Metagenome Family F019438

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F019438
Family Type	Metagenome
Number of Sequences	229
Average Sequence Length	40 residues
Representative Sequence	METILTTILLGGIGFIVCGLVLVGLMHLWFWMDENERGDR
Number of Associated Samples	107
Number of Associated Scaffolds	229

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	86.46 %
% of genes near scaffold ends (potentially truncated)	13.10 %
% of genes from short scaffolds (< 2000 bps)	73.80 %
Associated GOLD sequencing projects	99
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (46.725 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (39.301 % of family members)
Environment Ontology (ENVO)	Unclassified (79.913 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (83.406 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.58
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 229 Family Scaffolds
PF00476	DNA_pol_A	3.93
PF01612	DNA_pol_A_exo1	2.62
PF13203	DUF2201_N	2.62
PF12705	PDDEXK_1	2.62
PF11753	DUF3310	2.18
PF12651	RHH_3	2.18
PF09967	DUF2201	1.31
PF06827	zf-FPG_IleRS	1.31
PF08774	VRR_NUC	0.87
PF02796	HTH_7	0.87
PF13662	Toprim_4	0.44
PF10263	SprT-like	0.44
PF13884	Peptidase_S74	0.44
PF00166	Cpn10	0.44
PF04389	Peptidase_M28	0.44
PF06378	DUF1071	0.44

COG ID	Name	Functional Category	% Frequency in 229 Family Scaffolds
COG0749	DNA polymerase I, 3'-5' exonuclease and polymerase domains	Replication, recombination and repair [L]	3.93
COG0234	Co-chaperonin GroES (HSP10)	Posttranslational modification, protein turnover, chaperones [O]	0.44

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	53.28 %
Unclassified	root	N/A	46.72 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	51.53 %
Unclassified	root	N/A	46.72 %
cellular organisms	root	All Organisms → cellular organisms	1.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	33.19 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	17.03 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.75 %
unclassified viruses	clade	All Organisms → Viruses → unclassified viruses	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	33.19 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	17.03 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.75 %
unclassified DNA viruses	no rank	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	33.19 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	17.03 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.31 %
unclassified dsDNA viruses	no rank	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses	0.44 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	33.19 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	17.03 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.31 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.44 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	33.19 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	16.16 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.44 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.44 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.44 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.44 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	33.19 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16.16 %
Escherichia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia	0.44 %
Candidimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Candidimonas	0.44 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.44 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.44 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	33.19 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16.16 %
Candidimonas nitroreducens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Candidimonas → Candidimonas nitroreducens	0.44 %
Burkholderia gladioli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia gladioli	0.44 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.44 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.44 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.44 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002408\|B570J29032_109936919	All Organisms → Viruses → Predicted Viral	3414	Open in IMG/M
3300003499\|JGI25930J51415_1000434	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9392	Open in IMG/M
3300005517\|Ga0070374_10406736	Not Available	684	Open in IMG/M
3300005527\|Ga0068876_10036876	All Organisms → Viruses → Predicted Viral	3027	Open in IMG/M
3300005581\|Ga0049081_10010111	All Organisms → Viruses → Predicted Viral	3576	Open in IMG/M
3300005581\|Ga0049081_10022713	All Organisms → Viruses → Predicted Viral	2382	Open in IMG/M
3300005581\|Ga0049081_10081259	All Organisms → Viruses → Predicted Viral	1216	Open in IMG/M
3300005581\|Ga0049081_10088335	Not Available	1160	Open in IMG/M
3300005581\|Ga0049081_10104317	All Organisms → Viruses → Predicted Viral	1056	Open in IMG/M
3300005581\|Ga0049081_10142411	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	881	Open in IMG/M
3300005581\|Ga0049081_10218957	Not Available	677	Open in IMG/M
3300005581\|Ga0049081_10266457	Not Available	597	Open in IMG/M
3300005581\|Ga0049081_10315085	Not Available	536	Open in IMG/M
3300005582\|Ga0049080_10258554	Not Available	567	Open in IMG/M
3300005582\|Ga0049080_10311266	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	507	Open in IMG/M
3300005583\|Ga0049085_10210147	Not Available	645	Open in IMG/M
3300005584\|Ga0049082_10198812	Not Available	687	Open in IMG/M
3300007544\|Ga0102861_1000225	Not Available	14371	Open in IMG/M
3300007544\|Ga0102861_1000555	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8081	Open in IMG/M
3300007973\|Ga0105746_1084029	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1033	Open in IMG/M
3300007973\|Ga0105746_1088933	All Organisms → Viruses → Predicted Viral	1005	Open in IMG/M
3300007973\|Ga0105746_1221869	Not Available	648	Open in IMG/M
3300007974\|Ga0105747_1084893	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	974	Open in IMG/M
3300008055\|Ga0108970_10720441	Not Available	704	Open in IMG/M
