Basic Information | |
---|---|
Family ID | F019568 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 229 |
Average Sequence Length | 39 residues |
Representative Sequence | MENRTEPKTVGQWIRYVVVAVIALWLVIWMLRISGINIL |
Number of Associated Samples | 174 |
Number of Associated Scaffolds | 229 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 61.14 % |
% of genes near scaffold ends (potentially truncated) | 16.59 % |
% of genes from short scaffolds (< 2000 bps) | 77.73 % |
Associated GOLD sequencing projects | 154 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.052 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (7.424 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.358 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.852 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.82% β-sheet: 0.00% Coil/Unstructured: 64.18% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 229 Family Scaffolds |
---|---|---|
PF00753 | Lactamase_B | 8.30 |
PF00106 | adh_short | 3.49 |
PF14606 | Lipase_GDSL_3 | 2.62 |
PF00903 | Glyoxalase | 2.18 |
PF08818 | DUF1801 | 2.18 |
PF07995 | GSDH | 2.18 |
PF14607 | GxDLY | 1.75 |
PF00578 | AhpC-TSA | 1.31 |
PF04185 | Phosphoesterase | 1.31 |
PF00487 | FA_desaturase | 1.31 |
PF01966 | HD | 1.31 |
PF13483 | Lactamase_B_3 | 1.31 |
PF13561 | adh_short_C2 | 1.31 |
PF13320 | DUF4091 | 0.87 |
PF04250 | DUF429 | 0.87 |
PF07676 | PD40 | 0.87 |
PF01061 | ABC2_membrane | 0.87 |
PF13744 | HTH_37 | 0.87 |
PF00583 | Acetyltransf_1 | 0.87 |
PF13635 | DUF4143 | 0.87 |
PF13432 | TPR_16 | 0.87 |
PF00149 | Metallophos | 0.87 |
PF05362 | Lon_C | 0.87 |
PF00206 | Lyase_1 | 0.87 |
PF02403 | Seryl_tRNA_N | 0.44 |
PF04238 | DUF420 | 0.44 |
PF01176 | eIF-1a | 0.44 |
PF13499 | EF-hand_7 | 0.44 |
PF13709 | DUF4159 | 0.44 |
PF08757 | CotH | 0.44 |
PF05638 | T6SS_HCP | 0.44 |
PF00691 | OmpA | 0.44 |
PF13673 | Acetyltransf_10 | 0.44 |
PF00930 | DPPIV_N | 0.44 |
PF01381 | HTH_3 | 0.44 |
PF00391 | PEP-utilizers | 0.44 |
PF00227 | Proteasome | 0.44 |
PF08241 | Methyltransf_11 | 0.44 |
PF05569 | Peptidase_M56 | 0.44 |
PF00202 | Aminotran_3 | 0.44 |
PF05973 | Gp49 | 0.44 |
PF00724 | Oxidored_FMN | 0.44 |
PF11994 | DUF3489 | 0.44 |
PF04545 | Sigma70_r4 | 0.44 |
PF13378 | MR_MLE_C | 0.44 |
PF01797 | Y1_Tnp | 0.44 |
PF14378 | PAP2_3 | 0.44 |
PF11138 | DUF2911 | 0.44 |
PF13470 | PIN_3 | 0.44 |
PF00756 | Esterase | 0.44 |
PF04055 | Radical_SAM | 0.44 |
PF12399 | BCA_ABC_TP_C | 0.44 |
PF07691 | PA14 | 0.44 |
PF01478 | Peptidase_A24 | 0.44 |
PF07859 | Abhydrolase_3 | 0.44 |
PF05721 | PhyH | 0.44 |
PF13298 | LigD_N | 0.44 |
PF01738 | DLH | 0.44 |
PF01636 | APH | 0.44 |
PF12543 | DUF3738 | 0.44 |
PF07681 | DoxX | 0.44 |
PF13582 | Reprolysin_3 | 0.44 |
PF11149 | DUF2924 | 0.44 |
PF07238 | PilZ | 0.44 |
PF02463 | SMC_N | 0.44 |
PF00111 | Fer2 | 0.44 |
PF04389 | Peptidase_M28 | 0.44 |
PF14031 | D-ser_dehydrat | 0.44 |
PF04008 | Adenosine_kin | 0.44 |
PF13414 | TPR_11 | 0.44 |
PF00654 | Voltage_CLC | 0.44 |
COG ID | Name | Functional Category | % Frequency in 229 Family Scaffolds |
---|---|---|---|
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 2.18 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 2.18 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 2.18 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 2.18 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 1.31 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.31 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 1.31 |
COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.87 |
COG2410 | Predicted nuclease (RNAse H fold) | General function prediction only [R] | 0.87 |
COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.87 |
COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.44 |
COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.44 |
COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.44 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.44 |
COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.44 |
COG5337 | Spore coat protein CotH | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
COG3157 | Type VI protein secretion system component Hcp (secreted cytotoxin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.44 |
COG2322 | Cytochrome oxidase assembly protein CtaM/YozB, DUF420 family | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.44 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.44 |
COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.44 |
COG1839 | Adenosine/AMP kinase | Nucleotide transport and metabolism [F] | 0.44 |
COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.44 |
COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.44 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.44 |
COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.44 |
COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.44 |
COG0172 | Seryl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.44 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.44 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.49 % |
Unclassified | root | N/A | 27.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459017|G14TP7Y02HW2EY | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
3300000567|JGI12270J11330_10149890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 879 | Open in IMG/M |
3300004114|Ga0062593_102712051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300004156|Ga0062589_100555920 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300004463|Ga0063356_101156555 | Not Available | 1120 | Open in IMG/M |
3300004463|Ga0063356_102671601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
3300004479|Ga0062595_102224827 | Not Available | 538 | Open in IMG/M |
3300004635|Ga0062388_101455729 | Not Available | 690 | Open in IMG/M |
3300004643|Ga0062591_102098453 | Not Available | 585 | Open in IMG/M |
3300005093|Ga0062594_100837905 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300005183|Ga0068993_10169382 | Not Available | 746 | Open in IMG/M |
3300005327|Ga0070658_10117222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 2211 | Open in IMG/M |
3300005327|Ga0070658_10633184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 928 | Open in IMG/M |
