| Basic Information | |
|---|---|
| Family ID | F019513 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 229 |
| Average Sequence Length | 44 residues |
| Representative Sequence | SVQDIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCSAKK |
| Number of Associated Samples | 191 |
| Number of Associated Scaffolds | 229 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.75 % |
| % of genes near scaffold ends (potentially truncated) | 96.51 % |
| % of genes from short scaffolds (< 2000 bps) | 93.45 % |
| Associated GOLD sequencing projects | 179 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.039 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.594 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.891 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.079 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.08% β-sheet: 0.00% Coil/Unstructured: 85.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 229 Family Scaffolds |
|---|---|---|
| PF00141 | peroxidase | 63.32 |
| PF00903 | Glyoxalase | 3.49 |
| PF01475 | FUR | 1.75 |
| PF01939 | NucS | 1.31 |
| PF00199 | Catalase | 0.87 |
| PF12681 | Glyoxalase_2 | 0.87 |
| PF06580 | His_kinase | 0.44 |
| PF03167 | UDG | 0.44 |
| PF00126 | HTH_1 | 0.44 |
| PF03466 | LysR_substrate | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 229 Family Scaffolds |
|---|---|---|---|
| COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 63.32 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 1.75 |
| COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 1.31 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.87 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.44 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.44 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.44 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.44 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.48 % |
| Unclassified | root | N/A | 20.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100847323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300003368|JGI26340J50214_10065907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 970 | Open in IMG/M |
| 3300004080|Ga0062385_10770546 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300004082|Ga0062384_100159487 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300004082|Ga0062384_100683173 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300004082|Ga0062384_100783200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300004082|Ga0062384_100944982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 613 | Open in IMG/M |
| 3300004082|Ga0062384_101064277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300004091|Ga0062387_101196656 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300004153|Ga0063455_101281419 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005176|Ga0066679_10189684 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300005435|Ga0070714_102209770 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005439|Ga0070711_101944955 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005445|Ga0070708_101200961 | Not Available | 709 | Open in IMG/M |
| 3300005533|Ga0070734_10782523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300005538|Ga0070731_10321384 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300005541|Ga0070733_10231829 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300005541|Ga0070733_10319110 | Not Available | 1028 | Open in IMG/M |
| 3300005541|Ga0070733_10376294 | Not Available | 944 | Open in IMG/M |
| 3300005542|Ga0070732_10583577 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005542|Ga0070732_10832809 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300005712|Ga0070764_10916218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300005764|Ga0066903_100314050 | All Organisms → cellular organisms → Bacteria | 2495 | Open in IMG/M |
| 3300005764|Ga0066903_105228279 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005890|Ga0075285_1000976 | Not Available | 2900 | Open in IMG/M |
| 3300005921|Ga0070766_10796892 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005921|Ga0070766_10830139 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005921|Ga0070766_11148248 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005952|Ga0080026_10133673 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005995|Ga0066790_10004196 | All Organisms → cellular organisms → Bacteria | 6384 | Open in IMG/M |
| 3300006050|Ga0075028_100983070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 524 | Open in IMG/M |
| 3300006059|Ga0075017_100502805 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300006059|Ga0075017_101347537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 560 | Open in IMG/M |
| 3300006175|Ga0070712_102019668 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006176|Ga0070765_100252419 | Not Available | 1618 | Open in IMG/M |
| 3300006176|Ga0070765_100536136 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300006797|Ga0066659_10755462 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300006806|Ga0079220_11717602 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300007982|Ga0102924_1387613 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009098|Ga0105245_11634791 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300009522|Ga0116218_1065271 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300009525|Ga0116220_10582655 | Not Available | 513 | Open in IMG/M |
| 3300009525|Ga0116220_10585017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300009552|Ga0116138_1085306 | Not Available | 881 | Open in IMG/M |
