| Basic Information | |
|---|---|
| Family ID | F019545 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 229 |
| Average Sequence Length | 47 residues |
| Representative Sequence | AAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLGA |
| Number of Associated Samples | 185 |
| Number of Associated Scaffolds | 229 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.62 % |
| % of genes near scaffold ends (potentially truncated) | 96.07 % |
| % of genes from short scaffolds (< 2000 bps) | 93.01 % |
| Associated GOLD sequencing projects | 175 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.563 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.354 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.074 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.485 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.30% β-sheet: 0.00% Coil/Unstructured: 52.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 229 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 42.36 |
| PF01648 | ACPS | 2.18 |
| PF02668 | TauD | 1.31 |
| PF04392 | ABC_sub_bind | 0.87 |
| PF01547 | SBP_bac_1 | 0.87 |
| PF05721 | PhyH | 0.87 |
| PF06723 | MreB_Mbl | 0.44 |
| PF13416 | SBP_bac_8 | 0.44 |
| PF13544 | Obsolete Pfam Family | 0.44 |
| PF01609 | DDE_Tnp_1 | 0.44 |
| PF13633 | Obsolete Pfam Family | 0.44 |
| PF07963 | N_methyl | 0.44 |
| PF00155 | Aminotran_1_2 | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 229 Family Scaffolds |
|---|---|---|---|
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.31 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.87 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.87 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.44 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.44 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.44 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.44 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.44 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.44 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.56 % |
| Unclassified | root | N/A | 0.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig18932 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300000890|JGI11643J12802_10136578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1348 | Open in IMG/M |
| 3300000890|JGI11643J12802_11392664 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300000890|JGI11643J12802_12103102 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300000953|JGI11615J12901_10117167 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300000955|JGI1027J12803_102387193 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 762 | Open in IMG/M |
| 3300002916|JGI25389J43894_1030955 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300004114|Ga0062593_101392407 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300004157|Ga0062590_100076420 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
| 3300004480|Ga0062592_102366522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 532 | Open in IMG/M |
| 3300004643|Ga0062591_100444511 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300005171|Ga0066677_10696104 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005175|Ga0066673_10073763 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300005180|Ga0066685_10457019 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300005294|Ga0065705_10155273 | All Organisms → cellular organisms → Bacteria | 1878 | Open in IMG/M |
| 3300005295|Ga0065707_10014656 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300005295|Ga0065707_10865961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 570 | Open in IMG/M |
| 3300005331|Ga0070670_100594275 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300005332|Ga0066388_101166356 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300005332|Ga0066388_102099871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1016 | Open in IMG/M |
| 3300005332|Ga0066388_102373044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 961 | Open in IMG/M |
| 3300005332|Ga0066388_102529555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 934 | Open in IMG/M |
| 3300005332|Ga0066388_107392602 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005341|Ga0070691_11004253 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005343|Ga0070687_101020039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 601 | Open in IMG/M |
| 3300005353|Ga0070669_100595799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 925 | Open in IMG/M |
| 3300005353|Ga0070669_101733457 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005353|Ga0070669_101759493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 540 | Open in IMG/M |
| 3300005444|Ga0070694_101595846 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005446|Ga0066686_10178317 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300005446|Ga0066686_10492834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 835 | Open in IMG/M |
| 3300005458|Ga0070681_10212843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1849 | Open in IMG/M |
| 3300005467|Ga0070706_101304751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 666 | Open in IMG/M |
| 3300005467|Ga0070706_101766834 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005468|Ga0070707_100343749 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300005471|Ga0070698_102041565 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005471|Ga0070698_102147720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 512 | Open in IMG/M |
| 3300005535|Ga0070684_100095338 | All Organisms → cellular organisms → Bacteria | 2651 | Open in IMG/M |
| 3300005536|Ga0070697_101175277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 683 | Open in IMG/M |
| 3300005536|Ga0070697_101949871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 526 | Open in IMG/M |
| 3300005539|Ga0068853_102417838 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005540|Ga0066697_10122434 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300005547|Ga0070693_101176121 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005553|Ga0066695_10830705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 531 | Open in IMG/M |