3300005329|Ga0070683_100000694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 24453 | Open in IMG/M |
3300005329|Ga0070683_100034556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4619 | Open in IMG/M |
3300005334|Ga0068869_100943333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 749 | Open in IMG/M |
3300005334|Ga0068869_101581077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 584 | Open in IMG/M |
3300005334|Ga0068869_102057156 | Not Available | 513 | Open in IMG/M |
3300005338|Ga0068868_100662148 | Not Available | 931 | Open in IMG/M |
3300005367|Ga0070667_100859347 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300005434|Ga0070709_11179926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300005435|Ga0070714_100727777 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300005436|Ga0070713_100467444 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
3300005440|Ga0070705_100836271 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300005444|Ga0070694_100510099 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300005458|Ga0070681_11248061 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300005529|Ga0070741_10837837 | Not Available | 800 | Open in IMG/M |
3300005533|Ga0070734_10014827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 5416 | Open in IMG/M |
3300005534|Ga0070735_10005167 | All Organisms → cellular organisms → Bacteria | 10880 | Open in IMG/M |
3300005537|Ga0070730_10012999 | All Organisms → cellular organisms → Bacteria | 6723 | Open in IMG/M |
3300005538|Ga0070731_10007536 | All Organisms → cellular organisms → Bacteria | 8456 | Open in IMG/M |
3300005538|Ga0070731_11087019 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005544|Ga0070686_100381482 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300005545|Ga0070695_100833653 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300005546|Ga0070696_101167948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 649 | Open in IMG/M |
3300005578|Ga0068854_100971816 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300005591|Ga0070761_10720094 | Not Available | 625 | Open in IMG/M |
3300005598|Ga0066706_10903545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 688 | Open in IMG/M |
3300005616|Ga0068852_100611758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
3300005617|Ga0068859_101557885 | Not Available | 730 | Open in IMG/M |
3300005618|Ga0068864_100324494 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
3300005618|Ga0068864_100850837 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300005618|Ga0068864_101798022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
3300005650|Ga0075038_11421617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1420 | Open in IMG/M |
3300005712|Ga0070764_10903158 | Not Available | 553 | Open in IMG/M |
3300005718|Ga0068866_10731324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 682 | Open in IMG/M |
3300005836|Ga0074470_10333824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
3300005841|Ga0068863_101368758 | Not Available | 715 | Open in IMG/M |
3300005842|Ga0068858_101671169 | Not Available | 629 | Open in IMG/M |
3300005842|Ga0068858_101892012 | Not Available | 590 | Open in IMG/M |
3300005921|Ga0070766_10860006 | Not Available | 620 | Open in IMG/M |
3300006028|Ga0070717_10133107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 2140 | Open in IMG/M |
3300006028|Ga0070717_10501494 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300006028|Ga0070717_11381909 | Not Available | 640 | Open in IMG/M |
3300006046|Ga0066652_101689132 | Not Available | 578 | Open in IMG/M |
3300006057|Ga0075026_100333709 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300006059|Ga0075017_100329018 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300006163|Ga0070715_10171367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
3300006173|Ga0070716_100115313 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
3300006176|Ga0070765_100698411 | Not Available | 958 | Open in IMG/M |
3300006176|Ga0070765_101505800 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300006176|Ga0070765_101934498 | Not Available | 552 | Open in IMG/M |
3300006237|Ga0097621_100017720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5417 | Open in IMG/M |
3300006237|Ga0097621_100713719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 924 | Open in IMG/M |
3300006237|Ga0097621_100827072 | Not Available | 859 | Open in IMG/M |
3300006237|Ga0097621_102180052 | Not Available | 530 | Open in IMG/M |
3300006237|Ga0097621_102258690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300006358|Ga0068871_100355382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1297 | Open in IMG/M |
3300006358|Ga0068871_100601843 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
3300006638|Ga0075522_10067906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2004 | Open in IMG/M |
3300006797|Ga0066659_11576382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300006806|Ga0079220_11721278 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300006871|Ga0075434_101743861 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300006881|Ga0068865_100569514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 953 | Open in IMG/M |
3300007799|Ga0105049_10626555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 773 | Open in IMG/M |
3300009083|Ga0105047_11242025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 577 | Open in IMG/M |
3300009089|Ga0099828_10300947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1443 | Open in IMG/M |
3300009089|Ga0099828_11195907 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300009093|Ga0105240_10314663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1786 | Open in IMG/M |
3300009098|Ga0105245_10160908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 2130 | Open in IMG/M |
3300009098|Ga0105245_10441137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1309 | Open in IMG/M |
3300009098|Ga0105245_11709934 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 681 | Open in IMG/M |
3300009098|Ga0105245_11804940 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300009148|Ga0105243_11886723 | Not Available | 630 | Open in IMG/M |
3300009174|Ga0105241_11487700 | Not Available | 651 | Open in IMG/M |