| 3300009628|Ga0116125_1090360 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300009628|Ga0116125_1151739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300009639|Ga0116122_1244615 | Not Available | 556 | Open in IMG/M |
| 3300009641|Ga0116120_1112407 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300009646|Ga0116132_1161864 | Not Available | 681 | Open in IMG/M |
| 3300009672|Ga0116215_1265261 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300009672|Ga0116215_1378087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300009762|Ga0116130_1099177 | Not Available | 914 | Open in IMG/M |
| 3300009792|Ga0126374_11873790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 503 | Open in IMG/M |
| 3300009839|Ga0116223_10660442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300010339|Ga0074046_10369253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300010358|Ga0126370_12168977 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010359|Ga0126376_11748453 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300010360|Ga0126372_11585056 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300010366|Ga0126379_11380228 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300010376|Ga0126381_100438517 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
| 3300010379|Ga0136449_103052029 | Not Available | 652 | Open in IMG/M |
| 3300011037|Ga0138588_139512 | Not Available | 611 | Open in IMG/M |
| 3300011088|Ga0138576_1143139 | Not Available | 891 | Open in IMG/M |
| 3300011120|Ga0150983_12793951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300011120|Ga0150983_13700485 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012019|Ga0120139_1208928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 519 | Open in IMG/M |
| 3300012189|Ga0137388_10855286 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300012202|Ga0137363_10163128 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300012207|Ga0137381_11126253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300012212|Ga0150985_113500041 | Not Available | 594 | Open in IMG/M |
| 3300012354|Ga0137366_10472030 | Not Available | 908 | Open in IMG/M |
| 3300012363|Ga0137390_11129531 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300012925|Ga0137419_11383728 | Not Available | 593 | Open in IMG/M |
| 3300012930|Ga0137407_12319269 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012955|Ga0164298_10541626 | Not Available | 787 | Open in IMG/M |
| 3300012957|Ga0164303_10890320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300014159|Ga0181530_10549688 | Not Available | 570 | Open in IMG/M |
| 3300014161|Ga0181529_10724887 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300014168|Ga0181534_10100353 | Not Available | 1450 | Open in IMG/M |
| 3300014501|Ga0182024_10816396 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300014654|Ga0181525_10054825 | All Organisms → cellular organisms → Bacteria | 2264 | Open in IMG/M |
| 3300014654|Ga0181525_10402282 | Not Available | 752 | Open in IMG/M |
| 3300015052|Ga0137411_1170538 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300015193|Ga0167668_1076349 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300016294|Ga0182041_11504234 | Not Available | 620 | Open in IMG/M |
| 3300017822|Ga0187802_10050431 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300017822|Ga0187802_10167189 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300017822|Ga0187802_10208925 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300017933|Ga0187801_10283818 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300017935|Ga0187848_10231250 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300017941|Ga0187850_10354012 | Not Available | 644 | Open in IMG/M |
| 3300017946|Ga0187879_10027187 | All Organisms → cellular organisms → Bacteria | 3488 | Open in IMG/M |
| 3300017946|Ga0187879_10592662 | Not Available | 616 | Open in IMG/M |
| 3300017975|Ga0187782_11132034 | Not Available | 611 | Open in IMG/M |
| 3300017988|Ga0181520_10387692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1017 | Open in IMG/M |
| 3300017994|Ga0187822_10193844 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300018007|Ga0187805_10319990 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300018009|Ga0187884_10230422 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300018020|Ga0187861_10364528 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300018034|Ga0187863_10106368 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300018037|Ga0187883_10457288 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300018042|Ga0187871_10132444 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300018043|Ga0187887_10587692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300018046|Ga0187851_10745190 | Not Available | 551 | Open in IMG/M |
| 3300018057|Ga0187858_10213803 | Not Available | 1252 | Open in IMG/M |
| 3300018090|Ga0187770_11183073 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300019278|Ga0187800_1270979 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300019786|Ga0182025_1067025 | Not Available | 1792 | Open in IMG/M |
| 3300019882|Ga0193713_1017041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2168 | Open in IMG/M |
| 3300019885|Ga0193747_1159408 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300019999|Ga0193718_1049652 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300020004|Ga0193755_1146802 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300020579|Ga0210407_10496916 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300020580|Ga0210403_10777723 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300020580|Ga0210403_10877518 | Not Available | 709 | Open in IMG/M |
