPAQTPAG
A105W1_116817823300001526PermafrostMLSTDQINDLHRLYWSERWAIRKIERHLKISWKTIRKY
JGIcombinedJ21914_1012509223300002072Arctic Peat SoilMLNTDQINDLHRFYWSDRWPIRKIERHLRMGWRTIKKYLDMP
Ga0055436_1023655723300004024Natural And Restored WetlandsMLTTDQINDLHHLYWAERWPIRKIEQHLRMSWHTIKKYLE
Ga0062388_10089420613300004635Bog Forest SoilMLSTEQINDLHRLYWSERWPIRKIERHLRMGWHTIRKYLDAPAQG
Ga0070709_1171892023300005434Corn, Switchgrass And Miscanthus RhizosphereMLTTEQINDLHRLYWSEHWPIRKIERHLNMGWQTIKKYLDAPAQGPAKR
Ga0070685_1091239523300005466Switchgrass RhizosphereMLSTEQINELHRLYWSERWPIRKIERHLRMGWRTIRKYLEQPAQTRLL
Ga0078972_108905933300005573Hot SpringMLTADQINDLHSLYWSERWPIRKIERHLHRSWRTIKVA*
Ga0066654_1057343223300005587SoilMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKKYLDMPA
Ga0070761_1061447523300005591SoilMLSTDQINDLHRLYWSEHWPIRKIERHLRMSWRTIKKYLDAPAQGV
Ga0070766_1051819513300005921SoilMLTTEQINDLHRLYWSEQWPIRKIERHLNMGWKTIRK
Ga0070717_1096973933300006028Corn, Switchgrass And Miscanthus RhizosphereMLTTEQINDLHRLYWSEHWPIRKIERHLNMGWKTIRKYLDAPA
Ga0075023_10061817713300006041WatershedsMLSTDQINDLHRLYWSERWAIRKIERHLKISWKTIRKYLHAPAQAP
Ga0075029_10055031413300006052WatershedsMLTNEQIQTLHQLFYAERWPIRKIERHLRMGWRTIKKYLHQP
Ga0075019_1035796113300006086WatershedsMLTSEQINDLHRLYWSEHWPIRKIERHLKMSWRTIKKY
Ga0075030_10021970113300006162WatershedsMLTTEQINDLHRLYWSEHWPIRKIERHLNMCWKTIKKYLDAPT*
Ga0070715_1042942923300006163Corn, Switchgrass And Miscanthus RhizosphereMLSADQINDLHRLYWAERWPIRKIERHLRMSWRTIKK
Ga0070716_10105079513300006173Corn, Switchgrass And Miscanthus RhizosphereMLTTDQINDLHHLYWVARWPIRKIEQHLRMSWHTIKKYL
Ga0075014_10036702413300006174WatershedsMLTNEQIQTLHQLFYAERWPIRKIERHLRMGWRTIKKYLHQPDQP
Ga0070765_10187908813300006176SoilMLTTEQINDLHRLYWSEHWPIRKIERHLKMCWKTIKKYLDA
Ga0070765_10205838413300006176SoilMLTGDQINELHLLYVSEKWPIRKIERHLNMGWRTIRKYLDAPAQGA
Ga0079037_10105077833300006224Freshwater WetlandsMLTTEQINDLHCLYWSEHWPIRKIERHLHMGWDTIKKYLDMP
Ga0079222_1112692133300006755Agricultural SoilMLTSDQINDLHQMYWSERCSIRKIERHLNMGWRTIKK
Ga0075520_119270723300006795Arctic Peat SoilMLTTEQINDLHRRYWSDHWPIRKIERHLHMGWDTIKKYLDMPA
Ga0075428_10267099523300006844Populus RhizosphereMLTNEQIQTLHQLYYAERWPIRKIERHLRLGWRTIQKYLQKPDQP
Ga0075424_10099501513300006904Populus RhizosphereMLTTDQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLH
Ga0066710_10353621223300009012Grasslands SoilMLTIEQINELHRLYWSERWPIRKIERHLRMSWRTIKQYLD