3300009176|Ga0105242_10017945 | All Organisms → cellular organisms → Bacteria | 5527 | Open in IMG/M |
3300009177|Ga0105248_10026495 | All Organisms → cellular organisms → Bacteria | 6450 | Open in IMG/M |
3300009177|Ga0105248_11059999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 916 | Open in IMG/M |
3300009177|Ga0105248_11745948 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300009177|Ga0105248_12747240 | Not Available | 561 | Open in IMG/M |
3300009540|Ga0073899_11204445 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300009545|Ga0105237_12299840 | Not Available | 549 | Open in IMG/M |
3300009633|Ga0116129_1071762 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300009643|Ga0116110_1216786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 618 | Open in IMG/M |
3300010048|Ga0126373_10906991 | Not Available | 945 | Open in IMG/M |
3300010373|Ga0134128_12448478 | Not Available | 575 | Open in IMG/M |
3300010379|Ga0136449_100020780 | All Organisms → cellular organisms → Bacteria | 16765 | Open in IMG/M |
3300010379|Ga0136449_100136625 | All Organisms → cellular organisms → Bacteria | 4863 | Open in IMG/M |
3300010399|Ga0134127_10433576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1309 | Open in IMG/M |
3300010403|Ga0134123_10214594 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
3300010403|Ga0134123_12248421 | Not Available | 608 | Open in IMG/M |
3300011269|Ga0137392_10640976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300012096|Ga0137389_11046422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300012189|Ga0137388_11224457 | Not Available | 689 | Open in IMG/M |
3300012361|Ga0137360_10601040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
3300012363|Ga0137390_10102506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2830 | Open in IMG/M |
3300012533|Ga0138256_10108103 | All Organisms → cellular organisms → Bacteria | 2636 | Open in IMG/M |
3300012917|Ga0137395_11171653 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300012918|Ga0137396_11291941 | Not Available | 507 | Open in IMG/M |
3300012960|Ga0164301_11554755 | Not Available | 547 | Open in IMG/M |
3300012982|Ga0168317_1013869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2524 | Open in IMG/M |
3300012987|Ga0164307_10998901 | Not Available | 681 | Open in IMG/M |
3300013104|Ga0157370_10305613 | Not Available | 1468 | Open in IMG/M |
3300013296|Ga0157374_10145966 | All Organisms → cellular organisms → Bacteria | 2298 | Open in IMG/M |
3300013297|Ga0157378_11255743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
3300013297|Ga0157378_11293373 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 770 | Open in IMG/M |
3300013306|Ga0163162_13043663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
3300013307|Ga0157372_10709686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1170 | Open in IMG/M |
3300014169|Ga0181531_10746201 | Not Available | 610 | Open in IMG/M |
3300014199|Ga0181535_10158623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1413 | Open in IMG/M |
3300014301|Ga0075323_1088466 | Not Available | 652 | Open in IMG/M |
3300014501|Ga0182024_10317179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 2052 | Open in IMG/M |
3300014502|Ga0182021_12487579 | Not Available | 623 | Open in IMG/M |
3300014657|Ga0181522_10394360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
3300014838|Ga0182030_10258210 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
3300014969|Ga0157376_10480572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1217 | Open in IMG/M |
3300014969|Ga0157376_12334307 | Not Available | 574 | Open in IMG/M |
3300015063|Ga0167649_101380 | All Organisms → cellular organisms → Bacteria | 3041 | Open in IMG/M |
3300015371|Ga0132258_11812762 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300017936|Ga0187821_10328316 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300017975|Ga0187782_11648093 | Not Available | 507 | Open in IMG/M |
3300017988|Ga0181520_10051529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3911 | Open in IMG/M |
3300017988|Ga0181520_10440196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
3300018017|Ga0187872_10350040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 635 | Open in IMG/M |
3300018034|Ga0187863_10640852 | Not Available | 599 | Open in IMG/M |
3300019258|Ga0181504_1261149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300020070|Ga0206356_10334655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1219 | Open in IMG/M |
3300020070|Ga0206356_10624518 | Not Available | 691 | Open in IMG/M |
3300020070|Ga0206356_10963941 | Not Available | 625 | Open in IMG/M |
3300020082|Ga0206353_12019349 | Not Available | 581 | Open in IMG/M |
3300020579|Ga0210407_10028507 | All Organisms → cellular organisms → Bacteria | 4150 | Open in IMG/M |
3300020580|Ga0210403_10559185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
3300021168|Ga0210406_11031313 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300021170|Ga0210400_10081822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2538 | Open in IMG/M |
3300021170|Ga0210400_10125214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 2054 | Open in IMG/M |
3300021170|Ga0210400_10168803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1769 | Open in IMG/M |
3300021403|Ga0210397_11185837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300021404|Ga0210389_10114949 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
3300021404|Ga0210389_10179327 | Not Available | 1648 | Open in IMG/M |
3300021432|Ga0210384_10910038 | Not Available | 780 | Open in IMG/M |
3300021433|Ga0210391_10819773 | Not Available | 727 | Open in IMG/M |
3300021475|Ga0210392_10048044 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
3300021559|Ga0210409_10762715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 839 | Open in IMG/M |
3300021559|Ga0210409_11345942 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300022309|Ga0224510_10053989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2170 | Open in IMG/M |
3300022716|Ga0242673_1075170 | Not Available | 613 | Open in IMG/M |
3300024283|Ga0247670_1000509 | All Organisms → cellular organisms → Bacteria | 8853 | Open in IMG/M |