| 3300020581|Ga0210399_10208436 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300020581|Ga0210399_10884955 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300021088|Ga0210404_10361415 | Not Available | 807 | Open in IMG/M |
| 3300021168|Ga0210406_11192893 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300021170|Ga0210400_10307192 | Not Available | 1302 | Open in IMG/M |
| 3300021170|Ga0210400_11102064 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300021170|Ga0210400_11460251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300021171|Ga0210405_11091030 | Not Available | 597 | Open in IMG/M |
| 3300021171|Ga0210405_11399166 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300021180|Ga0210396_10108875 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300021181|Ga0210388_10783129 | Not Available | 827 | Open in IMG/M |
| 3300021181|Ga0210388_11024232 | Not Available | 707 | Open in IMG/M |
| 3300021181|Ga0210388_11655597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300021401|Ga0210393_10913072 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300021402|Ga0210385_10361140 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300021402|Ga0210385_10602675 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300021403|Ga0210397_11020944 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300021404|Ga0210389_10063487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2831 | Open in IMG/M |
| 3300021405|Ga0210387_10516278 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300021405|Ga0210387_10519482 | Not Available | 1059 | Open in IMG/M |
| 3300021407|Ga0210383_10963540 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300021420|Ga0210394_10918571 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300021432|Ga0210384_10858798 | Not Available | 807 | Open in IMG/M |
| 3300021432|Ga0210384_11868828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 506 | Open in IMG/M |
| 3300021433|Ga0210391_10756829 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300021474|Ga0210390_11464730 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300021477|Ga0210398_10054330 | All Organisms → cellular organisms → Bacteria | 3283 | Open in IMG/M |
| 3300021478|Ga0210402_10033075 | All Organisms → cellular organisms → Bacteria | 4471 | Open in IMG/M |
| 3300021478|Ga0210402_10696375 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300021560|Ga0126371_10754717 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300021560|Ga0126371_12136588 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300022508|Ga0222728_1095377 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300022521|Ga0224541_1001527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 2300 | Open in IMG/M |
| 3300022531|Ga0242660_1233129 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300022532|Ga0242655_10016220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1526 | Open in IMG/M |
| 3300022726|Ga0242654_10172107 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300022875|Ga0224553_1055796 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300024225|Ga0224572_1095151 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300025414|Ga0208935_1027107 | Not Available | 758 | Open in IMG/M |
| 3300025480|Ga0208688_1107995 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300025915|Ga0207693_10622124 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300025922|Ga0207646_10385509 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300025929|Ga0207664_11464047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300025945|Ga0207679_11234695 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300025992|Ga0208775_1001476 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300026023|Ga0207677_11065629 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300026309|Ga0209055_1259428 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300026351|Ga0257170_1062934 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300026552|Ga0209577_10766426 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300027330|Ga0207777_1045283 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300027521|Ga0209524_1111434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300027528|Ga0208985_1067047 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300027567|Ga0209115_1117035 | Not Available | 603 | Open in IMG/M |
| 3300027576|Ga0209003_1021615 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300027619|Ga0209330_1110966 | Not Available | 623 | Open in IMG/M |
| 3300027641|Ga0208827_1179393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300027692|Ga0209530_1100406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea dietziae | 824 | Open in IMG/M |
| 3300027698|Ga0209446_1070659 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300027706|Ga0209581_1237819 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 562 | Open in IMG/M |
| 3300027812|Ga0209656_10309759 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300027821|Ga0209811_10238923 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300027842|Ga0209580_10025106 | All Organisms → cellular organisms → Bacteria | 2682 | Open in IMG/M |
| 3300027842|Ga0209580_10439482 | Not Available | 650 | Open in IMG/M |
| 3300027853|Ga0209274_10659127 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300027867|Ga0209167_10039892 | All Organisms → cellular organisms → Bacteria | 2280 | Open in IMG/M |
| 3300027869|Ga0209579_10536690 | Not Available | 635 | Open in IMG/M |