3300008107\|Ga0114340_1021758	All Organisms → Viruses → Predicted Viral	4909	Open in IMG/M
3300008107\|Ga0114340_1044982	All Organisms → Viruses → Predicted Viral	3143	Open in IMG/M
3300008107\|Ga0114340_1073707	All Organisms → Viruses → Predicted Viral	2498	Open in IMG/M
3300008113\|Ga0114346_1333973	Not Available	502	Open in IMG/M
3300008119\|Ga0114354_1001907	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	19472	Open in IMG/M
3300008119\|Ga0114354_1002906	All Organisms → Viruses	12933	Open in IMG/M
3300008119\|Ga0114354_1005600	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7675	Open in IMG/M
3300008119\|Ga0114354_1188503	Not Available	729	Open in IMG/M
3300008266\|Ga0114363_1174632	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	688	Open in IMG/M
3300008267\|Ga0114364_1014509	All Organisms → Viruses → Predicted Viral	3463	Open in IMG/M
3300008267\|Ga0114364_1155869	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	621	Open in IMG/M
3300008448\|Ga0114876_1104404	All Organisms → Viruses → Predicted Viral	1121	Open in IMG/M
3300008448\|Ga0114876_1128856	Not Available	957	Open in IMG/M
3300008448\|Ga0114876_1173507	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	760	Open in IMG/M
3300008448\|Ga0114876_1206508	Not Available	657	Open in IMG/M
3300008450\|Ga0114880_1122856	Not Available	973	Open in IMG/M
3300009068\|Ga0114973_10002790	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	12541	Open in IMG/M
3300009151\|Ga0114962_10066614	Not Available	2318	Open in IMG/M
3300009151\|Ga0114962_10098215	All Organisms → Viruses → Predicted Viral	1827	Open in IMG/M
3300009151\|Ga0114962_10450436	Not Available	688	Open in IMG/M
3300009151\|Ga0114962_10586382	Not Available	580	Open in IMG/M
3300009152\|Ga0114980_10276408	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	978	Open in IMG/M
3300009152\|Ga0114980_10338730	Not Available	869	Open in IMG/M
3300009152\|Ga0114980_10476152	Not Available	712	Open in IMG/M
3300009154\|Ga0114963_10014669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Candidimonas → Candidimonas nitroreducens	5277	Open in IMG/M
3300009154\|Ga0114963_10454399	Not Available	687	Open in IMG/M
3300009154\|Ga0114963_10520382	Not Available	631	Open in IMG/M
3300009158\|Ga0114977_10595890	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	596	Open in IMG/M
3300009158\|Ga0114977_10770289	Not Available	508	Open in IMG/M
3300009159\|Ga0114978_10065984	Not Available	2445	Open in IMG/M
3300009159\|Ga0114978_10193767	All Organisms → Viruses → Predicted Viral	1287	Open in IMG/M
3300009159\|Ga0114978_10542838	Not Available	678	Open in IMG/M
3300009159\|Ga0114978_10609880	Not Available	630	Open in IMG/M
3300009160\|Ga0114981_10265922	Not Available	933	Open in IMG/M
3300009163\|Ga0114970_10631974	Not Available	574	Open in IMG/M
3300009164\|Ga0114975_10091892	Not Available	1760	Open in IMG/M
3300009164\|Ga0114975_10654710	Not Available	557	Open in IMG/M
3300009180\|Ga0114979_10284515	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	985	Open in IMG/M
3300009183\|Ga0114974_10586326	Not Available	616	Open in IMG/M
3300009194\|Ga0114983_1091422	Not Available	677	Open in IMG/M
3300009419\|Ga0114982_1001663	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10425	Open in IMG/M
3300010157\|Ga0114964_10104293	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1405	Open in IMG/M
3300010158\|Ga0114960_10137421	All Organisms → Viruses → Predicted Viral	1325	Open in IMG/M
3300010160\|Ga0114967_10163606	Not Available	1226	Open in IMG/M
3300010334\|Ga0136644_10186664	All Organisms → Viruses → Predicted Viral	1244	Open in IMG/M
3300010334\|Ga0136644_10194504	All Organisms → Viruses → Predicted Viral	1213	Open in IMG/M
3300010334\|Ga0136644_10197226	Not Available	1203	Open in IMG/M
3300010885\|Ga0133913_10314984	All Organisms → Viruses → Predicted Viral	4144	Open in IMG/M
3300010885\|Ga0133913_11036995	All Organisms → Viruses → Predicted Viral	2118	Open in IMG/M
3300010885\|Ga0133913_11284670	All Organisms → Viruses → Predicted Viral	1870	Open in IMG/M
3300010885\|Ga0133913_11349433	All Organisms → Viruses → Predicted Viral	1818	Open in IMG/M
3300011010\|Ga0139557_1037017	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	851	Open in IMG/M
3300011116\|Ga0151516_10503	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19115	Open in IMG/M
3300011335\|Ga0153698_1281	Not Available	22654	Open in IMG/M
3300011335\|Ga0153698_1930	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10324	Open in IMG/M
3300012012\|Ga0153799_1013527	All Organisms → Viruses → Predicted Viral	1740	Open in IMG/M
3300014811\|Ga0119960_1027552	Not Available	798	Open in IMG/M
3300014811\|Ga0119960_1067582	Not Available	623	Open in IMG/M
3300015050\|Ga0181338_1000486	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7699	Open in IMG/M
3300015050\|Ga0181338_1003519	All Organisms → Viruses → Predicted Viral	2717	Open in IMG/M
3300015050\|Ga0181338_1006105	Not Available	2035	Open in IMG/M
3300015050\|Ga0181338_1008251	Not Available	1739	Open in IMG/M
3300015050\|Ga0181338_1023307	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	962	Open in IMG/M
3300015050\|Ga0181338_1028487	Not Available	855	Open in IMG/M
3300017700\|Ga0181339_1008708	All Organisms → Viruses → Predicted Viral	1214	Open in IMG/M
3300017700\|Ga0181339_1037214	Not Available	530	Open in IMG/M
3300017707\|Ga0181363_1017681	All Organisms → Viruses → Predicted Viral	1415	Open in IMG/M
3300017707\|Ga0181363_1022493	All Organisms → Viruses → Predicted Viral	1228	Open in IMG/M
3300017707\|Ga0181363_1064932	Not Available	637	Open in IMG/M
3300017716\|Ga0181350_1086697	Not Available	786	Open in IMG/M
3300017716\|Ga0181350_1120663	Not Available	629	Open in IMG/M
3300017722\|Ga0181347_1076308	Not Available	983	Open in IMG/M
3300017723\|Ga0181362_1032231	All Organisms → Viruses → Predicted Viral	1115	Open in IMG/M
3300017723\|Ga0181362_1090388	Not Available	613	Open in IMG/M
3300017736\|Ga0181365_1020179	All Organisms → Viruses → Predicted Viral	1679	Open in IMG/M