Ga0099830_1077777723300009088Vadose Zone SoilMLTTEQINELHRLYWSEHWPIRKIERQLNMGWKTIRKYLDA
Ga0114974_1060927323300009183Freshwater LakeMLDTDQINELHRLYWAEQWSIRRIERHLKMCWRTIRKYLDVPSQIPALRH
Ga0123519_1015888533300009503Hot SpringMLTADQINDLHCLYWSERWPIRKIERHLHRSWRTIKAA*
Ga0116225_140269723300009524Peatlands SoilVPHKGKRALLTTDQINDLHHLYWVEHWPIRKIEQHLGMSWRTIKKYLEA
Ga0116220_1019617213300009525Peatlands SoilMLTTDQINDLHHLYWAERWPIHKIEQHLRMSWHTIKK
Ga0116115_110546423300009631PeatlandMRIEPMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPAQ
Ga0116112_123769623300009636PeatlandMLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIKKYLDMPAQTPAGRP
Ga0116118_107327823300009637PeatlandMLSTEQINDLHRLYWSERWPIRKIERHLRMGWHTIRKYLDAPA
Ga0116135_137146823300009665PeatlandMLTTDQINDLHHPYWAEHWPIRKIEQHLRMCWHTIKKYLEAPAQ
Ga0126384_1225781013300010046Tropical Forest SoilGNRAMLSTEQIKDLHRLYWSERWPIRKIERHLRMGWHTCV*
Ga0074045_1018849423300010341Bog Forest SoilMRIEPMLTTEQINDLHRRYWSDHWPIRKIERHLHMGWDTIKK*
Ga0116237_1085069013300010356Anaerobic Digestor SludgeMLTTDQINDLHHLYWAERWPIRKIEQHLRMSWRTIKKYLEA
Ga0126376_1272210013300010359Tropical Forest SoilKGNRAMLSTEQIKDLHRLYWSERWPIRKIERHLRMGWHTCV*
Ga0126377_1089913323300010362Tropical Forest SoilMLTTDQINDLHRLYWSEHWPIRKIERHLHMSWRTIKKYL
Ga0136449_10456129513300010379Peatlands SoilMLSTEQINDLHRLYWSERWPIRKIERHLSMGWHTIRKYLDA
Ga0126383_1129515733300010398Tropical Forest SoilMLSTDQINDLHRLYWSEHWPIRKIERHLRISWHTIKKYLDAPA
Ga0137431_112518513300012038SoilMLTPDQINDLHRLYWSERWPIRKIERHLRMGWRTIKKY
Ga0137383_1024048733300012199Vadose Zone SoilMLTTDQINELHRLYWSERWPIRKIERQLNIGWKTIRQYLDAPA
Ga0137363_1080668223300012202Vadose Zone SoilMLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIK
Ga0137363_1145735013300012202Vadose Zone SoilMRIEPMLTTEQINDLNRLYWSEHWPIRKIERHLHMG
Ga0137380_1163969023300012206Vadose Zone SoilMLTTDQINELHRLDWSEHWPIRKIERRLRMSWRTIQKYLNAPGKHPPRG
Ga0137407_1125623323300012930Vadose Zone SoilMLSTEQINDLHRLYWSERWPIRKIERHLRMGWHTI
Ga0137410_1059587913300012944Vadose Zone SoilMLTTDQINDLHRLYWSEHWSIRKIERHLKLSWRTIQKYLEAPGKRPALS*
Ga0126375_1043580823300012948Tropical Forest SoilMLTTEQINDLHRFYWSDHWPIRKIERHLHMGWKTIKKYLDAPAQ
Ga0153916_1090890513300012964Freshwater WetlandsMLTNEQIQILHQLYYAERWPIRKIERHLRMGWRTINKYLHQPDQPAVS
Ga0157375_1103860923300013308Miscanthus RhizosphereMLTTDQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLDTPAQTTA
Ga0120123_102359313300013770PermafrostMLSTDQINDLHRLYWSERWAIRKIERHLKISWKTIRKYLHAPAQAPA