| 3300005556|Ga0066707_10032157 | All Organisms → cellular organisms → Bacteria | 2915 | Open in IMG/M |
| 3300005556|Ga0066707_10860554 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005563|Ga0068855_101504009 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005566|Ga0066693_10037734 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300005569|Ga0066705_10479570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 780 | Open in IMG/M |
| 3300005576|Ga0066708_10125120 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300005578|Ga0068854_102285442 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005586|Ga0066691_10515630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 714 | Open in IMG/M |
| 3300005615|Ga0070702_101595458 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005713|Ga0066905_102301659 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005718|Ga0068866_11148312 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005719|Ga0068861_100407960 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300006031|Ga0066651_10747349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 528 | Open in IMG/M |
| 3300006032|Ga0066696_10217761 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300006172|Ga0075018_10061099 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300006755|Ga0079222_10871443 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300006796|Ga0066665_11651541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 506 | Open in IMG/M |
| 3300006806|Ga0079220_11248180 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006844|Ga0075428_101407526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 732 | Open in IMG/M |
| 3300006844|Ga0075428_102446594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 535 | Open in IMG/M |
| 3300006845|Ga0075421_102542196 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006846|Ga0075430_101733234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 512 | Open in IMG/M |
| 3300006847|Ga0075431_101222457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 714 | Open in IMG/M |
| 3300006852|Ga0075433_10432401 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300006852|Ga0075433_11571790 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300006854|Ga0075425_100386320 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300006881|Ga0068865_101720735 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006903|Ga0075426_10021789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4580 | Open in IMG/M |
| 3300006918|Ga0079216_11615142 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300007004|Ga0079218_12716634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 591 | Open in IMG/M |
| 3300009012|Ga0066710_100278157 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300009012|Ga0066710_102156047 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300009012|Ga0066710_103108781 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300009053|Ga0105095_10654204 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300009100|Ga0075418_10031246 | All Organisms → cellular organisms → Bacteria | 5791 | Open in IMG/M |
| 3300009100|Ga0075418_11338408 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300009137|Ga0066709_102860880 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300009146|Ga0105091_10069967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1579 | Open in IMG/M |
| 3300009147|Ga0114129_10668627 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1338 | Open in IMG/M |
| 3300009147|Ga0114129_12605991 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009156|Ga0111538_13682793 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009162|Ga0075423_10407733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae | 1427 | Open in IMG/M |
| 3300009162|Ga0075423_12291203 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009167|Ga0113563_13473543 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300009174|Ga0105241_10361273 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300009176|Ga0105242_10745166 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300009176|Ga0105242_11435742 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300009678|Ga0105252_10121940 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300009811|Ga0105084_1039685 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300010047|Ga0126382_10783041 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300010047|Ga0126382_11041542 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300010047|Ga0126382_12402742 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 512 | Open in IMG/M |
| 3300010304|Ga0134088_10084567 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300010358|Ga0126370_11481881 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010358|Ga0126370_12435421 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010359|Ga0126376_12362170 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300010360|Ga0126372_10145283 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
| 3300010360|Ga0126372_11083650 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300010360|Ga0126372_13262691 | Not Available | 504 | Open in IMG/M |
| 3300010397|Ga0134124_11868958 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300010399|Ga0134127_10286206 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300010399|Ga0134127_10661519 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300010399|Ga0134127_11319119 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300010400|Ga0134122_10746238 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300010401|Ga0134121_11676123 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300010403|Ga0134123_10386658 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300011119|Ga0105246_10875621 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012199|Ga0137383_10707992 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012201|Ga0137365_10715023 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300012203|Ga0137399_10256086 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300012208|Ga0137376_11570235 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012350|Ga0137372_10915369 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012353|Ga0137367_10423813 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300012353|Ga0137367_10880530 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012355|Ga0137369_10206106 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300012360|Ga0137375_10006211 | All Organisms → cellular organisms → Bacteria | 14189 | Open in IMG/M |