3300017736\|Ga0181365_1092610	Not Available	735	Open in IMG/M
3300017736\|Ga0181365_1171416	Not Available	509	Open in IMG/M
3300017747\|Ga0181352_1005496	All Organisms → Viruses → Predicted Viral	4307	Open in IMG/M
3300017747\|Ga0181352_1010670	All Organisms → Viruses → Predicted Viral	2975	Open in IMG/M
3300017747\|Ga0181352_1034109	All Organisms → Viruses → Predicted Viral	1527	Open in IMG/M
3300017747\|Ga0181352_1051484	All Organisms → Viruses → Predicted Viral	1197	Open in IMG/M
3300017747\|Ga0181352_1175586	Not Available	558	Open in IMG/M
3300017747\|Ga0181352_1201013	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	512	Open in IMG/M
3300017754\|Ga0181344_1003002	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5906	Open in IMG/M
3300017754\|Ga0181344_1011922	All Organisms → Viruses → Predicted Viral	2776	Open in IMG/M
3300017754\|Ga0181344_1012925	All Organisms → Viruses → Predicted Viral	2657	Open in IMG/M
3300017754\|Ga0181344_1079242	Not Available	964	Open in IMG/M
3300017754\|Ga0181344_1081488	Not Available	949	Open in IMG/M
3300017754\|Ga0181344_1116032	Not Available	773	Open in IMG/M
3300017754\|Ga0181344_1157809	Not Available	646	Open in IMG/M
3300017761\|Ga0181356_1029203	Not Available	1983	Open in IMG/M
3300017761\|Ga0181356_1060399	All Organisms → Viruses → Predicted Viral	1290	Open in IMG/M
3300017761\|Ga0181356_1102356	Not Available	931	Open in IMG/M
3300017774\|Ga0181358_1006808	All Organisms → Viruses → Predicted Viral	4835	Open in IMG/M
3300017777\|Ga0181357_1092743	Not Available	1149	Open in IMG/M
3300017777\|Ga0181357_1113275	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1022	Open in IMG/M
3300017777\|Ga0181357_1147193	Not Available	870	Open in IMG/M
3300017777\|Ga0181357_1188253	Not Available	743	Open in IMG/M
3300017777\|Ga0181357_1209448	Not Available	692	Open in IMG/M
3300017777\|Ga0181357_1269119	Not Available	587	Open in IMG/M
3300017780\|Ga0181346_1120119	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1007	Open in IMG/M
3300017780\|Ga0181346_1166593	Not Available	815	Open in IMG/M
3300017780\|Ga0181346_1185493	Not Available	759	Open in IMG/M
3300017780\|Ga0181346_1212179	Not Available	693	Open in IMG/M
3300017780\|Ga0181346_1242889	Not Available	632	Open in IMG/M
3300017780\|Ga0181346_1312778	Not Available	530	Open in IMG/M
3300017780\|Ga0181346_1313915	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	528	Open in IMG/M
3300017784\|Ga0181348_1316643	Not Available	518	Open in IMG/M
3300017785\|Ga0181355_1065332	All Organisms → Viruses → Predicted Viral	1533	Open in IMG/M
3300017785\|Ga0181355_1276984	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	637	Open in IMG/M
3300018041\|Ga0181601_10079729	All Organisms → Viruses → Predicted Viral	2185	Open in IMG/M
3300019781\|Ga0181360_112756	Not Available	696	Open in IMG/M
3300019783\|Ga0181361_107637	Not Available	836	Open in IMG/M
3300019784\|Ga0181359_1009626	All Organisms → Viruses → Predicted Viral	3395	Open in IMG/M
3300019784\|Ga0181359_1026172	All Organisms → Viruses → Predicted Viral	2236	Open in IMG/M
3300019784\|Ga0181359_1031200	All Organisms → Viruses → Predicted Viral	2058	Open in IMG/M
3300019784\|Ga0181359_1037500	All Organisms → Viruses → Predicted Viral	1877	Open in IMG/M
3300019784\|Ga0181359_1040079	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1814	Open in IMG/M
3300019784\|Ga0181359_1042623	All Organisms → Viruses → Predicted Viral	1758	Open in IMG/M
3300019784\|Ga0181359_1072382	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1304	Open in IMG/M
3300019784\|Ga0181359_1082169	All Organisms → Viruses → Predicted Viral	1205	Open in IMG/M
3300019784\|Ga0181359_1091228	All Organisms → Viruses → Predicted Viral	1129	Open in IMG/M
3300019784\|Ga0181359_1094458	Not Available	1105	Open in IMG/M
3300019784\|Ga0181359_1101386	All Organisms → Viruses → Predicted Viral	1055	Open in IMG/M
3300019784\|Ga0181359_1127832	Not Available	900	Open in IMG/M
3300019784\|Ga0181359_1130474	Not Available	887	Open in IMG/M
3300019784\|Ga0181359_1136214	Not Available	860	Open in IMG/M
3300019784\|Ga0181359_1151789	Not Available	793	Open in IMG/M
3300019784\|Ga0181359_1216581	Not Available	605	Open in IMG/M
3300019784\|Ga0181359_1236845	Not Available	563	Open in IMG/M
3300020161\|Ga0211726_10354278	All Organisms → Viruses → Predicted Viral	2322	Open in IMG/M
3300020172\|Ga0211729_10716363	Not Available	587	Open in IMG/M
3300020188\|Ga0181605_10251572	Not Available	766	Open in IMG/M
3300020205\|Ga0211731_11601713	Not Available	519	Open in IMG/M
3300020205\|Ga0211731_11700016	Not Available	815	Open in IMG/M
3300020498\|Ga0208050_1001788	All Organisms → Viruses → Predicted Viral	2963	Open in IMG/M
3300020517\|Ga0208854_1046857	Not Available	523	Open in IMG/M
3300021961\|Ga0222714_10228174	All Organisms → Viruses → Predicted Viral	1058	Open in IMG/M
3300021963\|Ga0222712_10083268	All Organisms → Viruses → Predicted Viral	2281	Open in IMG/M
3300021963\|Ga0222712_10269486	Not Available	1081	Open in IMG/M
3300022179\|Ga0181353_1006011	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2895	Open in IMG/M
3300022179\|Ga0181353_1018055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia gladioli	1839	Open in IMG/M
3300022179\|Ga0181353_1022232	All Organisms → Viruses → Predicted Viral	1671	Open in IMG/M
3300022179\|Ga0181353_1089122	Not Available	770	Open in IMG/M
3300022179\|Ga0181353_1137448	Not Available	572	Open in IMG/M
3300022190\|Ga0181354_1054122	All Organisms → Viruses → Predicted Viral	1335	Open in IMG/M
3300022407\|Ga0181351_1009953	All Organisms → Viruses → Predicted Viral	3834	Open in IMG/M
3300022407\|Ga0181351_1047600	All Organisms → Viruses → Predicted Viral	1798	Open in IMG/M
3300022407\|Ga0181351_1096079	All Organisms → Viruses → Predicted Viral	1153	Open in IMG/M
3300022407\|Ga0181351_1133426	Not Available	915	Open in IMG/M
3300022407\|Ga0181351_1258253	Not Available	537	Open in IMG/M
3300022752\|Ga0214917_10015534	Not Available	6601	Open in IMG/M