Ga0181524_1025406313300014155BogMLTTDQINDLHHLYWVEHWPIRKIEQHLRMSWHTIKKY
Ga0181521_1057794323300014158BogVLTTDQINDLHHLFWSEHWPIRKIEGHLRMSWRTIK
Ga0181523_1079088023300014165BogMLSTDQINDLHRLYWSEHWPIRKIERHLRMSWRTIKKYLDAPAQGVAQR
Ga0181526_1049238423300014200BogMLTTDQINDLHHLYEVEHWPIRKIEQYLRMSWRTIKKYLDALAQT
Ga0181537_1093658613300014201BogMLTSDQINELHRLYVSERWPIRKIERHLNMGWKTIKKYLDAPA
Ga0181537_1112229423300014201BogMLDTEQINDLHRLYWSERWSIRKIERHLKMGWRTIRKYLKA
Ga0182010_1082839323300014490FenMLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIKKYLDM
Ga0182013_1070477623300014492BogMRIESMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKK
Ga0182016_1068658723300014493BogMLTTEQINDLHRFYWSEHWPIRKIERHLHMGWKTIKKYL
Ga0182019_1088025313300014498FenMLTNEQINDLHRFYWSERWPIRKIERHLQMGWKTIKK
Ga0182019_1142589123300014498FenMLSNEQINDLHRLYWSERWPIRKIERHLSMGWHTIRKYLDAPAQGPAQRP
Ga0182024_1024019753300014501PermafrostLNRSTNLNRLYRSERWPVRKIERHLCMSWHTIRKYLDAPAQAPAIL*
Ga0182021_1259149213300014502FenMRIEPMLTTEQINDLHRLYWSDHWPIRKIERHLHM
Ga0181516_1023282933300014655BogMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLH
Ga0181522_1043076923300014657BogMLTSDQIHELHRLYVSEKWPIRKIERHLNMGWRTIRKYLDAPAQGAT
Ga0157377_1060940423300014745Miscanthus RhizosphereMTMLTTEHINDLHRFYWSERWPIRKIERHLKMGWKTIKKYLD
Ga0182027_1003638653300014839FenMLTTDQINDLHHLYWVERWPIRKIEQHLRMSWHTIKKYL
Ga0137409_1073950233300015245Vadose Zone SoilMLTADQINDLHRLYWSEHWSIRKIERHLKLSWRTIQKYLEAPAQTPAKRE
Ga0132258_1173357623300015371Arabidopsis RhizosphereMLTADQINDLHRLYWSARWPIRKIERHLHRSWRTIKKYLDAPRP
Ga0132256_10189881413300015372Arabidopsis RhizosphereMLNTEQINELHRLYWSERWPIRKIERHLRMSWRTIKKYLHAPAQ
Ga0182040_1141086523300016387SoilMLTTEQINDLHRFYWSERWPIRKIERHLHMGWKTIKKYLVAPAQSPAT
Ga0182037_1076863223300016404SoilMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWNTIKKYLDMPAQTPAG
Ga0182039_1063001113300016422SoilMLSTEQINDLHRLYWSERWPVRKIAQHLHMGCNTIRKYLN
Ga0136617_1058075033300017789Polar Desert SandMLTTDQINELHRLYWSEHWPIRKIERQLNMGWKTIRKYIDAPA
Ga0187801_1013509823300017933Freshwater SedimentMLTTDQINDLHHLYWAERWPIRKIEQHLRMSWHTIKKYLETPAQT
Ga0187803_1032594513300017934Freshwater SedimentMLTADQINDLHHLYWAERWPIRKIEQHLRMSWRTIKKYLVAPAQT
Ga0187776_1072669423300017966Tropical PeatlandMLTTDQINELHRLYWSEHWPIRKIERHLRMSWRTIEIFLDGAPAHAQVAFDL
Ga0187782_1075587513300017975Tropical PeatlandVLTTEQINDLHRLYWSERWPIRKIERHLRMGWHTIRKYLDAPAQGPA
Ga0187782_1156300513300017975Tropical PeatlandMLSTEQINDLHRLYWSERWPIRKIERHLQMGWHTIRKY
Ga0187816_1050610523300017995Freshwater SedimentMLTTDQINDLHHLYWAEHWPIRKIEQHLRMSWQTIKKYLEAPRRRLRRRLA
Ga0187805_1039525313300018007Freshwater SedimentMLTTDQINDLHRLYWSEHWPIRKIERYLHMGWQTIKKYL
Ga0187874_1018997613300018019PeatlandMLTTDQINDLHHVYWVEHWPIRKIEQRLGMSWRTIKKYLEAPAQTPAA
Ga0187857_1046811623300018026PeatlandMLSTEQINDLHRLYWSEHWPIRKIERHLRMGWHTI
Ga0187857_1052275423300018026PeatlandMLTTEQINDLHRLYWSERWSIRKIERHLSMGWHTIRKYLDAPA
Ga0187869_1035996123300018030PeatlandMLSTEQINDLHRLYWSERWPIRKIERHLSMGWHTIRKYLDAP
Ga0187867_1054822013300018033PeatlandMLTTDQINDLHHLYWVEHWPIHKIEQHLGMSWRTIKKYLEA
Ga0187863_1044722623300018034PeatlandMLTTEQINDLHRLYWSEHWPIRKIERHLHMGWDTIK
Ga0187887_1071475113300018043PeatlandMLTTDQINDLHHLYWAEHWPIRKIEQHLRMSWHTIKKYLEAPAQTPAARS
Ga0187890_1055268313300018044PeatlandMLTSDQINELHLLYVSEKWPIRKIERHLNMGWRTIRKYLDA
Ga0187859_1046752113300018047PeatlandMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPA
Ga0187784_1070534213300018062Tropical PeatlandMLTDEQIQTLHQLYYAERWPIRKIERHLDMGWRTIKKYLHQPDQPA
Ga0184625_1023325223300018081Groundwater SedimentMLTTDQINDLHRLYWSERWPIRKIERHLRINWRTIKKYLDAPAQGP
Ga0190271_1270691313300018481SoilMLTADQINDLHRLYWSERWPIRKIERHLHRSWRTIKKY
Ga0193730_115510613300020002SoilMLTTDQINDLHRLFWSEHWPIRKIERHLKMCWKTIKV
Ga0193726_102278843300020021SoilMLTTDQINDLHHLYWVEHWPIRKIEQHLGMSWRTI
Ga0213877_1021618723300021372Bulk SoilMLSTEQINDLHRLYWSERWPVRKIERHLRMSWRTIRKYLDAP
Ga0213874_1026765913300021377Plant RootsMLTSDQINELHRMYVSEKWPIRKIERHLNMGWKTIKKY
Ga0210386_1170834913300021406SoilMLTTDQINELHRLYWSERWPIRKIERQLNIGWKTIRKYLDAPAQDPLRRDR
Ga0210394_1130409213300021420SoilMLSADQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLDAPAQSPAQRQ
Ga0210398_1073851923300021477SoilMLTSDQINELHRLYVSEKWPIRKIERHLNMGWRTIRKYLDMPAQG
Ga0210398_1113831823300021477SoilMLSTDQINDLHRLYWSEHWPIRKIERHLGMSWRTIKKYLDA
Ga0222622_1060557213300022756Groundwater SedimentMLTNEQINDLHRFYWSERWPIRKIERHLKLGWKTIKKS
Ga0224553_105052423300022875SoilMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPAQTP
(restricted) Ga0224519_104509223300023060SoilMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETI
Ga0124853_124391463300024056Freshwater WetlandsMLTTDQINDLHRRYWSERWPIRKIERYLRMDWQTIRKYLDMPAQTPAGRP
Ga0208188_113128123300025507PeatlandMLSTEQINDLHRLYWSERWPIRKIERHLRMGWHTIRKYLDA
Ga0208714_106489313300025527Arctic Peat SoilMLTTDQINDLHHLYWVEHWPIRKIEQHLGMSWRTIKKYLEAPAQTPAA
Ga0208714_107897213300025527Arctic Peat SoilMLTTDQINDLHHLYWAERWPIRKIEQHLRMSWRTIKKYLEAPAQTP
Ga0209584_1023811813300025878Arctic Peat SoilMLTTDQINDLHHLYWVEHWPIRKIEQHLGMSWRTIK
Ga0209540_1044481723300025888Arctic Peat SoilMKIEPMLTTEQINDLHRLYWSEHWPIRKIERHLHMGWET
Ga0209585_1009075443300025891Arctic Peat SoilMLNTDQINGLHRFYWSDRWPIRKIERHLRMGWRTIKKYLD
Ga0209585_1045111513300025891Arctic Peat SoilMKIEPMLTTEQINDLHRLYWSEHWPIRKIERHLHM
Ga0207684_1053100433300025910Corn, Switchgrass And Miscanthus RhizosphereMLSTEQINELHRLYWSERWPVRKIALHLHMGCNTIRKYLN
Ga0207654_1113663423300025911Corn RhizosphereMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKKYLD
Ga0207694_1015938213300025924Corn RhizosphereMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKKYLDMPAQTPAGRP
Ga0207701_1152143313300025930Corn, Switchgrass And Miscanthus RhizosphereMLNTDQINDLHRLYWSEHWSIRRIERHLKMCWKTIRK
Ga0207703_1214770813300026035Switchgrass RhizosphereMLTTDQINDLHHLYWVERWPIRKIEQHLRMSWHTIKKYLEAPAQTPA
Ga0209903_104926923300026216SoilMLTTEQINDLHRLYWSEHWPIRKIERHLNMCWKTIKKYLDAPA
Ga0209059_135045623300026527SoilMLTSDQINELHRLYVSEQWPIRKIERHLNMGWQTTIKKYL
Ga0209474_1056144813300026550SoilMLTTEQINDLHRLYWSEHWPIRKIERHLNMGWRTIRKYLDAPA
Ga0207835_103382013300026953Tropical Forest SoilMLTADQINDLHHLYWAERWPIRKIEQHLCMSWRTIKKYLEAPAQKPATRS
Ga0207819_103046913300027024Tropical Forest SoilMLTADQINDLHHLYWAERWPIRKIEQHLCMSWRTIKKYLEAPAQKP
Ga0209215_105289213300027266Forest SoilMLSTDQINDLHRLYWSERWTIRKIERHLRMGWRTIKKYL
Ga0209904_102037213300027394Thawing PermafrostMRIEPMLTTEQINDLHRLYWSEHWPIRKIERHLHMGWDTIKKYLDMPCLLYTSRCV
Ga0208042_117652923300027568Peatlands SoilMLTTDQINDLHHLYWAERWTIRKIEQHLRMSWHTIKKYLETPAQTSAT
Ga0209333_111386513300027676Forest SoilMLTSDQINELHRLYVSEKWPIRKIERHLNMGWRTIRKYLE
Ga0207826_117244423300027680Tropical Forest SoilMLTADQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLDAPAQAPAQRQ
Ga0209581_104584843300027706Surface SoilMLTTEQINELHHLYWSERWSIRKIERHLRMGWRTIRKYLESPAQ
Ga0209655_1029544723300027767Bog Forest SoilMLTSDQINDLHRLYVSEKWPIRKIERHLNMGWRTIRKYLDTPAQGAAP
Ga0209274_1046470823300027853SoilMLTTEQINDLHRLYWSEHWPIRKIERQLNIGWRTIRKYLDAPAQA
Ga0209693_1062024723300027855SoilMLDTEQINDLHRLYWSERWSIRKIERHLKMGWRTIR
Ga0207433_1015248833300027863Hot SpringMLTADQINDLHSLYWSERWPIRKIERHLHRSWRTIKVA
Ga0209465_1045052313300027874Tropical Forest SoilMLSTDQINDLYRLYWSERWPIRKIERHLRMGWRTIKKYLDAPAQGP
Ga0209380_1056925213300027889SoilMLTTEQINDLHRLYWSEHWPIRKIERQLNIGWRTIHKYLNAP
Ga0209624_1087136313300027895Forest SoilMLTTDQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLNA
Ga0209488_1016244913300027903Vadose Zone SoilRAMLTADQINDLHRLYWSEHWSIRKIERHVKMNWRTIQKYLEAPGKRPALS
Ga0209583_1021936913300027910WatershedsMLSTDQINNLHRLYWSERWAIRKIERHLKISWKTIRKYLHAPAQAP
Ga0209698_1006593943300027911WatershedsMLTTEQINDLHRLYWSEHWPIRKIERHLNMCWKTIKKYLDAPT
Ga0209526_1057477213300028047Forest SoilMLTTEQINDLHRLYWSEHWPIRKIERHLNMGWKTIRKYLD
Ga0302149_117792623300028552BogMLTSEQINDLHRLYWAEHWPIRKIERHLNMGWQTIKKYL
Ga0302152_1014765713300028572BogMLTSDQINELHRLYVSERWPIRKIERHLKLGWKTIKKYLE
Ga0302152_1028991713300028572BogMLTTDQINDLHRLYWSEHWPIRKIERQLNMGWKTIQKYLVAPA
Ga0302231_1018836223300028775PalsaMLSTDQINDLHRLYWSEHWPIRKIERHLRMSWRTIKKYLDA
Ga0302303_1015737423300028776PalsaMLTSDQINELHRLYVSERWPIRKIERHLKLGWKTIKKYLET
Ga0302303_1032714413300028776PalsaMLTSEQINDLHRLYWAEHWPIRKIERHLNMGWQTIKKYLDAPAQGVT
Ga0302227_1021731413300028795PalsaMLTTAQINDLHRLYWSDHWPIRKIERHLHMGWETIK
Ga0265338_1061557113300028800RhizosphereMLTSDQINDLHRLYWSERWPIRKIERHLKMGWRTIKKYLDM
Ga0302199_124917113300028860BogMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYL
Ga0311327_1048822723300029883BogMLTSDQINELHRLYVSERWPIRKIERHLKLGWKTIKKYL
Ga0311359_1073002713300029914BogMLTTDQINDLHHLYWSEHWPIRRIEQHLCMTWRTIKK
Ga0311352_1127345123300029944PalsaMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPAQTPAGRS
Ga0311371_1117415913300029951PalsaMLTTDQINELHRLYWSEHWPIRKIERQLNMGWRTIRKYIDAPAQSALHR
Ga0311346_1079007423300029952BogMLTSEQINDLHRLYWAEHWPIRKIERHLNMGWHTIKKYLDAPAQGA
Ga0302277_103305253300029982BogMLTTDQINDLHRLYWSEHWPIRKIERQLNMGWKTIQKYLVAPAQSA
Ga0302188_1003189813300029986BogMLTTDQINDLHRLYWSEHWPIRKIERQLNMGWKTI
Ga0311338_1077905223300030007PalsaMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPAQ
Ga0302281_1036004513300030044FenMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLD
Ga0302177_1050676023300030053PalsaMLTTDQINDLHRLYWSERWPIRKIERHLRMGWHTIKKYLEAPAQGPA
Ga0302176_1018246013300030057PalsaMLTTEQINDLHRLYWSEHWPIRKIERHLRMGWETIKKYLDMPAQT
Ga0311333_1086414213300030114FenMLTSDQINDLHHLYWVEHWPIRKIEQHLRMSWRTIKKYLEAPAQT
Ga0311353_1044970433300030399PalsaMLTSEQINDLHRLYWSERWPIRKIERHLKMGWKTIKKYLNAPAQG
Ga0311353_1069529723300030399PalsaMLTTDQINDLHRLYWSERWPIRKIERHLRMGWHTIKKYLEAPAQGP
Ga0311370_1137076813300030503PalsaMLTSEQINDLHRLYWSERWPIRKIERHLKMGWKTIK
Ga0311372_1173763413300030520PalsaMLTTDQINELHRLYWSERWPIRKIERQLNIGWKTIRKYLDAPAQD