3300024288|Ga0179589_10511408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 558 | Open in IMG/M |
3300024323|Ga0247666_1007048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 2502 | Open in IMG/M |
3300025862|Ga0209483_1053448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1892 | Open in IMG/M |
3300025893|Ga0207682_10624156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
3300025903|Ga0207680_10533878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
3300025913|Ga0207695_11570947 | Not Available | 538 | Open in IMG/M |
3300025914|Ga0207671_10416115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1069 | Open in IMG/M |
3300025922|Ga0207646_11749724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300025924|Ga0207694_10000927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 25984 | Open in IMG/M |
3300025927|Ga0207687_10190867 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
3300025927|Ga0207687_10275564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1346 | Open in IMG/M |
3300025927|Ga0207687_10825820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 791 | Open in IMG/M |
3300025928|Ga0207700_10007503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6671 | Open in IMG/M |
3300025934|Ga0207686_10066277 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
3300025934|Ga0207686_10229333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1345 | Open in IMG/M |
3300025937|Ga0207669_11189150 | Not Available | 646 | Open in IMG/M |
3300025937|Ga0207669_11369522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 602 | Open in IMG/M |
3300025938|Ga0207704_11710681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
3300025941|Ga0207711_10008731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8472 | Open in IMG/M |
3300025941|Ga0207711_11856310 | Not Available | 546 | Open in IMG/M |
3300025942|Ga0207689_10074895 | All Organisms → cellular organisms → Bacteria | 2782 | Open in IMG/M |
3300025945|Ga0207679_10144537 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
3300025945|Ga0207679_11115445 | Not Available | 724 | Open in IMG/M |
3300025960|Ga0207651_10897895 | Not Available | 789 | Open in IMG/M |
3300026035|Ga0207703_11459840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
3300026088|Ga0207641_12065726 | Not Available | 571 | Open in IMG/M |
3300027826|Ga0209060_10174907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 993 | Open in IMG/M |
3300027850|Ga0209591_10582975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 706 | Open in IMG/M |
3300027853|Ga0209274_10155765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
3300027854|Ga0209517_10096427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2006 | Open in IMG/M |
3300027862|Ga0209701_10363780 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300027867|Ga0209167_10000474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 29190 | Open in IMG/M |
3300027869|Ga0209579_10012427 | All Organisms → cellular organisms → Bacteria | 5105 | Open in IMG/M |
3300027869|Ga0209579_10686967 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300027879|Ga0209169_10674820 | Not Available | 537 | Open in IMG/M |
3300027986|Ga0209168_10013361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4805 | Open in IMG/M |
3300028648|Ga0268299_1037774 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
3300028800|Ga0265338_10255108 | Not Available | 1292 | Open in IMG/M |
3300028906|Ga0308309_11113662 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300029911|Ga0311361_10891438 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300031057|Ga0170834_100881889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 680 | Open in IMG/M |
3300031057|Ga0170834_106990701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 747 | Open in IMG/M |
3300031234|Ga0302325_11543428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 852 | Open in IMG/M |
3300031344|Ga0265316_11253850 | Not Available | 512 | Open in IMG/M |
3300031344|Ga0265316_11311031 | Not Available | 500 | Open in IMG/M |
3300031595|Ga0265313_10004043 | All Organisms → cellular organisms → Bacteria | 11436 | Open in IMG/M |
3300031708|Ga0310686_101152168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
3300031708|Ga0310686_106435404 | Not Available | 584 | Open in IMG/M |
3300031708|Ga0310686_107891163 | All Organisms → cellular organisms → Bacteria | 3010 | Open in IMG/M |
3300031708|Ga0310686_117401524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus roseus → Terriglobus roseus DSM 18391 | 1082 | Open in IMG/M |
3300031708|Ga0310686_117618222 | Not Available | 539 | Open in IMG/M |
3300031711|Ga0265314_10002044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 21343 | Open in IMG/M |
3300031715|Ga0307476_10828567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
3300031716|Ga0310813_10366002 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300031962|Ga0307479_12180760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 501 | Open in IMG/M |
3300032160|Ga0311301_10147340 | All Organisms → cellular organisms → Bacteria | 4278 | Open in IMG/M |
3300032160|Ga0311301_10147884 | All Organisms → cellular organisms → Bacteria | 4266 | Open in IMG/M |
3300032160|Ga0311301_10278326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2713 | Open in IMG/M |
3300032160|Ga0311301_12149701 | Not Available | 643 | Open in IMG/M |
3300032205|Ga0307472_101747638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300032770|Ga0335085_10204548 | All Organisms → cellular organisms → Bacteria | 2415 | Open in IMG/M |
3300032770|Ga0335085_10249217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2136 | Open in IMG/M |
3300032783|Ga0335079_10090260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisoma → unclassified Acidisoma → Acidisoma sp. L85 | 3478 | Open in IMG/M |
3300032783|Ga0335079_10122469 | All Organisms → cellular organisms → Bacteria | 2936 | Open in IMG/M |
3300032805|Ga0335078_10162122 | All Organisms → cellular organisms → Bacteria | 3151 | Open in IMG/M |
3300032828|Ga0335080_10330914 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
3300032893|Ga0335069_10128549 | All Organisms → cellular organisms → Bacteria | 3164 | Open in IMG/M |
3300032893|Ga0335069_10845578 | Not Available | 1027 | Open in IMG/M |
3300032895|Ga0335074_10733264 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300032898|Ga0335072_11720765 | Not Available | 522 | Open in IMG/M |
3300033412|Ga0310810_10958825 | Not Available | 739 | Open in IMG/M |
3300033513|Ga0316628_102097875 | Not Available | 750 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.42% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.68% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.80% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.80% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.93% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 3.06% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.62% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.18% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.18% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.18% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.75% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.31% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.31% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.31% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.31% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.87% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.87% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.87% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.87% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.44% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.44% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.44% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.44% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.44% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.44% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.44% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.44% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.44% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.44% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.44% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.44% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.44% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.44% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.44% |
Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.44% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.44% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.44% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.44% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.44% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.44% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007799 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 | Environmental | Open in IMG/M |
3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015063 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3b, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028648 | Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactor | Engineered | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4ZMR_03392850 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MENRTEPRTVAQWIRYVLMAVIAIWLVIWMLRLSGINVL |
JGI12270J11330_101498903 | 3300000567 | Peatlands Soil | TEPRTAREWIRYIVVAVIAIWLVIWMLRISGINIL* |
Ga0062593_1027120512 | 3300004114 | Soil | MENRTEPRTLWQWIRYIVVAVIALWLVVWMLRISGIDIL* |
Ga0062589_1005559202 | 3300004156 | Soil | MENRTEPKTVGQWIRYVVVAVIAIWLVIWMLRLSGINIL* |
Ga0063356_1011565553 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MENRMEPKTLGQWIRYLVVAVIALWLVVWMLRISGIDIL* |
Ga0063356_1026716012 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MENRTEPRTVGQWIRYIVVAVIALWLVVWMLRISGINVL* |
Ga0062595_1022248271 | 3300004479 | Soil | MENRTEPKTLRQWIRYIVVAAIAIWLVIWMLRLSGINVL* |
Ga0062388_1014557291 | 3300004635 | Bog Forest Soil | VANRTEPQTLGQWIRYIIVAAIAIWLVIWMLRLSGIDVL* |
Ga0062591_1020984531 | 3300004643 | Soil | MENRTEPRTVAQWIRYVLMAVIAIWLVIWMLRLSGINVL* |
Ga0062594_1008379052 | 3300005093 | Soil | MEYRTEPKTVGQWIRYVVVAVIAIWLVIWMLRLSGINIL* |
Ga0068993_101693822 | 3300005183 | Natural And Restored Wetlands | MENRTEPKTAFQWIRYIVVAVIALWLVIWMLRISGIDIL* |
Ga0070658_101172224 | 3300005327 | Corn Rhizosphere | MENRTEPKTAAQWVRYIVVAVIALWLVVWMLRISGINLF* |
Ga0070658_106331841 | 3300005327 | Corn Rhizosphere | MENRTEPRTAAQWIRYVVVSVIALWLVVWMLRISGINLF* |
Ga0070683_1000006947 | 3300005329 | Corn Rhizosphere | MENRTEPKTAVQWVRYVVVAVIALWLVLWMLRISGINIL* |
Ga0070683_1000345563 | 3300005329 | Corn Rhizosphere | MENRTEPKTAAQWIRYVVVSVIALWLVVWMLRISGINLF* |
Ga0068869_1009433332 | 3300005334 | Miscanthus Rhizosphere | MPNRTEPKTVGQWIRYIAVAVIALWLVVWMLRISGIDIL* |
Ga0068869_1015810773 | 3300005334 | Miscanthus Rhizosphere | MENRTEPKTPRQWIRYIVVAVIALWLVVWMLRISGIDIL* |
Ga0068869_1020571562 | 3300005334 | Miscanthus Rhizosphere | MENRTEPTTVKGWIRYVVVAVIAIWLVIWMLRISGIDIF* |
Ga0068868_1006621482 | 3300005338 | Miscanthus Rhizosphere | MENRTEPRTVGQWIRYLVVAVIALWLVIWMLRISGINIL* |
Ga0070667_1008593472 | 3300005367 | Switchgrass Rhizosphere | MENRTEPKTAGQWIRYIVVAVIALWLVVWMLRISGIDIL* |
Ga0070709_111799262 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPKTVGQWIRYVVVAVIAIWLVVWMLRLSGINVL* |
Ga0070714_1007277772 | 3300005435 | Agricultural Soil | MPNRTEPKTLGQWIRYIVVAVIAIWLVIWMLRISGINLL* |
Ga0070713_1004674441 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPKTAAQWIRYMVVAAIALWLVVWMLRISGINIF* |
Ga0070705_1008362712 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPKTVGQWIRYVVVAMIAIWLVIWMLRLSDINIL* |
Ga0070694_1005100992 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPKTVGQWIRYVVVAMIAIWLVIWMLRLSGINIL* |
Ga0070681_112480612 | 3300005458 | Corn Rhizosphere | MENRTEPKTVGQWIRYVVVAVIAIWLVIWMWRLSGINIL* |
Ga0070741_108378372 | 3300005529 | Surface Soil | MPNRTEPKSLREWIRYIVVAIIAIWLVIYMLRISGINIF* |
Ga0070734_100148274 | 3300005533 | Surface Soil | MTNRTEPKTPAQWIRYVVAGVIAIWLVIWMLRISGIDIL* |
Ga0070735_100051677 | 3300005534 | Surface Soil | VENRTEPKTVGQWIRYVVVAVIALWLVVWMLRISGINIL* |
Ga0070730_100129997 | 3300005537 | Surface Soil | MENRTEPRTVGQWIRYIVVAAIAIWLVIWMLRISGINVL* |
Ga0070731_100075362 | 3300005538 | Surface Soil | MENRTEPKTVGQWIRYVVVAAIAIWLVIWMLRLSGINVL* |
Ga0070731_110870192 | 3300005538 | Surface Soil | MENRTEPKTVAQWIRYVVVAAIAIWLVIWMLRLSGINIL* |