3300023174\|Ga0214921_10002258	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	31562	Open in IMG/M
3300023174\|Ga0214921_10005165	Not Available	18608	Open in IMG/M
3300023179\|Ga0214923_10119552	All Organisms → Viruses → Predicted Viral	1723	Open in IMG/M
3300023184\|Ga0214919_10440023	Not Available	828	Open in IMG/M
3300025075\|Ga0209615_107051	Not Available	630	Open in IMG/M
3300027210\|Ga0208802_1039608	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	644	Open in IMG/M
3300027608\|Ga0208974_1012616	All Organisms → Viruses → Predicted Viral	2717	Open in IMG/M
3300027608\|Ga0208974_1092688	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	814	Open in IMG/M
3300027656\|Ga0209357_1184016	Not Available	539	Open in IMG/M
3300027659\|Ga0208975_1043179	All Organisms → Viruses → Predicted Viral	1403	Open in IMG/M
3300027659\|Ga0208975_1153429	Not Available	641	Open in IMG/M
3300027659\|Ga0208975_1168991	Not Available	600	Open in IMG/M
3300027659\|Ga0208975_1217309	Not Available	504	Open in IMG/M
3300027708\|Ga0209188_1265279	Not Available	586	Open in IMG/M
3300027733\|Ga0209297_1001638	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	12940	Open in IMG/M
3300027733\|Ga0209297_1001989	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	11576	Open in IMG/M
3300027734\|Ga0209087_1000050	Not Available	63726	Open in IMG/M
3300027734\|Ga0209087_1012623	All Organisms → Viruses → Predicted Viral	4280	Open in IMG/M
3300027734\|Ga0209087_1068792	Not Available	1564	Open in IMG/M
3300027736\|Ga0209190_1000073	Not Available	65310	Open in IMG/M
3300027741\|Ga0209085_1008819	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5120	Open in IMG/M
3300027749\|Ga0209084_1040493	All Organisms → Viruses → Predicted Viral	2314	Open in IMG/M
3300027749\|Ga0209084_1048320	All Organisms → Viruses → Predicted Viral	2062	Open in IMG/M
3300027782\|Ga0209500_10015417	Not Available	4570	Open in IMG/M
3300027782\|Ga0209500_10068625	All Organisms → Viruses → Predicted Viral	1831	Open in IMG/M
3300027782\|Ga0209500_10099739	All Organisms → Viruses → Predicted Viral	1440	Open in IMG/M
3300027785\|Ga0209246_10293090	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	625	Open in IMG/M
3300027804\|Ga0209358_10177935	All Organisms → Viruses → Predicted Viral	1117	Open in IMG/M
3300027808\|Ga0209354_10151703	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	945	Open in IMG/M
3300027892\|Ga0209550_10647073	Not Available	615	Open in IMG/M
3300028025\|Ga0247723_1011284	All Organisms → Viruses → Predicted Viral	3430	Open in IMG/M
3300031786\|Ga0315908_10391961	All Organisms → Viruses → Predicted Viral	1162	Open in IMG/M
3300031786\|Ga0315908_10660291	Not Available	864	Open in IMG/M
3300031787\|Ga0315900_10361909	All Organisms → Viruses → Predicted Viral	1165	Open in IMG/M
3300031857\|Ga0315909_10149292	All Organisms → Viruses → Predicted Viral	1928	Open in IMG/M
3300031857\|Ga0315909_10379119	All Organisms → Viruses → Predicted Viral	1022	Open in IMG/M
3300031857\|Ga0315909_10536506	Not Available	798	Open in IMG/M
3300031857\|Ga0315909_10881983	Not Available	554	Open in IMG/M
3300031951\|Ga0315904_11070597	Not Available	632	Open in IMG/M
3300031963\|Ga0315901_10404555	All Organisms → Viruses → Predicted Viral	1093	Open in IMG/M
3300031963\|Ga0315901_10905450	Not Available	627	Open in IMG/M
3300031999\|Ga0315274_11052781	Not Available	825	Open in IMG/M
3300032053\|Ga0315284_10537908	All Organisms → Viruses → Predicted Viral	1409	Open in IMG/M
3300032092\|Ga0315905_11476521	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	535	Open in IMG/M
3300033992\|Ga0334992_0005211	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9317	Open in IMG/M
3300033996\|Ga0334979_0002056	All Organisms → Viruses	14715	Open in IMG/M
3300034062\|Ga0334995_0147764	All Organisms → Viruses → Predicted Viral	1701	Open in IMG/M
3300034062\|Ga0334995_0230967	All Organisms → Viruses → Predicted Viral	1261	Open in IMG/M
3300034062\|Ga0334995_0748093	Not Available	543	Open in IMG/M
3300034092\|Ga0335010_0433819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	709	Open in IMG/M
3300034106\|Ga0335036_0068886	All Organisms → Viruses → Predicted Viral	2657	Open in IMG/M
3300034106\|Ga0335036_0104657	All Organisms → Viruses → Predicted Viral	2073	Open in IMG/M
3300034110\|Ga0335055_0078857	All Organisms → Viruses → Predicted Viral	1512	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.56%
Host-Associated	Host-Associated	0.44%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.25%
Terrestrial	Environmental → Terrestrial	1.31%
Plants	Host-Associated → Plants	0.44%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	93.01%
Marine	Environmental → Aquatic → Marine	5.24%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.31%
Leaf	Host-Associated → Plants → Leaf	0.44%

Habitat	Taxonomy	Distribution
Lentic	Environmental → Aquatic → Freshwater → Lentic	48.91%
Lake	Environmental → Aquatic → Freshwater → Lake	36.68%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	6.11%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	2.18%
Coastal	Environmental → Aquatic → Marine → Coastal	1.75%
Unclassified	Environmental → Aquatic → Marine → Unclassified	1.31%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.31%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.87%