| 3300012362|Ga0137361_10147754 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
| 3300012390|Ga0134054_1077209 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 623 | Open in IMG/M |
| 3300012495|Ga0157323_1037103 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012903|Ga0157289_10413855 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012922|Ga0137394_10110634 | All Organisms → cellular organisms → Bacteria | 2319 | Open in IMG/M |
| 3300012929|Ga0137404_10356737 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300012930|Ga0137407_10979518 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300012944|Ga0137410_11804367 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012987|Ga0164307_10136033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1598 | Open in IMG/M |
| 3300013306|Ga0163162_12825320 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300013500|Ga0120195_1001535 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300014157|Ga0134078_10031508 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300014166|Ga0134079_10042531 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300014308|Ga0075354_1011920 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300014326|Ga0157380_11115079 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300015053|Ga0137405_1343946 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
| 3300015241|Ga0137418_10230153 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300015241|Ga0137418_10346324 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300015359|Ga0134085_10373886 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300015371|Ga0132258_11394817 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300015371|Ga0132258_12244497 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300015372|Ga0132256_100272954 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300015372|Ga0132256_103567100 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300015373|Ga0132257_100306543 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300015373|Ga0132257_104451002 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300017659|Ga0134083_10201909 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 821 | Open in IMG/M |
| 3300018000|Ga0184604_10177444 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300018056|Ga0184623_10433322 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300018064|Ga0187773_10407815 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300018084|Ga0184629_10534823 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300018089|Ga0187774_10117839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1340 | Open in IMG/M |
| 3300018422|Ga0190265_11697054 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300018433|Ga0066667_12147452 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300018482|Ga0066669_10785827 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300019377|Ga0190264_10652608 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300020021|Ga0193726_1245300 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300021051|Ga0206224_1009064 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300025165|Ga0209108_10424915 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300025173|Ga0209824_10305773 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300025289|Ga0209002_10461805 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300025327|Ga0209751_10303831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1344 | Open in IMG/M |
| 3300025899|Ga0207642_11042139 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300025900|Ga0207710_10101561 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300025922|Ga0207646_11574763 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300025930|Ga0207701_10726337 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300025934|Ga0207686_10754584 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300025960|Ga0207651_11040392 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300026000|Ga0208143_104620 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300026035|Ga0207703_12217410 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300026277|Ga0209350_1129767 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300026295|Ga0209234_1033008 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
| 3300026297|Ga0209237_1042790 | All Organisms → cellular organisms → Bacteria | 2353 | Open in IMG/M |
| 3300026298|Ga0209236_1161543 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300026316|Ga0209155_1127593 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300026326|Ga0209801_1346360 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300026335|Ga0209804_1049725 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300026371|Ga0257179_1000903 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300026371|Ga0257179_1036531 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300026523|Ga0209808_1231129 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300026529|Ga0209806_1028030 | All Organisms → cellular organisms → Bacteria | 2820 | Open in IMG/M |
| 3300026538|Ga0209056_10669261 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300026540|Ga0209376_1266087 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300026542|Ga0209805_1277492 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300027383|Ga0209213_1057054 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300027384|Ga0209854_1037995 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300027490|Ga0209899_1077177 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300027617|Ga0210002_1002280 | All Organisms → cellular organisms → Bacteria | 2772 | Open in IMG/M |