| 3300027882|Ga0209590_10347873 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300027911|Ga0209698_11198794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300028566|Ga0302147_10068965 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300028666|Ga0265336_10170577 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300028775|Ga0302231_10375460 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300028788|Ga0302189_10410360 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300028789|Ga0302232_10605947 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300028800|Ga0265338_10172398 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300028858|Ga0302216_1070842 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300028906|Ga0308309_10158386 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
| 3300028906|Ga0308309_10159704 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300029907|Ga0311329_10194134 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300029980|Ga0302298_10186957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica | 674 | Open in IMG/M |
| 3300030000|Ga0311337_10233258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1521 | Open in IMG/M |
| 3300030011|Ga0302270_10515216 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300030054|Ga0302182_10467316 | Not Available | 525 | Open in IMG/M |
| 3300030058|Ga0302179_10019088 | All Organisms → cellular organisms → Bacteria | 3347 | Open in IMG/M |
| 3300030491|Ga0302211_10024006 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
| 3300030659|Ga0316363_10169953 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300030741|Ga0265459_13844942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300030990|Ga0308178_1092655 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300031122|Ga0170822_12135361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica | 663 | Open in IMG/M |
| 3300031128|Ga0170823_14104932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 676 | Open in IMG/M |
| 3300031231|Ga0170824_128656655 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300031244|Ga0302297_1055554 | Not Available | 739 | Open in IMG/M |
| 3300031247|Ga0265340_10254114 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031446|Ga0170820_12563020 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031469|Ga0170819_12459346 | Not Available | 563 | Open in IMG/M |
| 3300031474|Ga0170818_107343584 | Not Available | 622 | Open in IMG/M |
| 3300031474|Ga0170818_115149258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica | 724 | Open in IMG/M |
| 3300031525|Ga0302326_10163407 | All Organisms → cellular organisms → Bacteria | 3802 | Open in IMG/M |
| 3300031708|Ga0310686_113642966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300031708|Ga0310686_117917516 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031715|Ga0307476_10742653 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300031753|Ga0307477_10341367 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300031823|Ga0307478_10576656 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300031823|Ga0307478_11823689 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031837|Ga0302315_10190080 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300031918|Ga0311367_10628999 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300031962|Ga0307479_10946276 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300031962|Ga0307479_11364575 | Not Available | 668 | Open in IMG/M |
| 3300032001|Ga0306922_12015050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 562 | Open in IMG/M |
| 3300032515|Ga0348332_10212785 | Not Available | 503 | Open in IMG/M |
| 3300032895|Ga0335074_10831985 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300033412|Ga0310810_10379484 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300033475|Ga0310811_10916055 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300034065|Ga0334827_175365 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300034090|Ga0326723_0387759 | Not Available | 633 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.68% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.37% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.06% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.62% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.62% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.18% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.75% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.31% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.31% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.87% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.87% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.44% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.44% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.44% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.44% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.44% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.44% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.44% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.44% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.44% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011037 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 80 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022875 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 10-14 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025992 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028858 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031244 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_2 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1008473231 | 3300002245 | Forest Soil | LVCSRCKSVQDIEGEFIDFKQLSRHLPDGFDLTQPLVEVFGLCRRCAKK* |
| JGI26340J50214_100659072 | 3300003368 | Bog Forest Soil | TRCKSVQDIAGDFVDFKRLARQAPGGFDLRQPLIEVFGLCPRCSGKT* |
| Ga0062385_107705461 | 3300004080 | Bog Forest Soil | CKSVQDIEGEFIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCAATK* |
| Ga0062384_1001594872 | 3300004082 | Bog Forest Soil | IEGEFIDFKRLSRQLPDGFDLTQPLVEVFGLCRRCSANQ* |
| Ga0062384_1006831731 | 3300004082 | Bog Forest Soil | VCSRCKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLVEVFGLCRRCSKKK* |
| Ga0062384_1007832001 | 3300004082 | Bog Forest Soil | LVCSRCKSVQDIEGEFIDFKRLSRHLPDGFDLMQPLVEVFGLCRRCSTKK* |
| Ga0062384_1009449821 | 3300004082 | Bog Forest Soil | VCSRCKSVQDIEGEFIDFKRLSRQLPDGFDLTEALVEVFGLCRRCSAKD* |
| Ga0062384_1010642772 | 3300004082 | Bog Forest Soil | QDIEGEFIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCAATK* |
| Ga0062387_1011966561 | 3300004091 | Bog Forest Soil | CKSVQDIEGEFIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCAAKK* |
| Ga0063455_1012814192 | 3300004153 | Soil | CSRCKSVQDIEGEFVDFKRLSRQLPDGFDLTQPLVEVFGLCRRCSTKK* |
| Ga0066679_101896841 | 3300005176 | Soil | KSVQDIEGDFIDFNRLSRQLPGGFDLTQPLIEVFGLCRRCRAKT* |
| Ga0070714_1022097701 | 3300005435 | Agricultural Soil | CKSVQDIEGDFIDFKRLSPHVPHGFDLTQPVVEVFGLCRRCSAKR* |
| Ga0070711_1019449552 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ISGDFVDFQRLARQVPGGFDLTQPLIEVFGLCARCSAKT* |
| Ga0070708_1012009612 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKSVQDIEGEFIDLKRLSRQLPDGFDLTQPLIEVFGLRRRCRART* |
| Ga0070734_107825231 | 3300005533 | Surface Soil | VCSRCKSVQDIEGDFIDLKRLSRQLPDGFDVTQPLIEVFGLCRRCSAKT* |
| Ga0070731_103213841 | 3300005538 | Surface Soil | VQDIEGEFIDFKRLSRHLPEGFDLTQPLVEVFGLCRRCSARK* |
| Ga0070733_102318292 | 3300005541 | Surface Soil | VDFKRLARQAPGGFDLSEPLIEVFGLCPRCSAKNSKTTS* |
| Ga0070733_103191101 | 3300005541 | Surface Soil | EGEFIDFKRLSRHVPDGFDLTQPLVEVFGLCRRCRAKT* |
| Ga0070733_103762941 | 3300005541 | Surface Soil | GEFIDFKRLSPHVPRGFDLTQPVVEVFGLCRRCSAKK* |
| Ga0070732_105835772 | 3300005542 | Surface Soil | HLVCSRCKSVQDIEGEFIDFKQLSRHVPDGFDLTQPLVEVFGLCRRCRAKK* |
| Ga0070732_108328091 | 3300005542 | Surface Soil | VCMRCKTVQDIPGDFITGDLIDFKRLARQAPGGFDLTEPLIEVFGLCRRCSAKTQKLTS* |
| Ga0070764_109162182 | 3300005712 | Soil | VVCSRCKSVQDIEGEFIDFKRLSRQVPDGFDLTQPLIEVFGLCRRCRAKE* |
| Ga0066903_1003140501 | 3300005764 | Tropical Forest Soil | VQDIEGDFIDFRRLSSQVPDGFDLTQPVVEVFGLCRRCRAKTISNSEKGK* |
| Ga0066903_1052282792 | 3300005764 | Tropical Forest Soil | VQDIEGDFIDFKRLSPQVPDGFDLTQPVIEVFGLCRRCRSKTTTNSDKGK* |
| Ga0075285_10009763 | 3300005890 | Rice Paddy Soil | KSVQDIEGEFIDFNRLSRQLPAGFDLSQPLIEVFGLCRRCRAKK* |
| Ga0070766_107968922 | 3300005921 | Soil | CSRCKSVQDIEGEFIDFKRLSRHAPDGFDLTQPLVEVFGLCRRCSAKQ* |
| Ga0070766_108301391 | 3300005921 | Soil | CKSVQDIEGEFIDFKRLSRYLPDGFDLTQPLVEVFGLCRRCSTKK* |
| Ga0070766_111482482 | 3300005921 | Soil | CSRCKSVQDIEGEFIDFKRLSRQVPDGFDLTQPLIEVFGLCRRCRAKT* |
| Ga0080026_101336731 | 3300005952 | Permafrost Soil | DITGDFVDFKRLARQAPGGFDLTEPLIEVFGLCRRCSAKR* |
| Ga0066790_100041966 | 3300005995 | Soil | CSRCKSVQDIEGEFIDFNRLSRHLPDGFDLTQPLVEVFGLCRRCSAKK* |
| Ga0075028_1009830701 | 3300006050 | Watersheds | TRCKAVQDIEGDFINYKKLSRRAPRGFDLSQPLVEVFGLCRRCGAKK* |
| Ga0075017_1005028051 | 3300006059 | Watersheds | RCKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCRAKT* |
| Ga0075017_1013475371 | 3300006059 | Watersheds | VCSRCKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLVEVFGLCRRCRAKT* |
| Ga0070712_1020196681 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRCKTVQDIPGDFITGDLIDFKRLARQAPGGFDLTEPLIEVFGLCRRCRSKT* |
| Ga0070765_1002524191 | 3300006176 | Soil | IEGEFIDFKRLSRHLPDGFDLTHPLVEVFGLCRRCSAKT* |
| Ga0070765_1005361362 | 3300006176 | Soil | QDIEGEFIDFKRLSRQLPDGFNLTQPLIEVFGLCRRCSAKK* |
| Ga0066659_107554621 | 3300006797 | Soil | SRCKSVQDIEGEFIDFNRLSRQLPAGFDLTQPLIEVFGLCRRCSAKT* |
| Ga0079220_117176022 | 3300006806 | Agricultural Soil | VDFQRLARQVPGGFDLTQPLIEVFGLCARCSAKT* |
| Ga0102924_13876132 | 3300007982 | Iron-Sulfur Acid Spring | SVQDIEGEFIDFKRLSRQLPAGFDLTQPLIEIFGLCRRCRATQ* |
| Ga0105245_116347911 | 3300009098 | Miscanthus Rhizosphere | EFIDFKQLSRHLPDGFDLTQPLVEVFGLCRRCSAKK* |
| Ga0116218_10652711 | 3300009522 | Peatlands Soil | SVQDIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCSAKK* |
| Ga0116220_105826551 | 3300009525 | Peatlands Soil | RDIDGDFIGCKRLSLRIPDGFDLTQSLVEVFGLCRRCRAKT* |
| Ga0116220_105850171 | 3300009525 | Peatlands Soil | RCKSVEDIEGEFIDFKRLSRHVPDGFDLSQPMIEVFGLCRSCAKT* |
| Ga0116138_10853061 | 3300009552 | Peatland | AVCSRCKSVQDIEGEFINFKQLSRQLPEGFDLGQPLIEVFGLCRRCSAKK* |
| Ga0116125_10903602 | 3300009628 | Peatland | VQDIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCKAKN* |
| Ga0116125_11517392 | 3300009628 | Peatland | RCKKVQDVEADFFDFKKLSPKVLNGFDLTHPVVEVFGLCRRCSAKK* |
| Ga0116122_12446151 | 3300009639 | Peatland | EFIDLKRLSRQLPDGFDLTQPLIEVFGLCRRCRAKT* |
| Ga0116120_11124072 | 3300009641 | Peatland | RCKSVRDIEGDFIDFNRLSRHLPGGFDLTQPLVEVFGLCRRCRAKN* |
| Ga0116132_11618641 | 3300009646 | Peatland | IEGEFIDFKRLSRQAPDGFDLTQPLIEVFGLCRRCSAKT* |
| Ga0116215_12652611 | 3300009672 | Peatlands Soil | KSVHDIEADFIDFNRLSRHLPDGFDLTQPLIEVFGLCRRCSAKK* |
| Ga0116215_13780872 | 3300009672 | Peatlands Soil | KSVQDIEGEFIDFKRLSRQLPEGFDLTQPLIEVFGLCRRCRSKK* |
| Ga0116130_10991771 | 3300009762 | Peatland | KTLQDMEGDFINLKRLSRQAPRGFDLTRPLVDLYGLCRRCQTKT* |
| Ga0126374_118737901 | 3300009792 | Tropical Forest Soil | IEGDFIDFKRLSPQVPDGFDLTQPVVEVFGLCRRCRSKTISNSEKGK* |
| Ga0116223_106604421 | 3300009839 | Peatlands Soil | VVCSRCKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCSAKK* |
| Ga0074046_103692532 | 3300010339 | Bog Forest Soil | SRHPVQEIEEDFIDLKRLSRQLPDGFDLTQPLIEVFGLCRRCRAKT* |
| Ga0126370_121689771 | 3300010358 | Tropical Forest Soil | HLVCSRCKTVQDIEGDFIDFTRLSPQVPDGFDLTQPVIEVFGLCRRCRSKTTTNSDKGK* |
| Ga0126376_117484531 | 3300010359 | Tropical Forest Soil | TVQDIAGDFIDFQRLSPQVPEGFDLTRPVVEVFGLCRRCRSKNKS* |
| Ga0126372_115850562 | 3300010360 | Tropical Forest Soil | DIEGEFFDFKRISGQIPSGFDLSHPVVEVFGLCRRCSAKT* |
| Ga0126379_113802282 | 3300010366 | Tropical Forest Soil | IDFKRLSRQLPDGFDLTQPLIEVFGLCRRCRSKT* |
| Ga0126381_1004385171 | 3300010376 | Tropical Forest Soil | DIEGEFFDLQRISRQIPPGFDLSNPVVEVFGLCRRCSAKT* |
| Ga0136449_1030520292 | 3300010379 | Peatlands Soil | CKSVQDIEGEFVDFKRLSWQLPDGFDLTQPLIEVFGLCRRCRAKT* |
| Ga0138588_1395121 | 3300011037 | Peatlands Soil | DIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCRAKT* |
| Ga0138576_11431392 | 3300011088 | Peatlands Soil | VQDIEGEFIDFKRLSRQVPDGFDLTQPLVEVFGLCRRCRAKK* |
| Ga0150983_127939511 | 3300011120 | Forest Soil | RCKSVQDIEGNFVDFKKLFRQLPGGFDLTQPLVEVFGLCQRCSKKPRTTTTKEKLCQKTKKR* |
| Ga0150983_137004852 | 3300011120 | Forest Soil | VCSRCKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCSAKK* |
| Ga0120139_12089281 | 3300012019 | Permafrost | VQDIEGEFIDFNRLSRQLPVGFDLTQPLIEVFGLCRRCSAKK* |
| Ga0137388_108552861 | 3300012189 | Vadose Zone Soil | FVDFKRLSRQLPGGFDLTQPLVEVFGLCKDCKTRKKIS* |
| Ga0137363_101631282 | 3300012202 | Vadose Zone Soil | EGDFVDFKRLSRQLPGGFDLTQPLVEVFGLCQDCKTRKKIS* |
| Ga0137381_111262531 | 3300012207 | Vadose Zone Soil | MGKSVQDIEGEFIDLKGLSRQLPDGFDLTRPLIEVFGLCRRCRAKT* |
| Ga0150985_1135000412 | 3300012212 | Avena Fatua Rhizosphere | CTRCKSVQDITGDFIDFKRLARQAPGGFDLTQPLIEVFGLCQRCRAKTLKTSEERNHG* |
| Ga0137366_104720302 | 3300012354 | Vadose Zone Soil | SVQDIEGEFIDFNRLSRHVPVGFDLTQPLIEVFGLCRSCNAKK* |
| Ga0137390_111295312 | 3300012363 | Vadose Zone Soil | QDIEGDFINYKKLSRQAPRGFDLTQPLVEVFGLCRHCRART* |
| Ga0137419_113837281 | 3300012925 | Vadose Zone Soil | IDLKRLSRQLPDGFDLTQPLIEVFGLCRSCRAKK* |
| Ga0137407_123192692 | 3300012930 | Vadose Zone Soil | SVHDIEGDFVDFKRLSRQLPGGFDLTQPLVEVFGLCQDCKTRKKIS* |
| Ga0164298_105416262 | 3300012955 | Soil | SRCKSVQDIEGEFIDFNRLSRHLPDGFDVTQPLVEVFGLCRRCSAKK* |
| Ga0164303_108903202 | 3300012957 | Soil | RCKSVQDIEGDFIDLKRISRQLPAGFDLTQPLIEVFGLCRSCSAQK* |
| Ga0181530_105496881 | 3300014159 | Bog | EGEFIDLKRLSRHVPDGFDLTQPLVEVFGLCRRCRAKN* |
| Ga0181529_107248871 | 3300014161 | Bog | QDIEGEFIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCRSKK* |
| Ga0181534_101003531 | 3300014168 | Bog | FIDFKRLSRHVPDGFDLTQPLIEVFGLCGRCSAKK* |
| Ga0182024_108163961 | 3300014501 | Permafrost | KSVQDIEGEFIDFKRLSRHLPDGFDLTQPLIEVFGLCRRCRAKK* |
| Ga0181525_100548251 | 3300014654 | Bog | VRDIEGDFVDFKKLSRHVLDGFDLTQPAVEVFGLCRRCSAKK* |
| Ga0181525_104022822 | 3300014654 | Bog | SRCKSVQDIEGEFIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCAKE* |
| Ga0137411_11705381 | 3300015052 | Vadose Zone Soil | QDIDDDFFVDFKRLSRQLPGGFDLTQPLVEVFGLCKDCKTRKKIS* |
| Ga0167668_10763491 | 3300015193 | Glacier Forefield Soil | LVCSRCKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCSAKK* |
| Ga0182041_115042341 | 3300016294 | Soil | RVQDIEGEFFDFKRISRQIPSGFDLSSPVVEVFGLCRRCRAKT |
| Ga0187802_100504311 | 3300017822 | Freshwater Sediment | SRCKSVQDIEGEFIDFKRLSRHVPDGFDLTQPLVEVFGLCRRCSAKK |
| Ga0187802_101671892 | 3300017822 | Freshwater Sediment | CSRCKSVQDIEGEFIDFKRLSPHVPDGFDLTQPLVEVFGLCRRCRAKT |
| Ga0187802_102089251 | 3300017822 | Freshwater Sediment | EGEFIDFKRLSRQLPDGFDLTQPLVEVFGLCRRCSAKQ |
| Ga0187801_102838181 | 3300017933 | Freshwater Sediment | HLVCSRCKSVQDIEGEFIDFTRLSRQLPDGFDLTQPLIEVFGLCRRCRAKK |
| Ga0187848_102312502 | 3300017935 | Peatland | FIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCAAKK |
| Ga0187850_103540121 | 3300017941 | Peatland | LVCSRCKSVRDIEGDFIDFNRLSRHLPGGFDLTQPLVEVFGLCRRCRAKN |
| Ga0187879_100271873 | 3300017946 | Peatland | VQDIEGEFIDFKQLSRQAPGGFDLTQPLIEVFGLCRRCSAKT |
| Ga0187879_105926621 | 3300017946 | Peatland | VQDIEGEFIDFKQLSRQAPGGFDLTQPLIEVFGLCRRCSART |
| Ga0187782_111320341 | 3300017975 | Tropical Peatland | CKQVQDIEGDFIDFKRLSPHVPKGFDLTQPVVEVFGLCRRCRDKK |
| Ga0181520_103876922 | 3300017988 | Bog | VQDIEGEFIDFKRLSRQLPEGFDLTQPLIEVFGLCHRCSTKK |
| Ga0187822_101938442 | 3300017994 | Freshwater Sediment | VCSRCKSVQDISGDFVDFQRLARQVPGGFDLTQPLIEVFGLCRSCTAKK |
| Ga0187805_103199902 | 3300018007 | Freshwater Sediment | FIDFKRLSRQLPDGFDVTQPLVEVFGLCRRCRAKK |
| Ga0187884_102304221 | 3300018009 | Peatland | EGDFINYKKLSRQAPRGFDLTQPLVEVFGLCRRCSAKK |
| Ga0187861_103645282 | 3300018020 | Peatland | KSVQDIEGEFIDFKRLSRQLPDGFDLTRPLIEVFGLCRRCSAKK |
| Ga0187863_101063683 | 3300018034 | Peatland | QDIEGEFIDFKQLSRQAPGGFDLTQPLIEVFGLCRRCSAKT |
| Ga0187883_104572882 | 3300018037 | Peatland | HCKAVQDIEGDFINYKKLSRQAPRGFDLTQPLVEVFGVCRRCAKT |
| Ga0187871_101324442 | 3300018042 | Peatland | QDIEGEFIDFKRLSRQLPEGFDLTQPLIEVFGLCHRCSTKK |
| Ga0187887_105876921 | 3300018043 | Peatland | SRCKSVQDIDIDFIDLKRLSRQLPDGFDLTQPLIEVFGLCRRCKAKN |
| Ga0187851_107451902 | 3300018046 | Peatland | EFIDFKQLSRQAPGGFDLTQPLIEVFGLCRRCSART |
| Ga0187858_102138031 | 3300018057 | Peatland | EFIDFKQLSRQAPGGFDLTQPLIEVFGLCRRCSAKT |
| Ga0187770_111830732 | 3300018090 | Tropical Peatland | VEGDFINYKKLARQAPRGFDLTQPLVEVFGLCRRCSAETLRRSD |
| Ga0187800_12709791 | 3300019278 | Peatland | EDIEGDFIDFKRLSPLVPNGFDLSQPVVEVFGLCRRCRTKN |
| Ga0182025_10670252 | 3300019786 | Permafrost | TRCKSVQDIAGDFVDFKRLARQAPGGFDLTEPLIDVFGLCPRCSAKIQCQNLNPTS |
| Ga0193713_10170413 | 3300019882 | Soil | MGKSVQDIEGEFIDLKRLSRQLPDGFDLTQLLIGVFGLCGPAVQ |
| Ga0193747_11594082 | 3300019885 | Soil | CKSVQDIEGDFIDLKRLSRQLPGGFDLTQPLIEVFGLCRSCRGKK |
| Ga0193718_10496523 | 3300019999 | Soil | VQDIEGEFVDFNRLSRQLPDGFDLTQPMIEVFGLCRRCSAKK |
| Ga0193755_11468021 | 3300020004 | Soil | EGEFVDFNRLSRQLPDGFDLTQPMIEVFGLCRRCSAKK |
| Ga0210407_104969162 | 3300020579 | Soil | GDFIDFKRLSRQLPGGFDLTQPLIEVFGLCRSCSAKT |
| Ga0210403_107777232 | 3300020580 | Soil | GEFIDFKRLSRYLPDGFDLTQPLVEVFGLCRRCSTKK |
| Ga0210403_108775181 | 3300020580 | Soil | LVCVRCKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLVEVFGVCRRCRAKT |
| Ga0210399_102084361 | 3300020581 | Soil | HLVCSRCKSVQDIEGEFIDFKRLSRHVPDGFDLTQPLVEVFGLCRRCRAKK |
| Ga0210399_108849551 | 3300020581 | Soil | KSVQDIEGDFIDLNRLSRRLPDGFDLTQPLIEVFGLCRRCRTNK |
| Ga0210404_103614151 | 3300021088 | Soil | EGEFFDFKRLSRHLPDGFDLTQPLVEVFGLCRRCSVKK |
| Ga0210406_111928932 | 3300021168 | Soil | CKSVQDIEGEFIDFKRLSRQLPDGFDLTQPMIEVFGLCRRCSAKR |
| Ga0210400_103071922 | 3300021170 | Soil | CKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCRAKT |
| Ga0210400_111020642 | 3300021170 | Soil | IEGEFIDFKRLCRQLPDGFDLTQPLVEVFGLCRRCSAKQ |
| Ga0210400_114602511 | 3300021170 | Soil | RCKSVQDIEGDFIDLKRLSRQLPHGFDLTQPLIEVFGLCRRCSTEK |
| Ga0210405_110910302 | 3300021171 | Soil | SVQDIEGEFIDFKRLSRRVPDGFDLTQPLVEVFGLCRRCRAKK |
| Ga0210405_113991662 | 3300021171 | Soil | KSVQDIEGDFIDLKRLSRQLPVGFDLTQPLIEVFGLCRSCSAKT |
| Ga0210396_101088751 | 3300021180 | Soil | QDVEGDFIDLKRLSRQLPGGFDLSQPLIEVFGLCRSCSAKK |
| Ga0210388_107831292 | 3300021181 | Soil | RCKSVQDIEGEFIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCSAKK |
| Ga0210388_110242322 | 3300021181 | Soil | IEGDFIDFNRLSRQLPGGFDLTQPLIEVFGLCRRCRAKK |
| Ga0210388_116555972 | 3300021181 | Soil | EGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCRSKK |
| Ga0210393_109130722 | 3300021401 | Soil | EFIDFKRLSRQLPDGFNLTQPLIEVFGLCRRCSAKK |
| Ga0210385_103611401 | 3300021402 | Soil | RCKSVQDIEGEFIDFKRLSQQLPDGFDLTQPLIEVFGLCRRCSTEK |
| Ga0210385_106026751 | 3300021402 | Soil | SRCKSVQDIKGDFIDLKRLSRQLPAGFDLTQPLIEVFGLCRSCRAKQ |
| Ga0210397_110209441 | 3300021403 | Soil | LRCKSVQDIEGEFIDFKRLSRHVPDGFDLTQPLIEVFGLCRRCRTKT |
| Ga0210389_100634873 | 3300021404 | Soil | SVQDITGNFVDFKRLARQAPGGFDLTEPLIEVFGLCPRCSAKKTTS |
| Ga0210387_105162782 | 3300021405 | Soil | EFIEFKRLSRHLPDGFDLTQPLVEVFGLCRRCSAKK |
| Ga0210387_105194822 | 3300021405 | Soil | CKAVQDIEGDFIDYKKLSRQAPEGFDLRAPLVDVFGLCRQCAET |
| Ga0210383_109635402 | 3300021407 | Soil | HHLVCSRCKSVQDIEGEFIDFKRLSRHLPVGFDLTQPLIEVFGLCGSCSVKK |
| Ga0210394_109185711 | 3300021420 | Soil | SVQDIEGEFIDFKRLSRQAPDGFDLTHPLIEVFGLCHRCRAKT |
| Ga0210384_108587981 | 3300021432 | Soil | SVQDIEGEFIDFKRLSQQLPDGFDLTQPLIEVFGLCRRCSARK |
| Ga0210384_118688281 | 3300021432 | Soil | CKSVRDIEGDFFDFKRISRQIPEGFDLSQPVVEVFGLCRRCRANG |
| Ga0210391_107568291 | 3300021433 | Soil | SRCKSVQDIEGEFIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCRTKK |
| Ga0210390_114647302 | 3300021474 | Soil | KSVQDIEGEFIDFKGLSRQLPDGFDLTQPLVEVFGLCRRCGAKK |
| Ga0210398_100543303 | 3300021477 | Soil | IEGEFIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCSAEK |
| Ga0210402_100330751 | 3300021478 | Soil | RCKSVQDIEGEFIDYKRLSRHLPDGFDLTQPLIEVFGVCRRCGAK |
| Ga0210402_106963751 | 3300021478 | Soil | KSVQDIEGEFIDFKRLSRHVPDGFDLTRPLVEVFGLCRRCRART |
| Ga0126371_107547172 | 3300021560 | Tropical Forest Soil | SRCKTVQDIEGDFIDFKRLSPQVPDGFDLTQPVVEVFGLCRRCRSKTISNSEKGK |
| Ga0126371_121365882 | 3300021560 | Tropical Forest Soil | LVCSRCKTVQDIEGDFIDYKRLSPHIPEGFDLTRPQVEVFGVCRRCSQNVV |
| Ga0222728_10953772 | 3300022508 | Soil | VCSRCKSVQDIEGEFIDFKRLSRQVPDGFDLTQPLIEVFGLCRRCRAKT |
| Ga0224541_10015271 | 3300022521 | Soil | CSRCKSVQDIEGEFIDFKRLSRHLPDGFDLTQPLIEVFGLCRSCSAKK |
| Ga0242660_12331292 | 3300022531 | Soil | CSRCKSVQDIEGEFIDFKRLSRHVPDGFDLTQPLVEVFGLCRRCRTKT |
| Ga0242655_100162201 | 3300022532 | Soil | RCKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCRTKT |
| Ga0242654_101721071 | 3300022726 | Soil | LVCSRCKSVQDIKGDFIDLKRLSRQLPAGFDLTQPLIEVFGLCRSCRAKQ |
| Ga0224553_10557961 | 3300022875 | Soil | CKSVRDIEGEFIDFNRLSQQLPGGFDLTQPLVEVFGLCRRCRART |
| Ga0224572_10951511 | 3300024225 | Rhizosphere | CSRCKSVQDIEGEFIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCSAKK |
| Ga0208935_10271071 | 3300025414 | Peatland | DVEGDFINYKKLSRHAPRGFDLTQPLVEVFGLCRRCSAKK |
| Ga0208688_11079952 | 3300025480 | Peatland | CSRCKSVQDIEGEFIDFKRLSRQLPGGFDLTQPLIEVFGLCRRCSAKT |
| Ga0207693_106221242 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IEGEFIDFKQLSRHLPDGFDLTQPLVEVFGLCRRCSAKK |
| Ga0207646_103855092 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKSVQDIEGEFIDLKRLSRQLPDGFDLTQPLIEVFGLRRRCRART |
| Ga0207664_114640471 | 3300025929 | Agricultural Soil | CKSVQDIEGDFIDFKRLSPHVPHGFDLTQPVVEVFGLCRRCSAKR |
| Ga0207679_112346952 | 3300025945 | Corn Rhizosphere | SVQDITGDFVDFQRLARQVPGGFDLTQPLIEVFGFCRSCKAKK |
| Ga0208775_10014762 | 3300025992 | Rice Paddy Soil | KSVQDIEGEFIDFNRLSRQLPAGFDLSQPLIEVFGLCRRCRAKK |
| Ga0207677_110656292 | 3300026023 | Miscanthus Rhizosphere | GEFIDFNQLSRHLPDGFDLTQPLVEVFGLCRRCSAKK |
| Ga0209055_12594282 | 3300026309 | Soil | IEGDFIDLKRLSRQLPGGFDLSQPLIEVFGLCRSCSAKK |
| Ga0257170_10629341 | 3300026351 | Soil | SVQDIEGEFIDFNRLSRHLPDGFDLTQPLVEVFGLCRRCSAKK |
| Ga0209577_107664262 | 3300026552 | Soil | VCSRCKSVQDIEGDFVDFNTLSRHLPDGFDLTQPLIEVFGLCRRCRART |
| Ga0207777_10452832 | 3300027330 | Tropical Forest Soil | DIEGDFIDLKRLSPQVPDGFDLTQPLIEVFGLCRRCRAKA |
| Ga0209524_11114341 | 3300027521 | Forest Soil | VQDIEGEFIDFKRLSPQLPAGFDLTQPLIEVFGLCRRCNAKK |
| Ga0208985_10670472 | 3300027528 | Forest Soil | QDIESDLIDLKRLSRKLPKGFDLTSPVVEVFGLCSRCRAKQKVKTN |
| Ga0209115_11170351 | 3300027567 | Forest Soil | DIEGEFIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCSAKK |
| Ga0209003_10216152 | 3300027576 | Forest Soil | VQDIEGDFIDLKRLSRQLPGGFDLSQPLIEVFGLCRSCSAKK |
| Ga0209330_11109662 | 3300027619 | Forest Soil | SRCKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLVEVFGLCRRCSTKK |
| Ga0208827_11793931 | 3300027641 | Peatlands Soil | IEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCSAKR |
| Ga0209530_11004062 | 3300027692 | Forest Soil | VQDIEEEFIDFNRLSRHLPEGFDLTQPLVEVFGLCRRCSAKK |
| Ga0209446_10706592 | 3300027698 | Bog Forest Soil | EFVDFKRLSWQLPDGFDLTQPLIEVFGLCRRCRAKT |
| Ga0209581_12378192 | 3300027706 | Surface Soil | SVQDISCDFVDFKRLARQAPGGFDLTQPVVEVFGLCRRCSSKT |
| Ga0209656_103097592 | 3300027812 | Bog Forest Soil | CKSVQDIAGDFVDFKRLARQAPGGFDLKQPLVEVFGLCPRCSGKT |
| Ga0209811_102389231 | 3300027821 | Surface Soil | IEGDFIDLKRLSRQLPDGFDLTQPLIEVFGLCRRCNAKT |
| Ga0209580_100251061 | 3300027842 | Surface Soil | VQDIEGEFIDFKQLSRQLPDGFDLTQPLIEVFGLCRRCSAKR |
| Ga0209580_104394822 | 3300027842 | Surface Soil | HLVCSRCKSVQDIEGEFIDFKQLSRHVPDGFDLTQPLVEVFGLCRRCRAKK |
| Ga0209274_106591271 | 3300027853 | Soil | CSRCKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCSAKK |
| Ga0209167_100398923 | 3300027867 | Surface Soil | IEGEFIDFKRLSRQAPDGFDLRQPLVEVFGLCRRCRAKT |
| Ga0209579_105366902 | 3300027869 | Surface Soil | RCKSVQDITGDFVNFVDFKRLARQAPGGFDLSEPLIEVFGLCPRCSAKNSKTTS |
| Ga0209590_103478732 | 3300027882 | Vadose Zone Soil | EGDFINYKKLSRQAPRGFDLTQPLVEVFGLCRRCSAKT |
| Ga0209698_111987942 | 3300027911 | Watersheds | CKSVQDIEGDFVDFKRLARLAPGGFDLTQPLIEVFGLCRRCSAKS |
| Ga0302147_100689651 | 3300028566 | Bog | GKSVQDIEGEFVDFKRLSRHVPDGFDLTQPLIEVFGLCRRCSTKK |
| Ga0265336_101705772 | 3300028666 | Rhizosphere | VCSRCKSVQDIEGDFIDLKRLSRQLPDGFDLTQPLIEVFGLCRRCSVKK |
| Ga0302231_103754601 | 3300028775 | Palsa | VCSRCKSVQDIEGEFIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCRTKK |
| Ga0302189_104103601 | 3300028788 | Bog | RDIEGEFIDFNRLSQQLPGGFDLTQPLVEVFGLCRRCRART |
| Ga0302232_106059472 | 3300028789 | Palsa | KSVQDIEGEFIDFKRLSRLLPGGFDLTQPLIEVFGLCRRCSAKN |
| Ga0265338_101723982 | 3300028800 | Rhizosphere | CSRCKSVQDIEGDFIDLKRLSRQLPGGFDLTQPLIEVFGLCRRCSVKK |
| Ga0302216_10708422 | 3300028858 | Fen | KSVQDIKGEFIDFKRLFRQLPDGFDLTQPLIEVFGLCHSCRAPGSVRRSS |
| Ga0308309_101583862 | 3300028906 | Soil | EGEFIDFKRLSRHLPDGFDLTQPLVEVFGLCRRCSAKK |
| Ga0308309_101597041 | 3300028906 | Soil | GEFIDFKRLSQQVPDGFDVTQPLIEVFGLCRRCRAKN |
| Ga0311329_101941341 | 3300029907 | Bog | HYFTGDFIDFKRLARKAPGGFDLTEPLVEVFGLCRRCSDKA |
| Ga0302298_101869572 | 3300029980 | Fen | RCKSVQDIEGEFIDFKRLSRQLPAGFDLSQPLVEVFGLCRRCRTKT |
| Ga0311337_102332581 | 3300030000 | Fen | CKSVQDITGDFVDFKRLARQVPGGFDLSQPLIEVFGLCRRCSPKT |
| Ga0302270_105152162 | 3300030011 | Bog | IEGEFIDFNRLSQQLPGGFDLTQPLVEVFGLCRRCRART |
| Ga0302182_104673161 | 3300030054 | Palsa | FIDFKRLSRHVPDGFDLTQPLVEVFGLCRRCRTKK |
| Ga0302179_100190883 | 3300030058 | Palsa | SVQDIEGEFIDFKRLSRLLPGGFDLTQPLIEVFGLCRRCSAKN |
| Ga0302211_100240063 | 3300030491 | Fen | FIDFKRLSRQLPAGFDLSQPLVEVFGLCRRCRTKT |
| Ga0316363_101699531 | 3300030659 | Peatlands Soil | VVCSRCKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCSAKK |
| Ga0265459_138449422 | 3300030741 | Soil | VCSRCKSVQDIEEEFIAFNRLSRHLPEGFDLTQPLVEVFGLCRRCSAKK |
| Ga0308178_10926551 | 3300030990 | Soil | HLVCSRCKSVQDIEGEFVDFNRLSRQLPDGFDLTQPMIEVFGLCRRCSAKK |
| Ga0170822_121353613 | 3300031122 | Forest Soil | CSRCKSVQDIEGEFIDLKRLSRQLPDGFDLTQPLVEVFGLCRRCRTKT |
| Ga0170823_141049321 | 3300031128 | Forest Soil | LVCTRCKSVQDIEGDFINYKKLSQQAPRGFDLTQPLVDVFGLCRRCRAKT |
| Ga0170824_1286566552 | 3300031231 | Forest Soil | SRCKSVQDIEGEFIDFKRLSRHVPDGFDLTQPLVEVFGLCRRCRAKT |
| Ga0302297_10555542 | 3300031244 | Fen | QDIDGEFIDFKKLSRQLPDGFDLTQSLIEVFGLCRRCRAKK |
| Ga0265340_102541142 | 3300031247 | Rhizosphere | VCSRCKSVQDIEGDFIDFKRLSRQLPGGFDLTQPLIEVFGLCRSCSAKK |
| Ga0170820_125630201 | 3300031446 | Forest Soil | QDIADDFVDFKRLARQAPGGFDLSEAMVEVFGLCRRCSGKK |
| Ga0170819_124593461 | 3300031469 | Forest Soil | EGEFIDYKRLSRHAPDGFDLTQPLVEVFGLCRCCRAKT |
| Ga0170818_1073435841 | 3300031474 | Forest Soil | HPLVCSRCKSVQDIEGDIIDLKRLSRQLPDGFDLTQPMVEVFGLCRRCSAKK |
| Ga0170818_1151492581 | 3300031474 | Forest Soil | VQDIEGEFIDFKRLARHAPDGFDLTQPMIEVFGLCHRCRTKT |
| Ga0302326_101634071 | 3300031525 | Palsa | GEFIDFDRLSRQLPGGFDLTQPLIEVFGLCRRCSAKT |
| Ga0310686_1136429661 | 3300031708 | Soil | IEGEFIDFKRLSRQLPDGFDLTQPLVEVFGLCRRCRAKK |
| Ga0310686_1179175161 | 3300031708 | Soil | HLVCSRCKSVQDIEGEFIDFKRLSRQLPDGFDLTQPLIEVFGLCRRCSAKK |
| Ga0307476_107426532 | 3300031715 | Hardwood Forest Soil | GDFIDHKKLSRQAPRGFDLTRPLVEVFGLCRRCSAEK |
| Ga0307477_103413672 | 3300031753 | Hardwood Forest Soil | EGDFIDLKRLSRQLPVGFDLTQPLIEVFGLCRSCSAKK |
| Ga0307478_105766561 | 3300031823 | Hardwood Forest Soil | GEFIDFKRLSRQLPDGFNLTQPLIEVFGLCRRCSAKK |
| Ga0307478_118236892 | 3300031823 | Hardwood Forest Soil | KSVQDIEGEFIDFKRLSRQLPDGFDLTQPLVEVFGLCRRCRAKT |
| Ga0302315_101900801 | 3300031837 | Palsa | DIEGEFIDFKRLSRLLPGGFDLTQPLIEVFGLCRRCSAKN |
| Ga0311367_106289991 | 3300031918 | Fen | SRCKSVQDIDGEFIDFKKLSRQLPDGFDLTQSLIEVFGLCRRCRAKK |
| Ga0307479_109462762 | 3300031962 | Hardwood Forest Soil | EFIDYNRLSRHLPDGFDLTQPLIEVFGLCGRCNAKK |
| Ga0307479_113645752 | 3300031962 | Hardwood Forest Soil | CKSVQDIEGDFIDFKRLSRQLPGGFDLTQPLIEIFGLCRSCSAKT |
| Ga0306922_120150502 | 3300032001 | Soil | CSRCKTVQDIEGDFIDFKRLSPQVPDGFDLTQPVVEVFGLCHRCRSKTKS |
| Ga0348332_102127851 | 3300032515 | Plant Litter | LVCSRCKSVQDIEGEFIDFKRLSRQLPDGFDLTQSLIEVFGLCRRCSAKK |
| Ga0335074_108319851 | 3300032895 | Soil | VQDIEGDFVNFKKLSRQAPRGFDLTQPLVEVFGLCRRCSTQR |
| Ga0310810_103794841 | 3300033412 | Soil | RCKSVQDIEGEFIDFKRLSRQLPAGFDLRQPLIEVFGLCRRCSAKK |
| Ga0310811_109160551 | 3300033475 | Soil | HLVCSRCKSVQDIEGEFVDFDRLSRQLPDGFDLSQPLIEVFGLCRRCRSKT |
| Ga0334827_175365_22_150 | 3300034065 | Soil | VRDIEGEFIDFKRLSRHVPDGFDLTQPLIEVFGLCGRCSAKK |
| Ga0326723_0387759_500_628 | 3300034090 | Peat Soil | VQDIEGEFIDFNRLSRQLPGGFDLTQPLIEVFGLCRRCSAKT |
| ⦗Top⦘ |