Ice	Environmental → Aquatic → Freshwater → Ice	0.44%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.44%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	48.03%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	35.81%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	6.11%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.75%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.31%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	1.31%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.31%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.87%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.87%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.87%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.87%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.44%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.44%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	39.30%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	20.09%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	8.30%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	6.11%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	4.80%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	4.80%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	2.62%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.18%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	1.75%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.31%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.31%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.87%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.87%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.87%
Aquatic	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic	0.87%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.87%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.87%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.44%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.44%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater	0.44%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.44%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.44%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300003499	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300007544	Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3	Environmental	Open in IMG/M
3300007973	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008119	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009154	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009194	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300010158	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010334	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011010	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice	Environmental	Open in IMG/M
3300011116	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov	Environmental	Open in IMG/M
3300011335	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300014811	Aquatic viral communities from ballast water - Michigan State University - AB_ballast water	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017700	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D	Environmental	Open in IMG/M
3300017707	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300018041	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)	Environmental	Open in IMG/M
3300019781	Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D	Environmental	Open in IMG/M
3300019783	Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020188	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly)	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020498	Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020517	Freshwater microbial communities from Lake Mendota, WI - 30NOV2011 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300023179	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300025075	Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes)	Environmental	Open in IMG/M
3300027210	Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027656	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027741	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027804	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental	Open in IMG/M
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300031786	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034110	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J29032_1099369195	3300002408	Freshwater	METIATTIILGFIGVVVAGLVLVALMHLWFWMDENERGDR*
JGI25930J51415_100043418	3300003499	Freshwater Lake	METILTTILLGGIGFIVCGLVFVGLMHLWFWMDEKDRRDR*
Ga0070374_104067361	3300005517	Freshwater Lake	TATIIILGFIGVVVAGLVLVALMHLWFWMDEQERNDR*
Ga0068876_100368769	3300005527	Freshwater Lake	METIVTTILLGGLGFIVCGLVLVGLMHLWFWMDENERGDR*
Ga0049081_100101117	3300005581	Freshwater Lentic	METILATIILGGVGFIVCGLVFIGLMHLWFWMDENERGGR*
Ga0049081_100227136	3300005581	Freshwater Lentic	METILVTILLGFIGMVIAGFVLVALMHLWFWMDENERGDR*
Ga0049081_100812593	3300005581	Freshwater Lentic	METIATTILLGFIGVVVAGLVLIALMHLWFWMDEDERRDR*
Ga0049081_100883352	3300005581	Freshwater Lentic	METIATTIILGFIGVVVAGLVLVALMRLWFWMDEQERNDR*
Ga0049081_101043175	3300005581	Freshwater Lentic	METIATTIILGGIGFIVCGLVFVGLMHLWFWMDEEDRRDR*
Ga0049081_101424115	3300005581	Freshwater Lentic	TTILLGFIGVVVAGLVLIALMRLWFWMDEQERNDR*
Ga0049081_102189574	3300005581	Freshwater Lentic	METIATAIILGFIGVVVAGLVLVALMRLWFWMDENERGDR*
Ga0049081_102664572	3300005581	Freshwater Lentic	MMETIVTTILLGGLGFIVCGLVLVGLMHLWFWMDENERGDR*
Ga0049081_103150852	3300005581	Freshwater Lentic	METIATTILLGFIGVVVAGLVLVALMRLWFWMDEQERNDR*
Ga0049080_102585542	3300005582	Freshwater Lentic	MTETIVATILLGGLGILIAGLILIALMKLWFWMDEQERNDR*
Ga0049080_103112662	3300005582	Freshwater Lentic	METIATTIILGFIGVVVAGLVLVALMRLWFWMDENERGDR*
Ga0049085_102101471	3300005583	Freshwater Lentic	METIATTILLGFIGVVVAGLVLVALMRLWFWMDENERGDR*
Ga0049082_101988122	3300005584	Freshwater Lentic	METITTTILLGFIGVVVAGLVLVALMRLWFWMDEQERNDR*
Ga0102861_100022516	3300007544	Estuarine	MTETIVATILLGGLGMIVAGLVLIGLMKLWFWMDEQERNDR*
Ga0102861_100055518	3300007544	Estuarine	METIATTILLGFIGVVVAGLVLVALMRLWFWMDEEDRRDR*
Ga0105746_10840295	3300007973	Estuary Water	METVLTTIILGGIGFIVCGLVFIGLMHLWFWMDENERGNK*
Ga0105746_10889332	3300007973	Estuary Water	MMETIATTIILGFIGVVVAGLVLIALMRLWFWMDEDERGDR*
Ga0105746_12218692	3300007973	Estuary Water	MMETITTTILLGFIGVVVAVLVLVALMHLWLWMDENERGDR*
Ga0105747_10848933	3300007974	Estuary Water	MMETILTTILLGGLGFIVCGLVFVGLMHLWFWMDENERGDR*
Ga0108970_107204412	3300008055	Estuary	METVLTTIILGGIGFIVCGLVFIGLMHLWFWMDENERGDR*
Ga0114340_10217589	3300008107	Freshwater, Plankton	MMETILATILLGGIGFIVCGLVFIGLMHLWFWMDENERNEK*
Ga0114340_104498213	3300008107	Freshwater, Plankton	MMETIVTTIILGFIGVSVAGLVLIGLMKLWFWMDENERGNR*