| 3300027655|Ga0209388_1074321 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300027717|Ga0209998_10068790 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300027787|Ga0209074_10018809 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300027873|Ga0209814_10167954 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300027882|Ga0209590_10797966 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300027907|Ga0207428_10914444 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300027909|Ga0209382_11065627 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300027909|Ga0209382_11080563 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300027909|Ga0209382_11973974 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027909|Ga0209382_12343979 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027952|Ga0209889_1113426 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300028380|Ga0268265_12130494 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300028380|Ga0268265_12666401 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300028381|Ga0268264_11741367 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300028592|Ga0247822_11719211 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300028792|Ga0307504_10107410 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300028812|Ga0247825_11194612 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300028814|Ga0307302_10134938 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300031184|Ga0307499_10160401 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300031720|Ga0307469_10502263 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300031820|Ga0307473_10196649 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300031820|Ga0307473_10352533 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300031834|Ga0315290_10507302 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300031854|Ga0310904_10979739 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031854|Ga0310904_11306898 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031892|Ga0310893_10170211 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300032017|Ga0310899_10234006 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300032075|Ga0310890_10035046 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
| 3300032075|Ga0310890_10508304 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300032122|Ga0310895_10722421 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300032164|Ga0315283_10431913 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300032180|Ga0307471_100868100 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300032180|Ga0307471_102547731 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300032180|Ga0307471_103523950 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300032205|Ga0307472_101027514 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300032342|Ga0315286_10247074 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300032770|Ga0335085_10068037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4724 | Open in IMG/M |
| 3300033004|Ga0335084_10289574 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300033480|Ga0316620_11358661 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300033482|Ga0316627_101433231 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300034661|Ga0314782_008318 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300034817|Ga0373948_0022981 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.35% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.49% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.06% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.75% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.31% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.31% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.44% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.44% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.44% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.44% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.44% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.44% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.44% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.44% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013500 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026000 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0932.00001540 | 2166559005 | Simulated | VQASNVLTDTPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG |
| JGI11643J12802_101365783 | 3300000890 | Soil | LTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLKG* |
| JGI11643J12802_113926643 | 3300000890 | Soil | SAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLKG* |
| JGI11643J12802_121031022 | 3300000890 | Soil | AAEVQASNVLTDAPAKVIVDKWSIDQAIDWEDKKIKEIYDTLGA* |
| JGI11615J12901_101171673 | 3300000953 | Soil | APTGWPGPTTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLKG* |
| JGI1027J12803_1023871932 | 3300000955 | Soil | AAAEVQASNVLTDAPAKVIVDKWSVDHALEWEDKKIKEIYGTLGG* |
| JGI25389J43894_10309551 | 3300002916 | Grasslands Soil | VQASNVLTDAPAKVIIDKWSVDQAIDWADKKIKEIYATLG* |
| Ga0062593_1013924072 | 3300004114 | Soil | AVEWFSPTGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLKG* |
| Ga0062590_1000764201 | 3300004157 | Soil | VQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLKG* |
| Ga0062592_1023665222 | 3300004480 | Soil | PGPQTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYATLGA* |
| Ga0062591_1004445112 | 3300004643 | Soil | GWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVEQAIEWEDKKIKEIYDTLGA* |
| Ga0066677_106961041 | 3300005171 | Soil | ITAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYSTLGA* |
| Ga0066673_100737633 | 3300005175 | Soil | GPVTAAAAEVQASNVLTDAPAKVIIDKWSVDQAIDWADKKIKEIYATLG* |
| Ga0066685_104570191 | 3300005180 | Soil | EWFVPTGWPGPITAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYATL* |
| Ga0065705_101552733 | 3300005294 | Switchgrass Rhizosphere | TGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKETYDTLGT* |
| Ga0065707_100146563 | 3300005295 | Switchgrass Rhizosphere | GPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKETYDTLGT* |
| Ga0065707_108659611 | 3300005295 | Switchgrass Rhizosphere | QASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRA* |
| Ga0070670_1005942752 | 3300005331 | Switchgrass Rhizosphere | AAEWFSATGWPGPVTAAAAEVQASNVLTDMPAKVIVDKWSVDQAIDWADKKIKEIYDTIG |
| Ga0066388_1011663561 | 3300005332 | Tropical Forest Soil | AAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIGA* |
| Ga0066388_1020998712 | 3300005332 | Tropical Forest Soil | TPAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLGAG* |
| Ga0066388_1023730442 | 3300005332 | Tropical Forest Soil | AAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKETYDTLGT* |
| Ga0066388_1025295551 | 3300005332 | Tropical Forest Soil | PITAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIQG* |
| Ga0066388_1073926021 | 3300005332 | Tropical Forest Soil | EVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTIG* |
| Ga0070691_110042531 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | EWFVGTGYPGPVTAAAAEVQATNVLTDAPAKVIVDKWSVDQAIEWEDKKIKDVYDTLRG* |
| Ga0070687_1010200392 | 3300005343 | Switchgrass Rhizosphere | TAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLKG* |
| Ga0070669_1005957991 | 3300005353 | Switchgrass Rhizosphere | TAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTIG* |
| Ga0070669_1017334572 | 3300005353 | Switchgrass Rhizosphere | EVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRG* |
| Ga0070669_1017594931 | 3300005353 | Switchgrass Rhizosphere | GPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTIG* |
| Ga0070694_1015958461 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIQG* |
| Ga0066686_101783173 | 3300005446 | Soil | EVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYSTLGA* |
| Ga0066686_104928341 | 3300005446 | Soil | AAEVQASNVLTDAPAKVIVDKWSVDQAIDWEEKKIKEIYDTLRAG* |
| Ga0070681_102128434 | 3300005458 | Corn Rhizosphere | TAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG* |
| Ga0070706_1013047511 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | EVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKVKEIYDTLRG* |
| Ga0070706_1017668342 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYGTLG* |
| Ga0070707_1003437494 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYGTL* |
| Ga0070698_1020415651 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GTGYPGPVTAAAAEVQATNVLTDAPAKVIVDKWSADQAIDWEDKKIKDVYDTLRG* |
| Ga0070698_1021477202 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TAAAAEVQASNVLTDAPAKVIVDKWSVDQAVEWEDKKIKEIYDTLRAS* |
| Ga0070684_1000953381 | 3300005535 | Corn Rhizosphere | AAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLKG* |
| Ga0070697_1011752772 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKVKEIYDTLRG* |
| Ga0070697_1019498711 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYSTLGT* |
| Ga0068853_1024178381 | 3300005539 | Corn Rhizosphere | AAAEVQATNVLTDAPAKVIVDKWSVDQAIEWEDKKIKDVYDTLRG* |
| Ga0066697_101224341 | 3300005540 | Soil | AAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKDIYDTLRG* |
| Ga0070693_1011761212 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | AEWFAPTGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRA |
| Ga0066695_108307051 | 3300005553 | Soil | AAAAEVQASNVLTDAPAKVIIDKWSIDQAIDWADKKIKEIYDTLGR* |
| Ga0066707_100321571 | 3300005556 | Soil | AAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYSTLGA* |
| Ga0066707_108605541 | 3300005556 | Soil | AAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYATL* |
| Ga0068855_1015040091 | 3300005563 | Corn Rhizosphere | NVLTDAPAKVIVDKWGLDQAIDWEDKKIKDVYDTLRG* |
| Ga0066693_100377341 | 3300005566 | Soil | AAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYGTLGA* |
| Ga0066705_104795702 | 3300005569 | Soil | EWFVATGWPGPVTAAAAEVQASNILTDAPAKVIVDKWSVDQAVDWADKKIKEVYDTLGG* |
| Ga0066708_101251201 | 3300005576 | Soil | AEVQASNVLTDAPAKVIIDKWSVDQAIDWADKKIKEIYATLG* |
| Ga0068854_1022854422 | 3300005578 | Corn Rhizosphere | AAEWFSPTGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTIG |
| Ga0066691_105156302 | 3300005586 | Soil | AEVQASNVLTDAPAKVIIDKWSIDQAIDWADKKIKEIYDTLGR* |
| Ga0070702_1015954582 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | AAAEVQASNVLTDTPAKVIVDKWSVDQAIEWEDKKIKEIYDTLGA* |
| Ga0066905_1023016592 | 3300005713 | Tropical Forest Soil | WPGPVTAAAAEVQASNVLTDAPAKVIVDKWSNEQAVDWADKKIKEIYDTIGR* |
| Ga0068866_111483122 | 3300005718 | Miscanthus Rhizosphere | TDMPAKVIVDKWSIDQAIDWADKKIKEIYDTLGA* |
| Ga0068861_1004079603 | 3300005719 | Switchgrass Rhizosphere | AEVQATNVLTDAPAKVIVDKWPVEQAIDWEDKKIKDVYDTLRG* |
| Ga0066651_107473491 | 3300006031 | Soil | TAAAAEVQASNVLTDAPAKVIVDKWSNEQAVDWADKKIKEIYDTIGR* |
| Ga0066696_102177613 | 3300006032 | Soil | TAAAAEVQASNVLTDAPAKVIIDKWSVDQAIDWADKKIKEIYATLG* |
| Ga0075018_100610993 | 3300006172 | Watersheds | TDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRG* |
| Ga0079222_108714431 | 3300006755 | Agricultural Soil | SNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLGA* |
| Ga0066665_116515412 | 3300006796 | Soil | APTGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG* |
| Ga0079220_112481801 | 3300006806 | Agricultural Soil | ASNVLTDAPAKVIVDKWSVEQAIDWEDKKIKEIYDTMR* |
| Ga0075428_1014075261 | 3300006844 | Populus Rhizosphere | PVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIG* |
| Ga0075428_1024465942 | 3300006844 | Populus Rhizosphere | EVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLGA* |
| Ga0075421_1025421961 | 3300006845 | Populus Rhizosphere | LTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTIG* |
| Ga0075430_1017332341 | 3300006846 | Populus Rhizosphere | AAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYATLGA* |
| Ga0075431_1012224572 | 3300006847 | Populus Rhizosphere | AAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRAS* |
| Ga0075433_104324013 | 3300006852 | Populus Rhizosphere | NVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLKG* |
| Ga0075433_115717901 | 3300006852 | Populus Rhizosphere | AAAAEVQASNVLTDAPAKVIIDKWSIDQAIDWADKKIKEIYDTLGA* |
| Ga0075425_1003863203 | 3300006854 | Populus Rhizosphere | AEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIQG* |
| Ga0068865_1017207352 | 3300006881 | Miscanthus Rhizosphere | FSPTGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTIG* |
| Ga0075426_100217896 | 3300006903 | Populus Rhizosphere | SNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIRA* |
| Ga0079216_116151421 | 3300006918 | Agricultural Soil | AAEVQASNVLTDMPAKVIVDKMSVDQAIEFGDKKIKEIYDSLGG* |
| Ga0079218_127166342 | 3300007004 | Agricultural Soil | EWFSATGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWPVDQAIDWADKKIKEIYDTIG* |
| Ga0066710_1002781574 | 3300009012 | Grasslands Soil | GWTGPVTTAALQVQACNFLSDAPDKGIVDTWTVDQAVDWADKRIKEVYDTLGG |
| Ga0066710_1021560472 | 3300009012 | Grasslands Soil | EVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKDIYDTLRG |
| Ga0066710_1031087811 | 3300009012 | Grasslands Soil | VLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIG |
| Ga0105095_106542042 | 3300009053 | Freshwater Sediment | WPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKDVYDTLRG* |
| Ga0075418_100312467 | 3300009100 | Populus Rhizosphere | ASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYGTLGA* |
| Ga0075418_113384082 | 3300009100 | Populus Rhizosphere | AEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYSTLGA* |
| Ga0066709_1028608801 | 3300009137 | Grasslands Soil | VTAAAAEVQASNVLTDMPAKVIVDKWSVDQAIEWADKKIKEIYSTLGA* |
| Ga0105091_100699673 | 3300009146 | Freshwater Sediment | VQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKDIYDTLAR* |
| Ga0114129_106686271 | 3300009147 | Populus Rhizosphere | AAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLGA* |
| Ga0114129_126059912 | 3300009147 | Populus Rhizosphere | SNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYSTLGA* |
| Ga0111538_136827932 | 3300009156 | Populus Rhizosphere | LTDAPAKVIVDKWSVDQAIDWEDKKIKEVYSTLGA* |
| Ga0075423_104077333 | 3300009162 | Populus Rhizosphere | QASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIQG* |
| Ga0075423_122912032 | 3300009162 | Populus Rhizosphere | VQASNVLTDPPAKVIADKWSVDQAIDWEDKKIKKIYDTL |
| Ga0113563_134735432 | 3300009167 | Freshwater Wetlands | PVTPAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWKDKKIKDIYDTLGVR* |
| Ga0105241_103612731 | 3300009174 | Corn Rhizosphere | TDAPAKVIVDKWTVDQAIDWEDKKIKDVYDTLRG* |
| Ga0105242_107451661 | 3300009176 | Miscanthus Rhizosphere | EVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG* |
| Ga0105242_114357421 | 3300009176 | Miscanthus Rhizosphere | AEWFAPTGWPGPVTAAAAEVQASNVLTDMPAKVIVDKMSVDQAIDWADKKIKEIYGSLGA |
| Ga0105252_101219402 | 3300009678 | Soil | TPAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLGAG* |
| Ga0105084_10396852 | 3300009811 | Groundwater Sand | AAAAEVQASNVLTDAPAKVIVDKTSVDAAIEWEDKKIKEIYDTLGVG* |
| Ga0126382_107830412 | 3300010047 | Tropical Forest Soil | APTGWPGPTTASAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKTKEIYDTLKG* |
| Ga0126382_110415422 | 3300010047 | Tropical Forest Soil | WFSPTGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTIG* |
| Ga0126382_124027422 | 3300010047 | Tropical Forest Soil | AEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYGTLGA* |
| Ga0134088_100845671 | 3300010304 | Grasslands Soil | TDAPAKVIVDKWSNEQAVDWADKKIKEIYDTIGR* |
| Ga0126370_114818811 | 3300010358 | Tropical Forest Soil | PAAAEVQASNVLTDTPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG* |
| Ga0126370_124354211 | 3300010358 | Tropical Forest Soil | AAAEVQASNVLTDAPAKVIVDKWSNEQAVDWADKKIKEIYDTIGR* |
| Ga0126376_123621701 | 3300010359 | Tropical Forest Soil | WPGPVTAAAEVQASSVLTAAPAKVIVDKWSNEQAVDWADKKIKEIYDTIGR* |
| Ga0126372_101452831 | 3300010360 | Tropical Forest Soil | AEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYAQFV* |
| Ga0126372_110836501 | 3300010360 | Tropical Forest Soil | AAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTIQG* |
| Ga0126372_132626912 | 3300010360 | Tropical Forest Soil | AEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIGA* |
| Ga0134124_118689582 | 3300010397 | Terrestrial Soil | PGPTTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG* |
| Ga0134127_102862063 | 3300010399 | Terrestrial Soil | GFPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG* |
| Ga0134127_106615192 | 3300010399 | Terrestrial Soil | ATGWPGPVTAAAAEVQASNVLTDMPAKVIVDKWSIDQAIDWADKKIKEIYSTLGA* |
| Ga0134127_113191191 | 3300010399 | Terrestrial Soil | WFVGTGYPGPVTAAAAEVQATNVLTDAPAKVIVDKWSVDQAIDWEDKKIKDVYDTLRG* |
| Ga0134122_107462382 | 3300010400 | Terrestrial Soil | VLTDAPAKVIVDKWSVDQAIDWADKKIKETYDTLGT* |
| Ga0134121_116761232 | 3300010401 | Terrestrial Soil | VGTGYPGPVTAAAAEVQATNVLTDAPAKVIVDKWSVDQAIEWEDKKIKDVYDTLRG* |
| Ga0134123_103866582 | 3300010403 | Terrestrial Soil | VQATNVLTDMPAKVIVDKWSVDQAIDWADKKIKEVYSTLGA* |
| Ga0105246_108756211 | 3300011119 | Miscanthus Rhizosphere | APTGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRA* |
| Ga0137383_107079921 | 3300012199 | Vadose Zone Soil | AAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLGA* |
| Ga0137365_107150231 | 3300012201 | Vadose Zone Soil | LTDAPAKVIVDKWSIDQAIDWADKKIKEIYDTLGA* |
| Ga0137399_102560861 | 3300012203 | Vadose Zone Soil | TDAPAKVIVDKWSVDQAIEWEDKKIKEIYSTLGA* |
| Ga0137376_115702352 | 3300012208 | Vadose Zone Soil | TGWPGPITAAAAEVQASNVLTDAPAKVIIDKWSVDQAIEWEDKKIKEIYSTLGA* |
| Ga0137372_109153691 | 3300012350 | Vadose Zone Soil | AAEVQASNVLTDAPAKVIVDKWGVDQAIDWEDKKVKEIYDTLGG* |
| Ga0137367_104238132 | 3300012353 | Vadose Zone Soil | VLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIG* |
| Ga0137367_108805301 | 3300012353 | Vadose Zone Soil | QATNVLTDAPAKVIVDKWPLDQAIDWEDKKIKDVYDTLRG* |
| Ga0137369_102061063 | 3300012355 | Vadose Zone Soil | ASNVLTDATAKGIIDKSSVNQAIDWADKKIKEIYDTIG* |
| Ga0137375_1000621118 | 3300012360 | Vadose Zone Soil | TDAPAKVIVDKWSVDQTIDWEDKKVKEIYDTIGG* |
| Ga0137361_101477544 | 3300012362 | Vadose Zone Soil | VEWFVPTGWPGPITAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYSTLGA |
| Ga0134054_10772091 | 3300012390 | Grasslands Soil | EVQASNVLTDAPAKVIVDKWPVDQAIEWEDKKIKEIYATL* |
| Ga0157323_10371031 | 3300012495 | Arabidopsis Rhizosphere | TAAAAEVQASNVLTDTPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG* |
| Ga0157289_104138551 | 3300012903 | Soil | AAEWFVATGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLGA* |
| Ga0137394_101106341 | 3300012922 | Vadose Zone Soil | TGFPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVEQAIDWEDKKIKEIYDTLRG* |
| Ga0137404_103567371 | 3300012929 | Vadose Zone Soil | PITAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYATL* |
| Ga0137407_109795182 | 3300012930 | Vadose Zone Soil | GFPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVEQAIDWEDKKIKEIYDTLRG* |
| Ga0137410_118043671 | 3300012944 | Vadose Zone Soil | ITAAAAEVQASNVLTDAPAKVIVDKWSNEQAVDWADKKIKEIYDTIGR* |
| Ga0164307_101360331 | 3300012987 | Soil | QASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRG* |
| Ga0163162_128253201 | 3300013306 | Switchgrass Rhizosphere | GPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRA* |
| Ga0120195_10015352 | 3300013500 | Terrestrial | VTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRA* |
| Ga0134078_100315083 | 3300014157 | Grasslands Soil | TGWPGPITAAAAEVQSSNVLTDAPAKVIIDKWSVDQAIEWEDKKIKEIYSTLGA* |
| Ga0134079_100425313 | 3300014166 | Grasslands Soil | PITAAAAEVQASNVLTDAPAKVIIDKWSVDQAIEWEDKKIKEIYSTLGA* |
| Ga0075354_10119202 | 3300014308 | Natural And Restored Wetlands | PTGFPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG* |
| Ga0157380_111150791 | 3300014326 | Switchgrass Rhizosphere | PVTPAAAEVQATNVLTDAPAKVIVDKWGVDQAIDWEDKKIKDVYDTLRG* |
| Ga0137405_13439462 | 3300015053 | Vadose Zone Soil | VAGPVTAAAAEVQASNVLTDTPAKVIVDKWSVDQAIDWADKKIKEIYDTIRA* |
| Ga0137418_102301533 | 3300015241 | Vadose Zone Soil | GWPGPITAAAAEVQASNVLTDAPAKVIVDKWSNEQAVDWADKKIKEIYDTIGR* |
| Ga0137418_103463241 | 3300015241 | Vadose Zone Soil | PTGVPGPITAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG* |
| Ga0134085_103738861 | 3300015359 | Grasslands Soil | VTAAAAEVQASNVLTDMPAKVIVDKWSVDQAIDWADKKIKEVYSTLGA* |
| Ga0132258_113948171 | 3300015371 | Arabidopsis Rhizosphere | TDAPAKVIVDKWSVDQAIEWEDKKIKEIYGTLGG* |
| Ga0132258_122444972 | 3300015371 | Arabidopsis Rhizosphere | AEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTIG* |
| Ga0132256_1002729544 | 3300015372 | Arabidopsis Rhizosphere | GWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSNDQAIEWADKKIKEIYDTLGA* |
| Ga0132256_1035671001 | 3300015372 | Arabidopsis Rhizosphere | TPAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLGA* |
| Ga0132257_1003065433 | 3300015373 | Arabidopsis Rhizosphere | AAAEVQATNVLTDAPAKVIVDKWGVDQAIDWEDKKIKEIYDTLKG* |
| Ga0132257_1044510022 | 3300015373 | Arabidopsis Rhizosphere | VLTDAAAKVIVDKWSVDQAIEWEDKKIKEIYDTLRG* |
| Ga0134083_102019091 | 3300017659 | Grasslands Soil | VPTGWPGPITAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYATL |
| Ga0184604_101774442 | 3300018000 | Groundwater Sediment | LTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRA |
| Ga0184623_104333221 | 3300018056 | Groundwater Sediment | AEWFTATGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEVYDTLGS |
| Ga0187773_104078151 | 3300018064 | Tropical Peatland | AAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKDIYETLPR |
| Ga0184629_105348231 | 3300018084 | Groundwater Sediment | ATNVLTDAPAKVIVDKWSVDQAIDWEDKKIKDVYDTLRG |
| Ga0187774_101178393 | 3300018089 | Tropical Peatland | GWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG |
| Ga0190265_116970542 | 3300018422 | Soil | WPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRA |
| Ga0066667_121474522 | 3300018433 | Grasslands Soil | ATGWPGPVTAAAAEVQASNVLTDAPAKVIIDKWSVDQAIDWADKKIKEIYDTIQG |
| Ga0066669_107858272 | 3300018482 | Grasslands Soil | QASNVLTDAPAKVIIDKWSVDQAIDWADKKIKEIYATLG |
| Ga0190264_106526081 | 3300019377 | Soil | GPVTAAAAEVQASNVLTDMAAKVIVDKMSVDQAIEFGDKKIKEIYDSLGG |
| Ga0193726_12453001 | 3300020021 | Soil | WFAPTGWPGPTTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLKG |
| Ga0206224_10090642 | 3300021051 | Deep Subsurface Sediment | WFVPTGFPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG |
| Ga0209108_104249151 | 3300025165 | Soil | AAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEVYDTLRA |
| Ga0209824_103057732 | 3300025173 | Wastewater | PGPVTAAAAEVQATNVLTDMPAKVIVDKWSVDQAIDWADKKIKEVYGSLGA |
| Ga0209002_104618051 | 3300025289 | Soil | TAAAAEVQASNVLTDAPAKVIIDKWPIDRAIDFADKKIKEIYDTIGG |
| Ga0209751_103038313 | 3300025327 | Soil | AEWFVATGWPGPVTAAAAEVQATNVLTDAPAKVIIDKWSVDQAIDWADKKIKEVYDTLRA |
| Ga0207642_110421391 | 3300025899 | Miscanthus Rhizosphere | VLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLGA |
| Ga0207710_101015611 | 3300025900 | Switchgrass Rhizosphere | NVLTDAPAKVIVDKWSLDQAIDWEDKKIKDVYDTLRG |
| Ga0207646_115747631 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LTDAPAKVIVDKWSVDQAIDWEDKKIKEIYGSLGA |
| Ga0207701_107263371 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIG |
| Ga0207686_107545841 | 3300025934 | Miscanthus Rhizosphere | APTGWPGPVTAAAAEVQASNVLTDMPAKVIVDKMSVDQAIDWADKKIKEIYGSLGA |
| Ga0207651_110403921 | 3300025960 | Switchgrass Rhizosphere | NVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIQG |
| Ga0208143_1046201 | 3300026000 | Rice Paddy Soil | AAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG |
| Ga0207703_122174101 | 3300026035 | Switchgrass Rhizosphere | AAEWFVGTGYPGPVTAAAAEVQATNVLTDAPAKVIVDKWSVDQAIDWEDKKIKDVYDTLR |
| Ga0209350_11297671 | 3300026277 | Grasslands Soil | NVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYSTLGA |
| Ga0209234_10330081 | 3300026295 | Grasslands Soil | SNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYSTLGA |
| Ga0209237_10427901 | 3300026297 | Grasslands Soil | QASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYSTLGA |
| Ga0209236_11615432 | 3300026298 | Grasslands Soil | ASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYSTLGA |
| Ga0209155_11275931 | 3300026316 | Soil | TAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEVYGTLGA |
| Ga0209801_13463602 | 3300026326 | Soil | AAEVQASNVLTDAPAKVIIDRWSVDQAIDWADKKIKEIYDTIQG |
| Ga0209804_10497253 | 3300026335 | Soil | ATGWPGPVTAAAAEVQASNVLTDAPAKVIIDRWSVDQAIDWADKKIKEIYDTIQG |
| Ga0257179_10009033 | 3300026371 | Soil | TGFPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG |
| Ga0257179_10365312 | 3300026371 | Soil | SNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRG |
| Ga0209808_12311292 | 3300026523 | Soil | PTGWPGPITAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYGTLGA |
| Ga0209806_10280304 | 3300026529 | Soil | EWFSATGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSNEQAVDWADKKIKEIYDTIGR |
| Ga0209056_106692611 | 3300026538 | Soil | APTGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG |
| Ga0209376_12660872 | 3300026540 | Soil | EVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYATL |
| Ga0209805_12774922 | 3300026542 | Soil | VLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYSTLGA |
| Ga0209213_10570542 | 3300027383 | Forest Soil | MKTAQSTAAAEVQASNVLTDAPAKVIVDKWSVEQAIDWEDKKIKEIYDTLRG |
| Ga0209854_10379952 | 3300027384 | Groundwater Sand | AEVQASNVLTDAPAKVIIDKWSNDQAIDWADKKIKEIYDTLGA |
| Ga0209899_10771772 | 3300027490 | Groundwater Sand | AAEWFVATGWPGPVTAAAAEVQASNVLTDAPAKVIIDKWSVDQAIDWADKKIKEIYGTLG |
| Ga0210002_10022801 | 3300027617 | Arabidopsis Thaliana Rhizosphere | PAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLKG |
| Ga0209388_10743211 | 3300027655 | Vadose Zone Soil | TGWPGPITAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYSTLGA |
| Ga0209998_100687901 | 3300027717 | Arabidopsis Thaliana Rhizosphere | NVLTDAPAKVIVDKWSVDQAIDWEDKKIKDVYDTLRG |
| Ga0209074_100188093 | 3300027787 | Agricultural Soil | AAAAEVQASNVLTDAPAKVIVDKWLVDQAIDWEDKKIKEIYDTLKG |
| Ga0209814_101679542 | 3300027873 | Populus Rhizosphere | SATGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWPVDQAIDWADKKIKEIYDTIRA |
| Ga0209590_107979661 | 3300027882 | Vadose Zone Soil | EWFVGTGWPGPVTAPAAEVQASNVLTDAPAKVIIDKWSVDQAIDWADKKIKEIYATLG |
| Ga0207428_109144441 | 3300027907 | Populus Rhizosphere | PTTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLKG |
| Ga0209382_110656271 | 3300027909 | Populus Rhizosphere | GPVTAAAAEVQASNVLTDAPAKVIVDKWAVDQAIEWEDKKIKEIYETLS |
| Ga0209382_110805632 | 3300027909 | Populus Rhizosphere | SNVLTDAPAKVIVDKWSTDQAIEWEDKKIKEIYDTLGG |
| Ga0209382_119739742 | 3300027909 | Populus Rhizosphere | EVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTIG |
| Ga0209382_123439791 | 3300027909 | Populus Rhizosphere | VTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIG |
| Ga0209889_11134262 | 3300027952 | Groundwater Sand | NVLTDAPAKVIIDKWSNDQAIDWADKKIKEIYDTLGA |
| Ga0268265_121304942 | 3300028380 | Switchgrass Rhizosphere | QASNVLTDAPAKVIVDKWSIDQAIEWEDKKIKEIYSSLGA |
| Ga0268265_126664011 | 3300028380 | Switchgrass Rhizosphere | SNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTLRA |
| Ga0268264_117413672 | 3300028381 | Switchgrass Rhizosphere | ASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTIG |
| Ga0247822_117192111 | 3300028592 | Soil | ASNVLTDAPAKVIVDKWSIDQALEWEDKKIKEIYDTLGA |
| Ga0307504_101074102 | 3300028792 | Soil | VTPAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG |
| Ga0247825_111946121 | 3300028812 | Soil | EWFVPTGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSIDQAIDWEDKKIKEVYDTLRAG |
| Ga0307302_101349383 | 3300028814 | Soil | RAAEWFTATGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEVYDTLGS |
| Ga0307499_101604012 | 3300031184 | Soil | AEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLGA |
| Ga0307469_105022631 | 3300031720 | Hardwood Forest Soil | AAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKETYDSLGA |
| Ga0307473_101966491 | 3300031820 | Hardwood Forest Soil | FVATGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSNEQAVDWADKKIKEIYDTIGR |
| Ga0307473_103525331 | 3300031820 | Hardwood Forest Soil | AAAVVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTIQR |
| Ga0315290_105073021 | 3300031834 | Sediment | VLTDAPAKVIIDKWSVDQAIDWADKKVKEIYDTIGG |
| Ga0310904_109797392 | 3300031854 | Soil | TGWPGPTTAPAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLKG |
| Ga0310904_113068981 | 3300031854 | Soil | AAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLGA |
| Ga0310893_101702111 | 3300031892 | Soil | TGWPGPTTAPAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLGA |
| Ga0310899_102340061 | 3300032017 | Soil | VTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYDTIG |
| Ga0310890_100350465 | 3300032075 | Soil | TAAAAEVQATNVLTDAPAKVIVDKWSVEQAIDWEDKKIKEIYDTLKG |
| Ga0310890_105083041 | 3300032075 | Soil | AAEWFSATGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLG |
| Ga0310895_107224212 | 3300032122 | Soil | WPGPTTAAAAEVQASNVLTDAPAKVNVDKWSVDQAIEWEDKKIKEIYDTLKG |
| Ga0315283_104319133 | 3300032164 | Sediment | TGWPGPVTAAAAEVQASNVLTDAPAKVIIDKWSVDQAIDWADKKVKEIYDTIGG |
| Ga0307471_1008681002 | 3300032180 | Hardwood Forest Soil | GPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKETYDTLGT |
| Ga0307471_1025477312 | 3300032180 | Hardwood Forest Soil | AEVQASNVLTDAPAKVIVDRWSNEQAVDWADKKIKEIYDTIGR |
| Ga0307471_1035239501 | 3300032180 | Hardwood Forest Soil | PTGWPGPTTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKTKEIYDTLKG |
| Ga0307472_1010275141 | 3300032205 | Hardwood Forest Soil | TGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIEWEDKKIKEIYGTLGA |
| Ga0315286_102470743 | 3300032342 | Sediment | AAAEVQASNVLTDAPAKVIIDKWSVDQAIDWADKKVKEIYDTIGG |
| Ga0335085_100680376 | 3300032770 | Soil | ASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG |
| Ga0335084_102895741 | 3300033004 | Soil | AAEWFAATGWPGPVTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKDIYETLP |
| Ga0316620_113586611 | 3300033480 | Soil | AAEVQASNVLTDAPAKVIVDKWSVDQAIDWEDKKIKEIYDTLRG |
| Ga0316627_1014332312 | 3300033482 | Soil | TAAAAEVQATNVLTDAPAKVIVDKWSVDQAIEWEDKKIKDVYDTLRS |
| Ga0314782_008318_1_120 | 3300034661 | Soil | VTAAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIK |
| Ga0373948_0022981_1066_1206 | 3300034817 | Rhizosphere Soil | AAAAEVQASNVLTDAPAKVIVDKWSVDQAIDWADKKIKEIYDTLGA |
| ⦗Top⦘ |