Ga0070686_1003814822 | 3300005544 | Switchgrass Rhizosphere | MENRTEPKTFRQWVRYIVVAVIALWLVIWMLRISGIDIL* |
Ga0070695_1008336532 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPRTVGQWIRYVVVAVIAIWLVIWMLRLSGINVL* |
Ga0070696_1011679481 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPKTARQWIRYIAVAAIAIWLVIWMLRISGINII* |
Ga0068854_1009718162 | 3300005578 | Corn Rhizosphere | VMENRTEPKTAGQWIRYIVVAVIALWLVVWMLRISGIDIL* |
Ga0070761_107200941 | 3300005591 | Soil | THPKTVGEWVRYLVVAAVAVWLVIWLLRISGIPL* |
Ga0066706_109035452 | 3300005598 | Soil | MENRTEPKTLGQWIRYVVVAAIAIWLVIWMLRLSGINVL* |
Ga0068852_1006117584 | 3300005616 | Corn Rhizosphere | SQESLMENRTEPKTAAQWIRYVVVSVIALWLVVWMLRISGINLF* |
Ga0068859_1015578853 | 3300005617 | Switchgrass Rhizosphere | MANRTAPRTVGQWIRYIVGAIIAIWLVIWMLRISGINIL* |
Ga0068864_1003244943 | 3300005618 | Switchgrass Rhizosphere | MENRTEPRTVGQWIRYLVVAVIALWLVIWMLRISGINIF* |
Ga0068864_1008508373 | 3300005618 | Switchgrass Rhizosphere | LENRTEPRTVGQWIRYVVVAVIALWLVIWMLRISGINLF* |
Ga0068864_1017980222 | 3300005618 | Switchgrass Rhizosphere | MENRTEPKTFRQWIRYVVVAVIALWLVIWMLRISGIDIL* |
Ga0075038_114216172 | 3300005650 | Permafrost Soil | MVNRTEPRTAAQWIRYIVVAVIAIWLVIWMLRMSGINIF* |
Ga0070764_109031582 | 3300005712 | Soil | MPNRTQPTTVGQWIRYIVVAAVAIWLVIWMLRISGI* |
Ga0068866_107313242 | 3300005718 | Miscanthus Rhizosphere | MENRTEPTTVKGWIRYVVVAVIAIWLVIWMLRISGIDIL* |
Ga0074470_103338242 | 3300005836 | Sediment (Intertidal) | MANRTEPKTLWQLIRYVVVAIIAIWLVIWMLRLSGIDLI* |
Ga0068863_1013687582 | 3300005841 | Switchgrass Rhizosphere | MENRTEPRTFGQWIRYLVFAVVALWLVVWMLRISGINLI* |
Ga0068858_1016711691 | 3300005842 | Switchgrass Rhizosphere | MENRTEPKTVGQWIRYVVVAVIALWLVIWMLRISGINIL* |
Ga0068858_1018920122 | 3300005842 | Switchgrass Rhizosphere | MENRTEPKTIGQWIRYLVVAVIALWLVVWMLRISGINLF* |
Ga0070766_108600063 | 3300005921 | Soil | MANRTQPRTIKEWIRYIVVAVVALWLVVWMLRISGISIF* |
Ga0070717_101331073 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MANRTEPKTLGQWIRYIVVAIIAIWLVIWMLRISGINIL* |
Ga0070717_105014942 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPRTVGQWIRYVVVAAIAIWLVIWMLRISGIHIL* |
Ga0070717_113819093 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPKTAAQWVRYLVVAAIALWLVVWMLRISGINLF* |
Ga0066652_1016891322 | 3300006046 | Soil | MENRTEPKTPGQWIRYIVVAVIALWLVVWMLRISGIDIL* |
Ga0075026_1003337092 | 3300006057 | Watersheds | MENRTEPKTLRQWIRYLVMAGIALWLILWMLQGSGINLF* |
Ga0075017_1003290181 | 3300006059 | Watersheds | MENRTEPKTVGQWIRYVVVAVIAIWLVIWMLRLSGIN |
Ga0070715_101713672 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPRTVAQWIRYVVMAVIAIWLVIWMLRLSGINVL* |
Ga0070716_1001153131 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RTEPKTVWQWIRYLVVAVIAIWLVIWMLRLSGINVL* |
Ga0070765_1006984113 | 3300006176 | Soil | MANRTEPTTPAQWIRYVVVSVVAIWLVIWMLRISGINIL* |
Ga0070765_1015058002 | 3300006176 | Soil | MENRTEPKTFGQWIRYLVVAVIALWLVVWMLRISGINIL* |
Ga0070765_1019344981 | 3300006176 | Soil | MANRTEPKTPAQWIRYVTVGVIAIWLVIWMLRISGINIL* |
Ga0097621_1000177205 | 3300006237 | Miscanthus Rhizosphere | MENRTEPRTIGQWIRYLVVAVIALWLVVWMLRISGVNFL* |
Ga0097621_1007137192 | 3300006237 | Miscanthus Rhizosphere | MENRTEPRTFRQWIRYIVVAVIALWLVIWMLRISGIDVL* |
Ga0097621_1008270722 | 3300006237 | Miscanthus Rhizosphere | MENRTEPKTAAQWIRYIVVAVIALWLVVWMLRISGVNVL* |
Ga0097621_1021800522 | 3300006237 | Miscanthus Rhizosphere | MPNRTEPKTVAQWIRYIVVAVIALWLVVWMLRISGIDIL* |
Ga0097621_1022586902 | 3300006237 | Miscanthus Rhizosphere | MGNRTEPKTAREWFRYIVVAVIAIWLVIWMLRISGINIL* |
Ga0068871_1003553822 | 3300006358 | Miscanthus Rhizosphere | MENRTEPRTFGQWIRYIVVAAIALWLVVWMLRISGIDIL* |
Ga0068871_1006018432 | 3300006358 | Miscanthus Rhizosphere | MENRTEPKTAGQWIRYIVVAVIALWLVVWMLRISGVNVL* |
Ga0075522_100679063 | 3300006638 | Arctic Peat Soil | MTNQTEPKTLRQWIRYLIVAAIAIWLVIWMLRMLGINIL* |
Ga0066659_115763822 | 3300006797 | Soil | MENRTEPRTVGQWIRYVVVAAIAIWLVIWMLRISGIYIL* |
Ga0079220_117212782 | 3300006806 | Agricultural Soil | MENRTEPKTAGQWIRYVVMAVIALWLVVWMLRISGINIL* |
Ga0075434_1017438612 | 3300006871 | Populus Rhizosphere | MENRTQPRTIGQWIRYVVVAVIALWLVIWMLRISGINIF* |
Ga0068865_1005695142 | 3300006881 | Miscanthus Rhizosphere | MENRTEPRTPRQWIRYIVVAVIALWLVVWMLRISGIDIL* |
Ga0105049_106265551 | 3300007799 | Freshwater | VPNQTEPRTIWQWIRYLVVAVIAIWLVIWMLNLSGIQ |
Ga0105047_112420252 | 3300009083 | Freshwater | VPNQTEPRTIWQWIRYLVVAVIAIWLVIWMLNLSGI |
Ga0099828_103009472 | 3300009089 | Vadose Zone Soil | MENRTEPRTVGQWIRYLVVAAIAIWLVIWMLKLSGINVL* |
Ga0099828_111959072 | 3300009089 | Vadose Zone Soil | MENRTEPKTVGQWIRYLVVAIIAIWLVIWMLRISGINVL |
Ga0105240_103146634 | 3300009093 | Corn Rhizosphere | MENRTEPKTAAQWIRYIVVAAIALWLVVWMLRISGINVF* |
Ga0105245_101609083 | 3300009098 | Miscanthus Rhizosphere | MENRTEPRTVGQWIRYLVVAVIALWLVIWMLRVSGINIL* |
Ga0105245_104411372 | 3300009098 | Miscanthus Rhizosphere | MENRTEPRTVGQWIRYVVVAVIALWLVIWMLRISGINIL* |
Ga0105245_117099342 | 3300009098 | Miscanthus Rhizosphere | MENRTEPKTVRHWIRDIVVAAIAIWLVIWMLRISGINII* |
Ga0105245_118049402 | 3300009098 | Miscanthus Rhizosphere | MPNRTEPKTVGQWIRYIVVAVIALWLVVWMLRISGINIL* |
Ga0105243_118867231 | 3300009148 | Miscanthus Rhizosphere | MENRTEPKTFGQWIRYLVFAVVALWLVVWMLRISGINLI* |
Ga0105241_114877002 | 3300009174 | Corn Rhizosphere | MENRTEPKTAGQWIRYIVVAVIALWLVVWMLRISGIEIL* |
Ga0105242_100179456 | 3300009176 | Miscanthus Rhizosphere | MENRTEPKTLWQWIRYIVVAVIALWLVVWMLRISGIDIL* |
Ga0105248_100264955 | 3300009177 | Switchgrass Rhizosphere | MKAMENRTEPRTLGQWIRYVVFAVIALWLVVWMLRLSGINLI* |
Ga0105248_110599993 | 3300009177 | Switchgrass Rhizosphere | MENRTEPKTFRQWVRYIVVAVIALWLVIWMLRISGIDIF* |
Ga0105248_117459482 | 3300009177 | Switchgrass Rhizosphere | MADRTEPKTLAQRIHYIVVAVIALWLVVWMLGLSGLNIV* |
Ga0105248_127472403 | 3300009177 | Switchgrass Rhizosphere | MENRTEPKTAAQWVRYIVVAVIALWLVIWMLRISGINLF* |
Ga0073899_112044451 | 3300009540 | Activated Sludge | MGRRTEPRTLWEWIRYVVVAMIAIWLILWMLRMSGIHV |
Ga0105237_122998401 | 3300009545 | Corn Rhizosphere | MENRTEPKTAIQWIRYVVVAVIALWLVVWMLRISGINLF* |
Ga0116129_10717622 | 3300009633 | Peatland | MENRTEPRTFREWIRYIVVALIALFLVAWLLRLYIV* |
Ga0116110_12167862 | 3300009643 | Peatland | MEDDMPNRTEPRTVGQWIRYVVVAAIAIWLVIWMLRISGINLL* |
Ga0126373_109069913 | 3300010048 | Tropical Forest Soil | MSNRTQPKTIAEWIRYLVVAVIALWLVVWMLRISGIDLL* |
Ga0134128_124484783 | 3300010373 | Terrestrial Soil | MENRTEPRTVGQWIRYVAVAVIALWLVVWMLRISGINIL* |
Ga0136449_10002078012 | 3300010379 | Peatlands Soil | MANRTQPRTIKEWIRYIAVAVVALWLVVWMLRISGINIL* |
Ga0136449_1001366253 | 3300010379 | Peatlands Soil | MGNRTEPRTFREWIRYLAVAVVVLWLVIWMLRISGINIL* |
Ga0134127_104335764 | 3300010399 | Terrestrial Soil | MENRTEPKTAAEWVRYIVVAVIALWLVLWMLRISGINIL* |
Ga0134123_102145942 | 3300010403 | Terrestrial Soil | MEYRTEPKTVGQWIRYVVVAMIAIWLVIWMLRLSDINIL* |
Ga0134123_122484211 | 3300010403 | Terrestrial Soil | ENRTEPTTVKGWIRYVVVAVIAIWLVIWMLRISGIDIL* |
Ga0137392_106409762 | 3300011269 | Vadose Zone Soil | MKRIMENRTEPKTVWQWIRYLVVAVIAIWLVIWMLRLSGINVL* |
Ga0137389_110464222 | 3300012096 | Vadose Zone Soil | MKRIMENRTEPQTVWQWIRYLVVAVIAIWLVIWMLRLS |
Ga0137388_112244571 | 3300012189 | Vadose Zone Soil | GDTGTMANRTEPKTVGQWIRYIVVAVIAIWLVIWMLRLSGINVL* |
Ga0137360_106010402 | 3300012361 | Vadose Zone Soil | MENRTEPKTVGQWIRYVVMAVIAIWLVIWMLRLSGINVL |
Ga0137390_101025064 | 3300012363 | Vadose Zone Soil | MKRIMENRTEPKTVWQWIRYLVVAVIAIWLVIWMLRLSVINVL* |
Ga0138256_101081032 | 3300012533 | Active Sludge | MGRRTEPRTLWEWIRYVVVAMIAIWLILWMLRMSGIHVL* |
Ga0137395_111716532 | 3300012917 | Vadose Zone Soil | MGNRTEPKTLGQWTRYIVVAAIAIWLVIWMLRISGINVL* |
Ga0137396_112919412 | 3300012918 | Vadose Zone Soil | MANRTEPRTVGQWIRYIVVAAIAIWLVIWMLRLSGI |
Ga0164301_115547551 | 3300012960 | Soil | MENRTAPRTFRQWIRYIVVAVIALWLVIWMLRISGIDI |
Ga0168317_10138693 | 3300012982 | Weathered Mine Tailings | MENRTEPKTAAQWVRYIVVAAIALWLVVWMLRISGINLF* |
Ga0164307_109989013 | 3300012987 | Soil | MENRTEPKTAAQWIRYMVVAAIVLWLVVWMLRISGINIF* |
Ga0157370_103056133 | 3300013104 | Corn Rhizosphere | MENRTEPRTAGQWIRYLVVAVIALWLVIWMLRISGINIL* |
Ga0157374_101459664 | 3300013296 | Miscanthus Rhizosphere | LENRTEPKTFGQWIRYVVVAVIALWLVVWMLRISGINIF* |
Ga0157378_112557431 | 3300013297 | Miscanthus Rhizosphere | TEPKTAAQWIRYVVVSVIALWLVVWMLRISGINLF* |
Ga0157378_112933732 | 3300013297 | Miscanthus Rhizosphere | LENRTEPRTVGQWIRYIVVAVIALWLVVWMLRISGVNIF* |
Ga0163162_130436631 | 3300013306 | Switchgrass Rhizosphere | MENRTEPKTAWQWIRYIVVAVIALWLVVWMLRISGIDIL* |
Ga0157372_107096861 | 3300013307 | Corn Rhizosphere | ICMENRTEPKTARQWIRYIVVAAIAIWLVIWMLRISGINIL* |
Ga0181531_107462012 | 3300014169 | Bog | MENRTEPRTAGQWIRYIVVALIALFLVAWMMRVYVL* |
Ga0181535_101586232 | 3300014199 | Bog | MANRTEPKTIREWIRYVVVAVIALWLVVWMLRISGIDIL* |
Ga0075323_10884661 | 3300014301 | Natural And Restored Wetlands | MENRTEPKTVGQWIRYVVVAVIALWLVVWMLRISGIDIL* |
Ga0182024_103171794 | 3300014501 | Permafrost | MENRTEPKTAAQWIRYIVVAAIALWLVVWMLRISGINIL* |
Ga0182021_124875791 | 3300014502 | Fen | VGMENRTEPRTFWQWIRYIVVALIAIWLVIWMLRFVGIDLL* |
Ga0181522_103943602 | 3300014657 | Bog | MANRTEPKTIREWIRYVAVAAVAIWLVIWMLRMSGIDIL* |
Ga0182030_102582104 | 3300014838 | Bog | MANRTEPKTLREWIRYIVVAAIAIWLVVWMLRMSGIDIL* |
Ga0157376_104805721 | 3300014969 | Miscanthus Rhizosphere | MENRTEPRTVGQWIRYIVMAVIAIWLVIWMLRISG |
Ga0157376_123343072 | 3300014969 | Miscanthus Rhizosphere | MENRTEPRTPRQWIRYIVVAVIALWLVVWMLRISG |
Ga0167649_1013805 | 3300015063 | Glacier Forefield Soil | EPKTARQWILYVVVAAIATWLVIWMLRLSGIDIL* |
Ga0132258_118127622 | 3300015371 | Arabidopsis Rhizosphere | MENRTEPRTIGQWIRYLVVAAIAIWLVIWMLKISGINVF* |
Ga0187821_103283161 | 3300017936 | Freshwater Sediment | MENRTEPRTVGQWIRYVVVAVIAIWLVIWMLRLSG |
Ga0187782_116480932 | 3300017975 | Tropical Peatland | VPNRTQPATPGQWIRYIMVAVIALWLVIWMLRISGIDIL |
Ga0181520_100515293 | 3300017988 | Bog | MENSTEPKTAGQWIRYIVVAIIALWLVYWMLRSYVL |
Ga0181520_104401962 | 3300017988 | Bog | MENRTEPRTAGQWIRYIVVALIALFLVAWMMRVYVL |
Ga0187872_103500402 | 3300018017 | Peatland | MEDDMPNRTEPRTVGQWIRYVVVAAIAIWLVIWMLRISGINLL |
Ga0187863_106408522 | 3300018034 | Peatland | MIPMANRTEPKTIRELIRYIVVAVIALWLVAWMLRISGIDIL |
Ga0181504_12611492 | 3300019258 | Peatland | MANRTEPKTIREWIRYVAVAAVAIWLVIWMLRMSGIDIL |
Ga0206356_103346553 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPKTAVQWVRYVVVAVIALWLVLWMLRISGINIL |
Ga0206356_106245182 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPRTAGQWIRYLVVAVIALWLVIWMLRISGINIL |
Ga0206356_109639413 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPKTAAQWIRYVVVSVIALWLVVWMLRISGINLF |
Ga0206353_120193492 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPRTAAQWIRYVVVSVIALWLVVWMLRISGINLF |
Ga0210407_100285073 | 3300020579 | Soil | MENRTEPKTLGQWIRYVVVAVIAIWLVIWMLRLSGIKVL |
Ga0210403_105591852 | 3300020580 | Soil | MPNRTQPKTVGQWIRYIVLAIVAIWLVMLRISGIDIL |
Ga0210406_110313132 | 3300021168 | Soil | MANRTEPKTLGQWIRYLVVAVIALWLVVWMLRISGINLF |
Ga0210400_100818223 | 3300021170 | Soil | VAENRTEPKTIRQWIRYIVVAAIALWLVVWMLRISGVNIL |
Ga0210400_101252142 | 3300021170 | Soil | MANRTEPKTLGQWVRYVVVAAIAIWLVIWMLRISGINIL |
Ga0210400_101688034 | 3300021170 | Soil | VAENRTEPKTVGQWIRYIVVAVIALWLVVWMLRISGINIL |
Ga0210397_111858372 | 3300021403 | Soil | MENRTEPKTAREWIRYIVVAVIAIWLVIWMLRISGVNIL |
Ga0210389_101149496 | 3300021404 | Soil | MANRTQPKTVREWIRYIAVAGIALWLVVWMLRMSGINIF |
Ga0210389_101793272 | 3300021404 | Soil | MADEPMANRTQPKTLKEWIRYIAVAVVALWLVIWMLRISGINIF |
Ga0210384_109100381 | 3300021432 | Soil | VENRTEPKTIGQWIRYIVVAVIALWLVIWMLRISGINIL |
Ga0210391_108197732 | 3300021433 | Soil | MANRTEPKTPAQWIRYVTVGVIAIWLVIWMLRISGINIL |
Ga0210392_100480443 | 3300021475 | Soil | MANRTEPKTIGQWIRYLVVAVIALWLVVWMLRISGINLF |
Ga0210409_107627152 | 3300021559 | Soil | MANRTEPRTLGQWIRYIVVAIIAIWLVIWMLRISGINIL |
Ga0210409_113459423 | 3300021559 | Soil | MANRTEPKTVGQWIRYIVVAVIAIWLVIWMLRLSGIDIL |
Ga0224510_100539892 | 3300022309 | Sediment | MANRTEPKTFREWVRYLVMAGIALWLVNWMLQTSGISLF |
Ga0242673_10751702 | 3300022716 | Soil | MVMPNRTEPRTAGQWIRYAVVAAIAIWLVIWMLRISGIDVL |
Ga0247670_10005098 | 3300024283 | Soil | MENRTEPKTVGQWIRYVVVATIAIWLVIWMLRLSGINVL |
Ga0179589_105114082 | 3300024288 | Vadose Zone Soil | LENRTEPKTATQWIRYIVAAVIALWLVVWMLRISGINLF |
Ga0247666_10070481 | 3300024323 | Soil | MANRTEPKTFAQWCRYIAMAVVALWLVIWMLRISGINVF |
Ga0209483_10534483 | 3300025862 | Arctic Peat Soil | MTNQTEPKTLRQWIRYLIVAAIAIWLVIWMLRMLGINIL |
Ga0207682_106241562 | 3300025893 | Miscanthus Rhizosphere | VMENRTEPKTAGQWIRYIVVAVIALWLVVWMLRISGIDIL |
Ga0207680_105338781 | 3300025903 | Switchgrass Rhizosphere | MENRTEPKTAGQWIRYIVVAVIALWLVVWMLRISGIDIL |
Ga0207695_115709473 | 3300025913 | Corn Rhizosphere | MENRTEPKTAAQWIRYIVVAAIALWLVVWMLRISGINVI |
Ga0207671_104161153 | 3300025914 | Corn Rhizosphere | MENRTEPKTAAQWVRYIVVAVIALWLVVWMLRISGINLF |
Ga0207646_117497241 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPKTVWQWIRYLVVAVIAIWLVIWMLRLSGINVL |
Ga0207694_1000092721 | 3300025924 | Corn Rhizosphere | MENRTEPKTAAQWVRYVVMAVIALWLVLWMLRISGINIL |
Ga0207687_101908672 | 3300025927 | Miscanthus Rhizosphere | MENRTEPTTVKGWIRYVVVAVIAIWLVIWMLRISGIDIL |
Ga0207687_102755643 | 3300025927 | Miscanthus Rhizosphere | MENRTEPRTVGQWIRYVVVAVIALWLVIWMLRISGINIL |
Ga0207687_108258202 | 3300025927 | Miscanthus Rhizosphere | MENRTEPKTVGQWIRYIVVAVIALWLVVWMLQISGINIL |
Ga0207700_100075034 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MENRTEPKTAAQWVRYLVVAAIALWLVVWMLRISGINLF |
Ga0207686_100662773 | 3300025934 | Miscanthus Rhizosphere | MENRTEPKTLWQWIRYIVVAVIALWLVVWMLRISGIDIL |
Ga0207686_102293333 | 3300025934 | Miscanthus Rhizosphere | MENRTEPRTPRQWIRYIVVAVIALWLVVWMLRISGIDIL |
Ga0207669_111891502 | 3300025937 | Miscanthus Rhizosphere | MENRTEPKTLWQWIRYIVVAVIALWLVVWMLRISG |
Ga0207669_113695223 | 3300025937 | Miscanthus Rhizosphere | VMENRTEPKTLWQWIRYIVVAVIALWLVVWMLRISGIDIL |
Ga0207704_117106812 | 3300025938 | Miscanthus Rhizosphere | MENRTEPKTPRQWIRYIVVAVIALWLVVWMLRISGIDIL |
Ga0207711_100087314 | 3300025941 | Switchgrass Rhizosphere | MKAMENRTEPRTLGQWIRYVVFAVIALWLVVWMLRLSGINLI |
Ga0207711_118563102 | 3300025941 | Switchgrass Rhizosphere | MENRTEPKTAAQWVRYIVVAVIALWLVIWMLRISGINLF |
Ga0207689_100748952 | 3300025942 | Miscanthus Rhizosphere | MGNRTEPKTVGQWIRYIVVAVIALWLVVWMLRISGINIL |
Ga0207679_101445373 | 3300025945 | Corn Rhizosphere | VMENRTEPKTAGQWIGYIVVAVIALWLVVWMLRISGIDIL |
Ga0207679_111154452 | 3300025945 | Corn Rhizosphere | MENRTEPKTPRQWIRYIVVAVIALWLVIWMLRISGIDIL |
Ga0207651_108978951 | 3300025960 | Switchgrass Rhizosphere | SAVKKPMENRTEPRTVGQWIRYLVVAVIALWLVIWMLRISGINIL |
Ga0207703_114598402 | 3300026035 | Switchgrass Rhizosphere | MENRTEPKTFRQWIRYVVVAVIALWLVIWMLRISGIDIL |
Ga0207641_120657262 | 3300026088 | Switchgrass Rhizosphere | MENRTEPRTFGQWIRYLVFAVIALWLVVWMLRISGINLI |
Ga0209060_101749072 | 3300027826 | Surface Soil | MTNRTEPKTPAQWIRYVVAGVIAIWLVIWMLRISGIDIL |
Ga0209591_105829752 | 3300027850 | Freshwater | NQTEPRTIWQWIRYLVVAVIAIWLVIWMLNLSGIQVL |
Ga0209274_101557651 | 3300027853 | Soil | MGNRTEPGTFREWIRYIGVAVIALWLVVWMLRLSGI |
Ga0209517_100964273 | 3300027854 | Peatlands Soil | MANRTQPRTIKEWIRYIAVAVVALWLVVWMLRISGINIL |
Ga0209701_103637802 | 3300027862 | Vadose Zone Soil | MENRTEPRTVGQWIRYLVVAAIAIWLVIWMLKLSGINVL |
Ga0209167_100004748 | 3300027867 | Surface Soil | MANRTQPGTIKEWIRYIAAAVIALWLVVWMLRISGINIP |
Ga0209579_100124277 | 3300027869 | Surface Soil | MENRTEPKTVGQWIRYVVVAAIAIWLVIWMLRLSGINVL |
Ga0209579_106869672 | 3300027869 | Surface Soil | MENRTEPKTVAQWIRYVVVAAIAIWLVIWMLRLSGINIL |
Ga0209169_106748202 | 3300027879 | Soil | MPNRTQPTTVGQWIRYIVVAAVAIWLVIWMLRISGI |
Ga0209168_100133614 | 3300027986 | Surface Soil | VENRTEPKTVGQWIRYVVVAVIALWLVVWMLRISGINIL |
Ga0268299_10377743 | 3300028648 | Activated Sludge | GRRMGRRTEPRTLWEWIRYVVVAMIAIWLILWMLRMSGIHVL |
Ga0265338_102551082 | 3300028800 | Rhizosphere | MENRTEPKTIGQWIRYVVVAVIALWLVIWMLRISGIDIF |
Ga0308309_111136622 | 3300028906 | Soil | MENRTEPKTFGQWIRYLVVAVIALWLVVWMLRISGINIL |
Ga0311361_108914382 | 3300029911 | Bog | MPKRTEPTTVKEWIRYLAVAVIALWLVVCMLRISGIDIL |
Ga0170834_1008818891 | 3300031057 | Forest Soil | VAENRTEPETIGQWIRYLVVAAIALWLVVWMLRISGVNI |
Ga0170834_1069907011 | 3300031057 | Forest Soil | MENRTEPKTAAQWVRYIVVSVIALWLVVWMLRISGINLF |
Ga0302325_115434282 | 3300031234 | Palsa | MANRTEPKTIREWIRYVVVAVIAIWLVVWMLRISGIDIL |
Ga0265316_112538502 | 3300031344 | Rhizosphere | MQTEPKTFAQWVRYLIVAAIAIWLVIWMLRISGINVL |
Ga0265316_113110312 | 3300031344 | Rhizosphere | RTEPKTAREWIRYVVVGAIAVWLVIWMLRISGINLF |
Ga0265313_1000404313 | 3300031595 | Rhizosphere | MENRTEPKTAREWIRYIVVAVIAVWLVIWMLRISGINIL |
Ga0310686_1011521681 | 3300031708 | Soil | MANRTEPKTLREWIRYVVVAVIAIWLVVWMLRISGIDIL |
Ga0310686_1064354042 | 3300031708 | Soil | MGNRTEPKALREWIRYILVAMVALWLVVWMLRISGINIF |
Ga0310686_1078911633 | 3300031708 | Soil | MPNRTQPKTVGQWLRYIVVAMIAIWLVIWMLRISGINIM |
Ga0310686_1174015241 | 3300031708 | Soil | MANRTEPKTVREWIRYLVVAAIAIWLVIWMLRISGID |
Ga0310686_1176182221 | 3300031708 | Soil | MGNRTEPRTFWEWVRYIVVAVIALWLVVWMLRISGIN |
Ga0265314_1000204414 | 3300031711 | Rhizosphere | MENRTEPRTVGQWIRYVVVAVIALWLVVWMLRISGINIF |
Ga0307476_108285672 | 3300031715 | Hardwood Forest Soil | MANRTEPKTVGQWIRYIVVAAIAIWLVIWMLRISGINIL |
Ga0310813_103660023 | 3300031716 | Soil | MANRTEPKTAWQWIRYVVVAAIAIWLVIWMLRISGINIL |
Ga0307479_121807601 | 3300031962 | Hardwood Forest Soil | RSMENRTEPRTIGQWIRYVVVAAIAIWLVIWMLRISGINVL |
Ga0311301_101473403 | 3300032160 | Peatlands Soil | MENRTEPKTVGQWLRYVVVAVIAIWLVIWMLRLSGINLF |
Ga0311301_101478843 | 3300032160 | Peatlands Soil | MGNRTEPRTFREWIRYLAVAVVVLWLVVWMLRISGINIL |
Ga0311301_102783265 | 3300032160 | Peatlands Soil | MENRTEPKTPRQWIRYIVMAVIAIWLVVWMLRISGINIL |
Ga0311301_121497012 | 3300032160 | Peatlands Soil | NRTEPRTFREWTRYIVVAVVALWLVVWMLRISGINFL |
Ga0307472_1017476381 | 3300032205 | Hardwood Forest Soil | KRRMENRTEPRTVGQWIRYIVMAVIAIWLVIWMLRISGINVL |
Ga0335085_102045484 | 3300032770 | Soil | MANRTQPKTVSEWIRYIVIAIIALWLVVWMLRISGIDIV |
Ga0335085_102492172 | 3300032770 | Soil | MANRTEPKTLSEWIRYIVVAVIAIWLVIWMLRTSGINLF |
Ga0335079_100902601 | 3300032783 | Soil | MENRTEPKTLGQWIRYVVVAAIAIWLVIWMLRLSGINVL |
Ga0335079_101224693 | 3300032783 | Soil | MPNRTEPKSLGQWTRYVVVAAIALWLVIWMLRSSGIDIF |
Ga0335078_101621223 | 3300032805 | Soil | MPNRTEPKSLGQWTRYVVVAAIALWLVIGMLRSSGIDIF |
Ga0335080_103309142 | 3300032828 | Soil | MANRTEPKTIGQWIRYVVMAVIALWLVVWMLRISGINIL |
Ga0335069_101285493 | 3300032893 | Soil | MANRTEPKTLREWIRYIIVAAIALWLVIWMLRLSSIDIL |
Ga0335069_108455782 | 3300032893 | Soil | MANRTEPKTLREWIRYIIVAAIALWLVIWMLRLSGIRYSVSR |
Ga0335074_107332642 | 3300032895 | Soil | MANRTEPKSVGQWIRYIAVAGIALWLVLWMLRLSGLSVF |
Ga0335072_117207652 | 3300032898 | Soil | MPNRTDPKTLGQWIRHIIVAMIAIWLVIWMLRISGIDLL |
Ga0310810_109588251 | 3300033412 | Soil | LPVAENRTEPKTIGQWIRYILVAAIALWLVVWMLRISGINIL |
Ga0316628_1020978753 | 3300033513 | Soil | MENRTEPKTAAQWVRYIVVAAIALWLVVWMLRISGINLF |
⦗Top⦘ |