Ga0114340_10737074	3300008107	Freshwater, Plankton	MMETILATILLGGIGFIVCGLVFIGLMHLWFWMDENERGDR*
Ga0114346_13339732	3300008113	Freshwater, Plankton	METVLTTIILGGIGFIVCGLVLVALMRLWFWMDENERGDR*
Ga0114354_100190714	3300008119	Freshwater, Plankton	MMETIATTIILGFIGVVVAGLVLVGLMHLWFWMDENERGDR*
Ga0114354_100290621	3300008119	Freshwater, Plankton	MMETILATILLGGIGFIVCGLVFIGLMHLWFWMDENERGGR*
Ga0114354_10056009	3300008119	Freshwater, Plankton	MMETIVVTILLGGIGFIVCGFVLIGLMHLWFWMDENERGDR*
Ga0114354_11885033	3300008119	Freshwater, Plankton	MMETIATTILLGFIGVVVAGLVVIGLMHLWFWMDENERGDR*
Ga0114363_11746322	3300008266	Freshwater, Plankton	METITTMILLGFIGVVVAGLVLVALMRLWFWMDENERGDR*
Ga0114364_10145098	3300008267	Freshwater, Plankton	MMETILTTIILGGIGFIVCGLVFVGLMHLWFWMDENERGDR*
Ga0114364_11558692	3300008267	Freshwater, Plankton	MMETIVTTILLGFIGVAVAGLVLVALMRLWFWMDEEDRRDR*
Ga0114876_11044045	3300008448	Freshwater Lake	MMETILATILLGGLGFIVCGIVFVALMHLWFWMDENERGDR*
Ga0114876_11288561	3300008448	Freshwater Lake	GMMETIVTTILLGGLGFIVCGLVLVGLMHLWFWMDENERGDR*
Ga0114876_11735073	3300008448	Freshwater Lake	METILTTIILGGIGFIVCGLVFVGLMHLWFWMDENERGDR*
Ga0114876_12065081	3300008448	Freshwater Lake	ETVLTTIILGGIGFIVCGLVFVGLMHLWFWMDENERGDR*
Ga0114880_11228562	3300008450	Freshwater Lake	MMETILATILLGGIGFIVCGLVFIGLMHLWFWMDEHERGGR*
Ga0114973_1000279010	3300009068	Freshwater Lake	MMETIATTILLGGLGFIVCGLVLIGLMRLWFWMDENERGDR*
Ga0114962_100666143	3300009151	Freshwater Lake	METIATTILLGGLGFIVCGLVLIGLMHLWFWMDEQERKDR*
Ga0114962_100982152	3300009151	Freshwater Lake	MMETIVATILLGGIGFIVCGLVFVGLMHLWFWMDENERRDR*
Ga0114962_104504361	3300009151	Freshwater Lake	MMETITTTILLGFIGVVVAGLVLVALMRLWFWMDEEDRRDR*
Ga0114962_105863822	3300009151	Freshwater Lake	MMETIATTIILGFIGVVVAGLVLVALMRLWFWMDEEDRRGR*
Ga0114980_102764085	3300009152	Freshwater Lake	METILTTIILGGIGFIVCGLVFIGLMHLWFWMDENERGDR*
Ga0114980_103387303	3300009152	Freshwater Lake	MMETILATIILGGLGFIVCGLVFVGLMHLWFWMDENERGDR*
Ga0114980_104761521	3300009152	Freshwater Lake	VRGGVMETILTTIILGGIGFIVCGLVFIGLMHLWFWMDENERGDR*
Ga0114963_100146696	3300009154	Freshwater Lake	METIATTIILGGLGFIVCGLVLIGLMHLWFWMDENERGDR*
Ga0114963_104543993	3300009154	Freshwater Lake	VETIVATILLGGLGFIVCGLVLIGLMHLWFWMDENERGDR*
Ga0114963_105203824	3300009154	Freshwater Lake	MMETIATTILLGGLGFIVCGLVLIGLMHLWFWMDEQ
Ga0114977_105958902	3300009158	Freshwater Lake	METILATILLGGIGFIVCGLVFVGLMHLWFWMDEEDRRDR*
Ga0114977_107702891	3300009158	Freshwater Lake	RGGVMETIFTTILLGFIGVVVAGLVLVALMRLWFWMDENERRDR*
Ga0114978_100659845	3300009159	Freshwater Lake	METILATIILGFIGFMVGGLVFFGLVHLWFWMDENERGDR*
Ga0114978_101937673	3300009159	Freshwater Lake	MTETIATTIILGFIGVVVAGLVLVALMRLWFWMDEQERNDR*
Ga0114978_105428383	3300009159	Freshwater Lake	METIFTTILLGFIGVVVAGLVLVALMHLWFWMDENERGDR*
Ga0114978_106098802	3300009159	Freshwater Lake	MMETILATILLGGIGFIVCGLVFVGLMHLWFWMDENERGDR*
Ga0114981_102659222	3300009160	Freshwater Lake	METIATAILLGFIGVVVAGLVLVALMHLWFWMDENERGDR*
Ga0114970_106319742	3300009163	Freshwater Lake	MMETILATILLGGIGFIVCGLVFVGLMHLWFWMDENERRDR*
Ga0114975_100918924	3300009164	Freshwater Lake	METIFTTILLGFIGVVVAGLVLVALMRLWFWMDENERRDR*
Ga0114975_106547102	3300009164	Freshwater Lake	MMETIATTIILGFIGFMVGGLVFFGLVHLWFWMDEEDRRDR*
Ga0114979_102845153	3300009180	Freshwater Lake	MMETIFAVILLGGVGFIVAGLVLIALMKMWFWMDENERNNR*
Ga0114974_105863263	3300009183	Freshwater Lake	MMETIATTIILGGLGFIVCGLVLIGLMRLWFWMDENERGDR*
Ga0114983_10914222	3300009194	Deep Subsurface	METIVVTILLGVIGFMEGGFVFIGLMHLWFWMDENERNDR*
Ga0114982_100166318	3300009419	Deep Subsurface	MMETILATIILGGVGFIVCGLVFVGLMHLWFWMDENERGDR*
Ga0114964_101042932	3300010157	Freshwater Lake	METIATTIILGGLGFIVCGLVLVALMRLWFWMDENERGDR*
Ga0114960_101374214	3300010158	Freshwater Lake	METIATTIILGGLGFIVCGLVFVGLMHLWFWMDENERRDR*
Ga0114967_101636066	3300010160	Freshwater Lake	MMETIATTIILGFIGFMVGGLVFFGLVHLWFWMDENERGDR*
Ga0136644_101866641	3300010334	Freshwater Lake	ATTIILGGLGFIVCGLVLIGLMHLWFWMDENERGDR*
Ga0136644_101945042	3300010334	Freshwater Lake	MMETIVATILLGGIVFMVCGLVFVGLMHLWFWMDENERRDR*
Ga0136644_101972261	3300010334	Freshwater Lake	METIATTIILGGLGFIVCGLVLVALMRLWFWMDEQERKDR*
Ga0133913_103149842	3300010885	Freshwater Lake	METIATTILLGGLGFIVCGLVLIGLMRLWFWMDENERGDR*
Ga0133913_110369952	3300010885	Freshwater Lake	METVATAIILGFIGVVVAGLVLVALMRLWFWMDENERGDR*
Ga0133913_112846705	3300010885	Freshwater Lake	MMETILTTIILGGVGFIVCGLVFVGLMHLWFWMDERGDR*
Ga0133913_113494338	3300010885	Freshwater Lake	METIATTIILGGIGFIVCGLVLIGLMHLWFWMDENERNEK*
Ga0139557_10370172	3300011010	Freshwater	MMETIATTIILGFIGVVVAGLVLVALMRLWFWMDEEDRRDR*
Ga0151516_1050319	3300011116	Freshwater	METIVAVIVLGGIGFIVCGLVFIALMHVWFWMDENERGDR*
Ga0153698_12811	3300011335	Freshwater	MMETILATIILGGVGFIVCGLVFVGLMHLWFWMDEN
Ga0153698_19308	3300011335	Freshwater	MMETIFATIILGGIGFIVCGLVFVGLMHLWFWMDERGDR*
Ga0153799_10135275	3300012012	Freshwater	METITTTIILGFIGVSVAGLVLVALMRLWFWMDENERGDR*
Ga0119960_10275523	3300014811	Aquatic	METILTTILLGGIGFIVCGLVLVGLMHLWFWMDENERGDR*
Ga0119960_10675823	3300014811	Aquatic	FPVTIRGGMMETIATAIILGFIGVVVAGLVVIGLMHLWFWMDENERGDR*
Ga0181338_100048613	3300015050	Freshwater Lake	MDTVLTTILLGFIGVVVAGLVLVALMRLWFWMDENERGDR*
Ga0181338_10035194	3300015050	Freshwater Lake	METILATILLGGIGFIVCGLVFVGLMHLWFWMDENERGDR*
Ga0181338_10061055	3300015050	Freshwater Lake	METTATIIILGFIGVVVAGLVLVALMHLWFWMDENERRDR*
Ga0181338_10082515	3300015050	Freshwater Lake	MTETIATTILLGFIGVVVAGLVLVALMRLWFWMDENERGDR*
Ga0181338_10233072	3300015050	Freshwater Lake	MMETIATTILLGFIGVVVAGLVLVALMRLWFWMDEEDRRHR*
Ga0181338_10284872	3300015050	Freshwater Lake	MMETIATTIILGFIGVVVAGLVLIALMRLWFWMDEQERNDR*
Ga0181339_10087081	3300017700	Freshwater Lake	MNTVLTTILLGFIGVVVAGLVLVALMRLWFWMDEQERNDR
Ga0181339_10372142	3300017700	Freshwater Lake	MDTVLTTILLGFIGVVVAGLVLVALMRLWFWMDEED
Ga0181363_10176816	3300017707	Freshwater Lake	METVLTTILLGFIGVSVAGLVLVALMRLWFWMDENERGDR
Ga0181363_10224933	3300017707	Freshwater Lake	METILTTILLGGIGFIVCGLVFVGLMHLWFWMDEEDRRDR
Ga0181363_10649322	3300017707	Freshwater Lake	METIVTTILLGFIGFMVGGFVFFGLVYLWFWMDENERGDR
Ga0181350_10866972	3300017716	Freshwater Lake	METIATTILLGFIGVVVAGLVLVALMRLWFWMDENERGGR