Ga0311372_1252771123300030520PalsaMLSTDQINDLHRLYWSERWAIRKIERHLKISWKTIRKYL
Ga0311355_1101991213300030580PalsaMLTTDQINELHRLYWSEHWPIRKIERQLNMGWRTIRKYIDAPAQSALHRNR
Ga0311345_1098625613300030688BogMLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIKKYLDMPAQTP
Ga0302312_1030569123300030746PalsaMLTTEQINDLHRLYWSEHWPIRKIERHLRMGWETIKK
Ga0299914_1049112013300031228SoilMLDTDQINDLHRLYWSERWSIRKIERHLKMGWRTIRKYLEAPAQ
Ga0170824_11781749233300031231Forest SoilMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKKYLDMPAQ
Ga0302323_10092051033300031232FenMLTTEQINDLHRLYWSEHWPIRKIERHLNMCWKTIRKYLDAPAQGAV
Ga0302325_1069175113300031234PalsaVLSTEQINDLHRLYWSEHWPIRKIERHLRMGWHTIRKYLDAP
Ga0265330_1021760813300031235RhizosphereMLTTEQINDLHHLYWSEHWPIRKIERHLHMGWETIKKYLDMPAQTPAGR
Ga0265330_1050895713300031235RhizosphereMLDTEQINDPHRLYWSERWSIRKIERHLKMGWRTIRKYLE
Ga0302324_10172130213300031236PalsaMLTSEQINDLHRLYWAEHWPIRKIERHLNMGWQTIKKYLDA
Ga0265325_1043923813300031241RhizosphereMLTTDQINDLHHLYWAERWPIRKIEQHLRMSWRTIKKYLEAP
Ga0272448_107845133300031463SedimentMLTADQINDLHSLYWSERWPIRKIERHLHRSWRTIKAA
Ga0302320_1151944013300031524BogMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPAQTPA
Ga0302326_1334841913300031525PalsaMLTSEQINDLHRLYWAEHWPIRKIERHLTLGWQTIKKYLDAP
Ga0318541_1024280533300031545SoilMLTTDQINDLYRLYWSERWPIRKIERHLRMSWRTIKKYLDAPAQG
Ga0318515_1046635423300031572SoilMLTNEQIQTLHQLYYAERWSIRKIERHLSMGWRTIKKYLQQPD
Ga0318542_1040385623300031668SoilMLTTDQINDLYRLYWSERWPIRKIERHLRMSWRTIKKYLDGPAQ
Ga0310686_10562363913300031708SoilMLSTEQINDLHRLYWSERWPIRKIERHLRMGWHTIRKYLDAPAQ
Ga0310686_10591130413300031708SoilMLSTEQINYLHRLYWSERWPMRKIERHLRMGWQTIRKYL
Ga0265342_1013580613300031712RhizosphereMLTTEQINDLHHLYWSEHWPIRKIERHLHMGWETIKKYL
Ga0265342_1030756713300031712RhizosphereMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWETIKKYLDMPAQTPAGRP
Ga0310813_1008248543300031716SoilMLTTDRINELHRLYWSERWPIRKIERHLRMSWRTIKKY
Ga0306917_1075185023300031719SoilMLTTDQINGRLYWTEHWPIRKIERHLRMNWRTIKKYLDAPAQAPA
Ga0318502_1054437613300031747SoilMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWNTIK
Ga0302319_1018381913300031788BogMLDTEQINDLHRLYWSERWSIRKIERHLKMGWRTI
Ga0302319_1022704213300031788BogMLDTEQINDLHRLYWSERWSIRKIERHLKMGWRTIHKYLEAPAQGP
Ga0302319_1062671013300031788BogMLDTEQINDLHRLYWSERWSIRKIERHLKMGWRTIRKYLEALAQVPAVRSG
Ga0302319_1171793713300031788BogMLTSDQINELHRLYISERWPIRKIERHLKLGWKTIKKYLETPAQ
Ga0315297_1122241313300031873SedimentMLTTDQINDLHHLYWVERWPIRKIEQHLRMSWHTI
Ga0318544_1031085123300031880SoilMLTTDQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLDAPAQGPALR
Ga0306921_1087347113300031912SoilMLTIEQINDLHRLYWSEHWPIRKIERHLHMGWKTIKK
Ga0306926_1183673923300031954SoilMLTTDQINDLHHLYWAERWPIRKIEQHLRMSWHTIKKYLETPAQ
Ga0318563_1058363423300032009SoilMLSTDQINDLHRLYWSERWAIRKIERHLKISWKTIRKYLHAP
Ga0306924_1123838313300032076SoilMLNTEQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYLD
Ga0318540_1029442913300032094SoilMLTTDQINDLHHLYWVERWPIRKIEQHLRMSWHTIKKYLEAPAQ
Ga0311301_1018590213300032160Peatlands SoilMLTTDQINDLHHLYWAEHWPIRKIEQHLRMSWHTIK
Ga0315268_1129630713300032173SedimentMLTTDQINDLHHLYWAERWPIRKIEQHLRMSWHTIKKYLETPAQTPATR
Ga0315275_1156398023300032401SedimentMLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETI
Ga0335085_1021395933300032770SoilMLTTDQINDLHHLYWSEHWPIRKIERHLRMSWRTIKKYLHA
Ga0335082_1146915413300032782SoilMLTSDQINDLHRLYWSEHWPIRKIERHLHRSWRTIKKYLDAP
Ga0335078_1124814913300032805SoilMLTTDQINDLHHLYWAERWPIRKIEQHLRMSWHTIKKYLKAP
Ga0335080_1085993933300032828SoilMLTTDQINDLHRLYWSERWPIRKIERHLQMGWHTIRKYLDAPAQGPA
Ga0335080_1109994613300032828SoilMLTTDQINDLHHLYWAERWPIRKIEQHLRMSWHTIKKY
Ga0335081_1046921533300032892SoilMLSTEQINELHRLYWSERWPIRKIERHLRMSWRTIKKYLH
Ga0335081_1188385213300032892SoilMLTTDQINDLHHLYWSERWPIRRIERHLHLSWRTIKKYLEAPAQ
Ga0335081_1240864213300032892SoilMLTHEQIQTLYQLFYAERWPIRKIERHLGMGWRTIKK
Ga0335072_1094203613300032898SoilMLTADQINDLHHLYWVERWPIRKIEQHLRMSWHTIKKYLKAPAQT
Ga0335076_1143278613300032955SoilMLTADQINDLHRLYWSERWPIRKIERHLRMSWRTIKKYL
Ga0335076_1171588413300032955SoilMLTTDQINELHRLYWSEHWPIRKIERHLRMSWRTIKKYLDAPAQGP
Ga0335084_1094471213300033004SoilMLTTDQINDLHRLYWSERWPIRKIERHLRMSWRTIKK
Ga0335073_1106915113300033134SoilMLTTDQINDLHRLYWSEHWPIRKIERHLRMSWRTIKKYLDAPAQGPA
Ga0326727_1119876213300033405Peat SoilMLSTEQINDLHRLYWSEHWPIRKIERHLRMGWHTIRKYLDAPAQGPAR
Ga0316617_10121605413300033557SoilMLTADQINDLHRLYWSERWPIRKIERHLHRSWRTIKKYLDAPAQSAA
Ga0334848_096448_1_1203300033827SoilMLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIKKYLD
Ga0364937_118438_2_1513300034113SedimentMLTPDQINDLHRLYWSERWPIRKIERHLRMGWRTIKKYLDMPAQTPAGRP
Ga0370483_0204931_544_6693300034124Untreated Peat SoilMLTTEQINDLHRLYWSEHWPIRKIERHLHMGWETIKKYLDMP
Ga0364929_0113668_732_8603300034149SedimentMLTTDQINDLHHLYWVERWPIRKIEQHLRMSWHTIKKYLKAPA
Ga0364933_171678_425_5653300034150SedimentMRIEPMLTTEQINDLHRLYWSDHWPIRKIERHLHMGWDTIKKYLDMP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.