Ga0181350_11206632	3300017716	Freshwater Lake	MTETIATTILLGFIGVVVAGLVLVALMRLWFWMDEEDRRDR
Ga0181347_10763082	3300017722	Freshwater Lake	MDTVLTTILLGFIGVVVAGLVLVALMPLWFWMDEQERNDR
Ga0181362_10322314	3300017723	Freshwater Lake	METIATTILLGFIGVVVAGLVLVALMRLWFWMDEEDRRD
Ga0181362_10903882	3300017723	Freshwater Lake	MTETIVATILLGGLGMIVAGLVMIGLMKLWFWMDEQERNDR
Ga0181365_10201794	3300017736	Freshwater Lake	MDTVLTTILLGFIGVVVAGLVLVALMRLWFWMDEEDRRDR
Ga0181365_10926101	3300017736	Freshwater Lake	IATTIILGFIGVVVAGLVLIALMRLWFWMDEQERNDR
Ga0181365_11714162	3300017736	Freshwater Lake	METIVTTILLGFIGFMVGGLVFFGLVHLWFWMDEKDRRDR
Ga0181352_10054968	3300017747	Freshwater Lake	METILATIILGGVGFIVCGLVFVGLMHLWFWMDERGDR
Ga0181352_10106702	3300017747	Freshwater Lake	METILTTILLGFIGVSVAGLVLIGLMKLWFWMDENERGNR
Ga0181352_10341095	3300017747	Freshwater Lake	METIATTILLGFIGVVVAGLVLVGLMHLWFWMDENERRDR
Ga0181352_10514845	3300017747	Freshwater Lake	MMETILTTILLGGIGFIVCGLVFVGLMHLWFWMDENERNEK
Ga0181352_11755861	3300017747	Freshwater Lake	TIVATILLGGIGFIVCGLVFVGLMHLWFWMDEEDRRDR
Ga0181352_12010131	3300017747	Freshwater Lake	METILTTILLGGIGFIVCGLVIVGLMHLWFWMDENERGDR
Ga0181344_100300219	3300017754	Freshwater Lake	METIATTIILGFIGVVVAGLVLIALMRLWFWMDEDERRDR
Ga0181344_10119224	3300017754	Freshwater Lake	METILTTILLGGLGFIVCGLVLVALMRLWFWMDENERNEK
Ga0181344_10129257	3300017754	Freshwater Lake	METIVTTILLGFIGVVVAGLVLIALMHLWFWMDENERNEK
Ga0181344_10792424	3300017754	Freshwater Lake	METIVATILLGGIGFIVCGLVFVGLMHLWFWMDEEDRRDR
Ga0181344_10814882	3300017754	Freshwater Lake	METIVVTIILGGLGMVVAGLVLIALMKLWFWMDENERNDR
Ga0181344_11160322	3300017754	Freshwater Lake	METITATILLGFIGVVVAGLVLVALMRLWFWMDEQERNDR
Ga0181344_11578093	3300017754	Freshwater Lake	METILATIILGGVGFIVCGLVVVGLMHRWFWMDENERGDR
Ga0181356_10292036	3300017761	Freshwater Lake	METTATIIILGFIGVVVAGLVLVALMHLWFWMDENERRDR
Ga0181356_10603991	3300017761	Freshwater Lake	GMMETIATTILLGFIGFMVGGLVFFGLVHLWFWMDEKDRRDR
Ga0181356_11023564	3300017761	Freshwater Lake	METIATTILLGFIGFMVGGLVFFGLVHLWFWMDEKDRRD
Ga0181358_10068083	3300017774	Freshwater Lake	METIVTTILLGFIGFMVGGLVFFGLVHLWFWMDEKDRRDK
Ga0181357_10927435	3300017777	Freshwater Lake	MDTVLTTIILGFIGVVVAGLVLVALMHLWFWMDENERRDR
Ga0181357_11132754	3300017777	Freshwater Lake	MTETIVATILLGGLGILIAGLILIALMKLWFWMDEQERNDR
Ga0181357_11471932	3300017777	Freshwater Lake	METIATTILLGFIGFMVGGLVFFGLVHLWFWMDESERGDR
Ga0181357_11882532	3300017777	Freshwater Lake	MDTVLTTILLGFIGVVVAGLVVVALMHLWFWMDEEDRRDR
Ga0181357_12094482	3300017777	Freshwater Lake	METIATTILLGFIGVVVAGLVLVALMRLWFWMDEQERNDR
Ga0181357_12691191	3300017777	Freshwater Lake	MDTVLTTILLGFIGVVVAGLVLVALMRLWFWMDENERNDR
Ga0181346_11201194	3300017780	Freshwater Lake	MTETIVATILLGGLGMIVAGLVLIGLMKLWFWMDEQERKDR
Ga0181346_11665931	3300017780	Freshwater Lake	MMETIATTIILGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0181346_11854931	3300017780	Freshwater Lake	METIATTILLGFIGVVVAGLVLVALMRLWFWMDEQ
Ga0181346_12121792	3300017780	Freshwater Lake	MMETIATTILLGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0181346_12428892	3300017780	Freshwater Lake	METIATTILLGFIGVVVAGLVLVALMRLWFWMDEKDRGDR
Ga0181346_13127781	3300017780	Freshwater Lake	DTVLTTILLGFIGVVVAGLVVVALMHLWFWMDEEDRRDR
Ga0181346_13139151	3300017780	Freshwater Lake	KRVRRGMMETIATTILLGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0181348_13166432	3300017784	Freshwater Lake	MTETVLATILLGFIGVVVAGLVLVALMRLWFWMDEQERNDR
Ga0181355_10653327	3300017785	Freshwater Lake	METILVTILLGGIGFIVCGVVFVALMHLWFWMDEKDWRDR
Ga0181355_12769843	3300017785	Freshwater Lake	VLTTILLGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0181601_100797291	3300018041	Salt Marsh	METILTTILLGGIGFIVCGLVFVGLMHLWFWMDENERGDR
Ga0181360_1127564	3300019781	Freshwater Lake	MDTVLTTILLGFIGVVVAGLVLVALMRLWFWMDEQERNDR
Ga0181361_1076372	3300019783	Freshwater Lake	MMETIATTIILGFIGVVVAGLVLIALMRLWFWMDEQERNDR
Ga0181359_10096267	3300019784	Freshwater Lake	METITTTILLGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0181359_10261729	3300019784	Freshwater Lake	METILTTILLGGIGFIVCGLVFVGLMHLWFWMDEKDRRDR
Ga0181359_10312002	3300019784	Freshwater Lake	METVLTTIILGGIGFIVCGLVFVGLMHLWFWMDENERGGR
Ga0181359_10375003	3300019784	Freshwater Lake	METIATTILLGFIGVVVAGLVLVALMRLWFWMDEEDRRDR
Ga0181359_10400794	3300019784	Freshwater Lake	MDTVLTTILLGFIGVVVAGLVLVALMHLWFWMDENERRDR
Ga0181359_10426234	3300019784	Freshwater Lake	METIATTILLGFIGFMVGGLVLVALMRLWFWMDENERGDR
Ga0181359_10723823	3300019784	Freshwater Lake	MTETIVATILLGGLGMIVAGLVLIGLMKLWFWMDEQERNDR
Ga0181359_10821694	3300019784	Freshwater Lake	METILATILLGGIGFIVCGLVFVGLMHLWFWMDENERGDR
Ga0181359_10912284	3300019784	Freshwater Lake	METIATTILLGFIGFMVGGLVFFGLVHLWFWMDEKDRRDR
Ga0181359_10944583	3300019784	Freshwater Lake	METIVTTILLGFIGFMVGGLVFFGLVHLWFWMDESERGDR
Ga0181359_11013862	3300019784	Freshwater Lake	METILTTILLGFIGVSVAGLVLVALMRLWFWMDEEDRRDR
Ga0181359_11278322	3300019784	Freshwater Lake	METIVTTILLGFIGVAVAGLVLVALMRLWFWMDEEDRRDR
Ga0181359_11304741	3300019784	Freshwater Lake	METILVTILLGGIGFIVCGLVFIGLMHLWFWMDENERGDR
Ga0181359_11362141	3300019784	Freshwater Lake	MTETIVTTILLGFIGFMVGGLVFFGLVYLWFWMDENERGDR
Ga0181359_11517892	3300019784	Freshwater Lake	METIATTIILGFIGVVVAGLVLIALMRLWFWMDEQERNDR
Ga0181359_12165812	3300019784	Freshwater Lake	METVLTTIILGGIGFIVCGLVFVGLMHLWFWMDENERGDR
Ga0181359_12368452	3300019784	Freshwater Lake	MDTVLTTILLGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0211726_103542784	3300020161	Freshwater	MMETILTTILLGGIGFIVCGLVFVGLMHLWFWMDENERGDR
Ga0211729_107163633	3300020172	Freshwater	MMETILTKILLGGIGFIVCGLVFVGLMHLWFWMDENERGDR
Ga0181605_102515721	3300020188	Salt Marsh	METILTTILLGGIGFIVCGLVFVGLMHLWFWMDENER
Ga0211731_116017133	3300020205	Freshwater	METILATILLGGIGFIVCGLVFVGLMHLWFWMDEEDRRDR
Ga0211731_117000162	3300020205	Freshwater	METILTTILLGGIGFIVCGLVFVGLMHLWFWMDERGDR
Ga0208050_10017882	3300020498	Freshwater	METIVTTILLGGLGFIVCGLVLVGLMHLWFWMDENERGDR
Ga0208854_10468573	3300020517	Freshwater	ETIATTIILGFIGVVVAGLVLVALMHLWFWMDENERGDR
Ga0222714_102281743	3300021961	Estuarine Water	MDTVLTTILLGFIGVVVAGLVLVALMRLWFWMDENERGD
Ga0222712_100832684	3300021963	Estuarine Water	METIFTTILLGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0222712_102694861	3300021963	Estuarine Water	METIATAILLGFIGVVVAGLVLVALMHLWFWMDENERGDR
Ga0181353_100601114	3300022179	Freshwater Lake	METVLTTIILGGIGFIVCGLVFVGLMHLWFWMDEEDRRGR
Ga0181353_10180554	3300022179	Freshwater Lake	METILVTILLGFIGMVIAGFVLVALMHLWFWMDENERGDR
Ga0181353_10222326	3300022179	Freshwater Lake	METILTTIILGGIGFIVCGLVFVGLMHLWFWMDENERGDR
Ga0181353_10891223	3300022179	Freshwater Lake	METILTTILLGGIGFIVCGLVFVGLMHLWFWMDENERNEK
Ga0181353_11374482	3300022179	Freshwater Lake	METILATIILGGVGFIVCGLVFVGLMHLWFWMDENERGDR
Ga0181354_10541224	3300022190	Freshwater Lake	METIATTILLGFIGFMVGGLVFFGLVHLWFWMDEKDRRDK
Ga0181351_10099532	3300022407	Freshwater Lake	METILATIILGGVGFIVCGLVFVGLMHLWFWMDENERNEK
Ga0181351_10476001	3300022407	Freshwater Lake	ILTTIILGGIGFIVCGLVFVGLMHLWFWMDENERGDR
Ga0181351_10960792	3300022407	Freshwater Lake	MDTVIAVILIGGMGFIVCGLVFIALMNVWFWMDENERGDR
Ga0181351_11334262	3300022407	Freshwater Lake	VMDTVLTTILLGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0181351_12582532	3300022407	Freshwater Lake	MMETITTTILLGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0214917_1001553411	3300022752	Freshwater	METIATTIILGFIGVIVAGLVLVALMRLWFWMDENERGDR
Ga0214921_1000225837	3300023174	Freshwater	METILTTIILGGIGFIVCGLVFVGLMHLWFWMDENERGNK
Ga0214921_1000516511	3300023174	Freshwater	METIVVTILLGFIGVSVAGVVLVALMNLWFWMDENERGDR
Ga0214923_101195522	3300023179	Freshwater	METILATIILGGIGFIVCGLVFVGLMHLWFWMDENERGDR
Ga0214919_104400232	3300023184	Freshwater	METIVATILLGGIGFIVCGLVLIGLMHLWFWMDENERNEK
Ga0209615_1070513	3300025075	Freshwater	MDTVIAVILIGGVGFIVCGLVFIALMHVWFWMDENERGDR
Ga0208802_10396081	3300027210	Estuarine	TIVATILLGGLGMIVAGLVLIGLMKLWFWMDEQERNDR
Ga0208974_10126162	3300027608	Freshwater Lentic	METIATTIILGFIGVVVAGLVLVALMRLWFWMDEQERNDR
Ga0208974_10926884	3300027608	Freshwater Lentic	TIATTIILGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0209357_11840161	3300027656	Freshwater Lake	RGMMETIATTIILGFIGVVVAGLVLIALMRLWFWMDEQERNDR
Ga0208975_10431792	3300027659	Freshwater Lentic	METIATTIILGGIGFIVCGLVFVGLMHLWFWMDEEDRRDR
Ga0208975_11534294	3300027659	Freshwater Lentic	METIATAIILGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0208975_11689913	3300027659	Freshwater Lentic	LKRVRGGMMETIATTIILGFIGVVVAGLVLVALMRLWFWMDENERRDR
Ga0208975_12173092	3300027659	Freshwater Lentic	MMETITTTILLGFIGVVVAGLVLIALMRLWFWMDEQERNDR
Ga0209188_12652792	3300027708	Freshwater Lake	METIATTIILGGLGFIVCGLVLVALMRLWFWMDENERGDR
Ga0209297_10016388	3300027733	Freshwater Lake	METILTTIILGGIGFIVCGLVFIGLMHLWFWMDENERGDR
Ga0209297_100198920	3300027733	Freshwater Lake	METILATILLGGIGFIVCGLVFIGLMHLWFWMDENERGDR
Ga0209087_100005055	3300027734	Freshwater Lake	MTETIATTIILGFIGVVVAGLVLVALMRLWFWMDEQERNDR
Ga0209087_10126234	3300027734	Freshwater Lake	METIATTIILGFIGFMVGGLVFFGLVHLWFWMDEEDRRDR
Ga0209087_10687923	3300027734	Freshwater Lake	METIFTTILLGFIGVVVAGLVLVALMRLWFWMDENERRDR
Ga0209190_100007327	3300027736	Freshwater Lake	METIATTILLGGLGFIVCGLVLIGLMRLWFWMDENERGDR
Ga0209085_10088193	3300027741	Freshwater Lake	METIATTIILGGLGFIVCGLVLIGLMHLWFWMDENERGDR
Ga0209084_10404933	3300027749	Freshwater Lake	METIATTILLGGLGFIVCGLVLIGLMHLWFWMDEQERKDR
Ga0209084_10483202	3300027749	Freshwater Lake	METIVATILLGGIGFIVCGLVFVGLMHLWFWMDENERRDR
Ga0209500_1001541716	3300027782	Freshwater Lake	METILATIILGFIGFMVGGLVFFGLVHLWFWMDENERGDR
Ga0209500_100686253	3300027782	Freshwater Lake	MMETIFAVILLGGVGFIVAGLVLIALMKMWFWMDENERNNR
Ga0209500_100997392	3300027782	Freshwater Lake	METILATIILGGLGFIVCGLVFVGLMHLWFWMDENERGDR
Ga0209246_102930902	3300027785	Freshwater Lake	METITTTILLGFIGVVVAGLVLVALMHLWFWMDENERRDR
Ga0209358_101779353	3300027804	Freshwater Lake	METILTTILLGFIGVSVAGLVLVALMRLWFWMDENERGDR
Ga0209354_101517034	3300027808	Freshwater Lake	ETILATILLGGIGFIVCGLVFVGLMHLWFWMDENERGDR
Ga0209550_106470732	3300027892	Freshwater Lake	METTATIIILGFIGVVVAGLVLVALMHLWFWMDEQERNDR
Ga0247723_10112848	3300028025	Deep Subsurface Sediment	METIATTIILGFIGVVVAGLVLIGLMHLWFWMDENERGDR
Ga0315908_103919612	3300031786	Freshwater	METIVVTILLGGIGFIVCGFVLIGLMHLWFWMDENERGDR
Ga0315908_106602913	3300031786	Freshwater	METIVVTILLGGIGFIVCGLVFIGLMHLWFWMDENERGGR
Ga0315900_103619093	3300031787	Freshwater	METILATILLGGIGFIVCGLVFIGLMHLWFWMDENERNEK
Ga0315909_101492926	3300031857	Freshwater	METIATTILLGFIGVVVAGLVVIGLMHLWFWMDENERGDR
Ga0315909_103791192	3300031857	Freshwater	METITTMILLGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0315909_105365063	3300031857	Freshwater	METIVVTILLGGIGFIVCGLVLIGLMHLWFWMDEDERRDR
Ga0315909_108819832	3300031857	Freshwater	METILVTILLGGIGFIVCGFVLIGLMHLWFWMDENERGDR
Ga0315904_110705972	3300031951	Freshwater	METILTTILLGGLGFIVCGLVFVGLMHLWFWMDENERNEK
Ga0315901_104045553	3300031963	Freshwater	METIVTTIILGFIGVSVAGLVLIGLMKLWFWMDENERGNR
Ga0315901_109054502	3300031963	Freshwater	MMETILTTIILGGIGFIVCGLVFVGLMHLWFWMDENERGDR
Ga0315274_110527813	3300031999	Sediment	MDTVLTTIILGFIGVVVAGLVLVALMRLWFWMDENERGDR
Ga0315284_105379084	3300032053	Sediment	MDTVLTTILLGFIGVVVAGLVLVALMRLWFWMDENERNEK
Ga0315905_114765212	3300032092	Freshwater	MMETIVTTILLGFIGVAVAGLVLVALMRLWFWMDEEDRRDR
Ga0334992_0005211_3331_3453	3300033992	Freshwater	MDTVLATILLGFIGVVVAGLVLVALMRLWFWMDEQERNDR
Ga0334979_0002056_10928_11053	3300033996	Freshwater	MMETILATILLGGIGFIVCGLVFIGLMHLWFWMDENERGDR
Ga0334995_0147764_196_321	3300034062	Freshwater	MMETIATTIILGFIGVVVAGLVLVALMRLWFWMDENERNEK
Ga0334995_0230967_525_650	3300034062	Freshwater	MMETIATTIILGFIGVVVAGLVFIGLMHLWFWMDENERNEK
Ga0334995_0748093_164_289	3300034062	Freshwater	MMETIVTTILLGGLGFIVCGLVLVGLMHLWFWMDENERGDR
Ga0335010_0433819_3_110	3300034092	Freshwater	VTILLGVIGFMVGGFVFIGLMHLWFWMDENERNDR
Ga0335036_0068886_323_445	3300034106	Freshwater	METIATTIILGFIGVVVAGLVLVALMRLWFWMDEKDRRDR
Ga0335036_0104657_1489_1620	3300034106	Freshwater	MWGGMMETILATILLGGIGFIVCGLVFVGLMHLWFWMDERGDR
Ga0335055_0078857_1185_1307	3300034110	Freshwater	METVLTTIILGGIGFIVCGLVFVGLMHLWFWMDENERGNK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F019438

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences