NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019392

Metagenome / Metatranscriptome Family F019392

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019392
Family Type Metagenome / Metatranscriptome
Number of Sequences 230
Average Sequence Length 141 residues
Representative Sequence MSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS
Number of Associated Samples 177
Number of Associated Scaffolds 230

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 75.55 %
% of genes near scaffold ends (potentially truncated) 35.65 %
% of genes from short scaffolds (< 2000 bps) 81.74 %
Associated GOLD sequencing projects 142
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified viruses (57.391 % of family members)
NCBI Taxonomy ID 12429
Taxonomy All Organisms → Viruses → unclassified viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(26.522 % of family members)
Environment Ontology (ENVO) Unclassified
(90.870 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.870 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.93%    β-sheet: 8.97%    Coil/Unstructured: 53.10%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 230 Family Scaffolds
PF03237Terminase_6N 1.30
PF00386C1q 0.87
PF13884Peptidase_S74 0.87
PF11351GTA_holin_3TM 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.87 %
UnclassifiedrootN/A19.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10015404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → Magnetococcaceae → Magnetococcus → Magnetococcus marinus4672Open in IMG/M
3300000101|DelMOSum2010_c10220689All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.619Open in IMG/M
3300000115|DelMOSum2011_c10039380All Organisms → cellular organisms → Bacteria → Proteobacteria1994Open in IMG/M
3300000116|DelMOSpr2010_c10032240All Organisms → cellular organisms → Bacteria → Proteobacteria2438Open in IMG/M
3300000116|DelMOSpr2010_c10121852All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.940Open in IMG/M
3300000117|DelMOWin2010_c10026056All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2936Open in IMG/M
3300001450|JGI24006J15134_10022154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2903Open in IMG/M
3300001450|JGI24006J15134_10112156All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.958Open in IMG/M
3300001460|JGI24003J15210_10052311All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1356Open in IMG/M
3300001472|JGI24004J15324_10102656Not Available731Open in IMG/M
3300001589|JGI24005J15628_10021366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2798Open in IMG/M
3300002488|JGI25128J35275_1054669Not Available860Open in IMG/M
3300003542|FS900DNA_10872654All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1045Open in IMG/M
3300004097|Ga0055584_101259154All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.771Open in IMG/M
3300004448|Ga0065861_1018453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria789Open in IMG/M
3300004460|Ga0066222_1005749All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.664Open in IMG/M
3300005057|Ga0068511_1025100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria890Open in IMG/M
3300005086|Ga0072334_10396098All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.726Open in IMG/M
3300005747|Ga0076924_1098160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2572Open in IMG/M
3300005882|Ga0080455_1085881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria879Open in IMG/M
3300006164|Ga0075441_10071414All Organisms → cellular organisms → Bacteria → Proteobacteria1352Open in IMG/M
3300006164|Ga0075441_10332094All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.553Open in IMG/M
3300006165|Ga0075443_10037178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1627Open in IMG/M
3300006190|Ga0075446_10061345All Organisms → cellular organisms → Bacteria → Proteobacteria1145Open in IMG/M
3300006191|Ga0075447_10296234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Salipiger → Salipiger marinus520Open in IMG/M
3300006193|Ga0075445_10310046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Salipiger → Salipiger marinus532Open in IMG/M
3300006352|Ga0075448_10160148All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.695Open in IMG/M
3300006735|Ga0098038_1033017All Organisms → cellular organisms → Bacteria → Proteobacteria1925Open in IMG/M
3300006737|Ga0098037_1160351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria751Open in IMG/M
3300006749|Ga0098042_1018143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2097Open in IMG/M
3300006802|Ga0070749_10138397All Organisms → cellular organisms → Bacteria → Proteobacteria1422Open in IMG/M
3300006802|Ga0070749_10252588All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.998Open in IMG/M
3300006803|Ga0075467_10024869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883835Open in IMG/M
3300006810|Ga0070754_10070678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1784Open in IMG/M
3300006810|Ga0070754_10476903All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.539Open in IMG/M
3300006874|Ga0075475_10144729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1047Open in IMG/M
3300006916|Ga0070750_10243033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria784Open in IMG/M
3300006916|Ga0070750_10303854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria681Open in IMG/M
3300006920|Ga0070748_1009124All Organisms → Viruses → Predicted Viral4345Open in IMG/M
3300006920|Ga0070748_1225660All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.679Open in IMG/M
3300006921|Ga0098060_1065811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1053Open in IMG/M
3300006928|Ga0098041_1233570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria587Open in IMG/M
3300006929|Ga0098036_1129546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria773Open in IMG/M
3300006929|Ga0098036_1143466All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.730Open in IMG/M
3300006947|Ga0075444_10366493All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.546Open in IMG/M
3300007234|Ga0075460_10062936Not Available1375Open in IMG/M
3300007236|Ga0075463_10056640All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1267Open in IMG/M
3300007276|Ga0070747_1313623All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.538Open in IMG/M
3300007345|Ga0070752_1357115All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.547Open in IMG/M
3300007346|Ga0070753_1037716All Organisms → cellular organisms → Bacteria → Proteobacteria2042Open in IMG/M
3300007539|Ga0099849_1087616All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1252Open in IMG/M
3300007542|Ga0099846_1067400All Organisms → cellular organisms → Bacteria → Proteobacteria1340Open in IMG/M
3300007640|Ga0070751_1012942All Organisms → cellular organisms → Bacteria → Proteobacteria4177Open in IMG/M
3300007640|Ga0070751_1275240All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.633Open in IMG/M
3300007960|Ga0099850_1003722All Organisms → cellular organisms → Bacteria → Proteobacteria7145Open in IMG/M
3300007963|Ga0110931_1113555All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.815Open in IMG/M
3300007963|Ga0110931_1156500All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.684Open in IMG/M
3300008216|Ga0114898_1037386Not Available1595Open in IMG/M
3300008217|Ga0114899_1243902All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.555Open in IMG/M
3300008218|Ga0114904_1027231Not Available1618Open in IMG/M
3300008220|Ga0114910_1040598All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1528Open in IMG/M
3300008221|Ga0114916_1040686All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1366Open in IMG/M
3300009056|Ga0102860_1121477All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.731Open in IMG/M
3300009412|Ga0114903_1030063All Organisms → Viruses → Predicted Viral1348Open in IMG/M
3300009413|Ga0114902_1189213All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.503Open in IMG/M
3300009420|Ga0114994_10370800All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.949Open in IMG/M
3300009422|Ga0114998_10232764All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.870Open in IMG/M
3300009428|Ga0114915_1148551All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.667Open in IMG/M
3300009433|Ga0115545_1137362Not Available860Open in IMG/M
3300009435|Ga0115546_1181389All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.733Open in IMG/M
3300009436|Ga0115008_10530490Not Available843Open in IMG/M
3300009481|Ga0114932_10046325Not Available2811Open in IMG/M
3300009512|Ga0115003_10085046All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1959Open in IMG/M
3300009550|Ga0115013_10119781Not Available1515Open in IMG/M
3300009601|Ga0114914_1039386All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.790Open in IMG/M
3300009602|Ga0114900_1065355All Organisms → Viruses → Predicted Viral1069Open in IMG/M
3300009603|Ga0114911_1062613Not Available1133Open in IMG/M
3300009604|Ga0114901_1028905Not Available2070Open in IMG/M
3300009604|Ga0114901_1038976All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1706Open in IMG/M
3300009605|Ga0114906_1174627All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.730Open in IMG/M
3300009677|Ga0115104_11140102Not Available1309Open in IMG/M
3300009703|Ga0114933_10236881All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1225Open in IMG/M
3300009703|Ga0114933_10652038All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.676Open in IMG/M
3300010153|Ga0098059_1195007All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.790Open in IMG/M
3300010300|Ga0129351_1142202All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.950Open in IMG/M
3300010368|Ga0129324_10063398All Organisms → Viruses → Predicted Viral1660Open in IMG/M
3300011129|Ga0151672_149040All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.590Open in IMG/M
3300011129|Ga0151672_152440All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.590Open in IMG/M
3300011253|Ga0151671_1003233All Organisms → Viruses → Predicted Viral2750Open in IMG/M
3300011258|Ga0151677_1004635All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.5847Open in IMG/M
3300017697|Ga0180120_10264263All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.696Open in IMG/M
3300017709|Ga0181387_1076082All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.677Open in IMG/M
3300017710|Ga0181403_1024516All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1277Open in IMG/M
3300017713|Ga0181391_1064620Not Available848Open in IMG/M
3300017714|Ga0181412_1023440All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1708Open in IMG/M
3300017717|Ga0181404_1002733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00885003Open in IMG/M
3300017717|Ga0181404_1026972All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1476Open in IMG/M
3300017719|Ga0181390_1116519All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.699Open in IMG/M
3300017719|Ga0181390_1147902All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.593Open in IMG/M
3300017719|Ga0181390_1171372Not Available535Open in IMG/M
3300017724|Ga0181388_1033115All Organisms → Viruses → Predicted Viral1268Open in IMG/M
3300017724|Ga0181388_1173013Not Available511Open in IMG/M
3300017725|Ga0181398_1008717Not Available2610Open in IMG/M
3300017727|Ga0181401_1025903All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1715Open in IMG/M
3300017728|Ga0181419_1046688All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1139Open in IMG/M
3300017729|Ga0181396_1051444All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.822Open in IMG/M
3300017732|Ga0181415_1071162Not Available786Open in IMG/M
3300017734|Ga0187222_1006929All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2902Open in IMG/M
3300017737|Ga0187218_1028866All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1426Open in IMG/M
3300017737|Ga0187218_1107490All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.667Open in IMG/M
3300017739|Ga0181433_1156362All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.535Open in IMG/M
3300017743|Ga0181402_1017239All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2099Open in IMG/M
3300017744|Ga0181397_1051259All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1142Open in IMG/M
3300017746|Ga0181389_1064559All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1046Open in IMG/M
3300017746|Ga0181389_1147385All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.628Open in IMG/M
3300017749|Ga0181392_1086876All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.940Open in IMG/M
3300017750|Ga0181405_1038716Not Available1277Open in IMG/M
3300017751|Ga0187219_1121368All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.775Open in IMG/M
3300017752|Ga0181400_1015658All Organisms → Viruses → Predicted Viral2558Open in IMG/M
3300017752|Ga0181400_1072519All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1037Open in IMG/M
3300017753|Ga0181407_1021778All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1763Open in IMG/M
3300017753|Ga0181407_1092986All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.763Open in IMG/M
3300017756|Ga0181382_1061018All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1070Open in IMG/M
3300017756|Ga0181382_1181295Not Available538Open in IMG/M
3300017757|Ga0181420_1017800Not Available2375Open in IMG/M
3300017759|Ga0181414_1066328Not Available960Open in IMG/M
3300017759|Ga0181414_1086930All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.825Open in IMG/M
3300017762|Ga0181422_1031516Not Available1728Open in IMG/M
3300017764|Ga0181385_1112459Not Available832Open in IMG/M
3300017765|Ga0181413_1068346All Organisms → Viruses → Predicted Viral1092Open in IMG/M
3300017767|Ga0181406_1042948Not Available1404Open in IMG/M
3300017768|Ga0187220_1162472Not Available674Open in IMG/M
3300017768|Ga0187220_1272000All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.506Open in IMG/M
3300017769|Ga0187221_1050719All Organisms → Viruses → Predicted Viral1337Open in IMG/M
3300017770|Ga0187217_1057000All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1355Open in IMG/M
3300017770|Ga0187217_1107094All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.949Open in IMG/M
3300017771|Ga0181425_1035108Not Available1649Open in IMG/M
3300017772|Ga0181430_1073214Not Available1040Open in IMG/M
3300017772|Ga0181430_1228293Not Available527Open in IMG/M
3300017773|Ga0181386_1160184All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.686Open in IMG/M
3300017776|Ga0181394_1054058All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1344Open in IMG/M
3300017781|Ga0181423_1312995All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.577Open in IMG/M
3300017781|Ga0181423_1314340Not Available575Open in IMG/M
3300017782|Ga0181380_1111167All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.946Open in IMG/M
3300017782|Ga0181380_1112234All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.941Open in IMG/M
3300017782|Ga0181380_1316880All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.508Open in IMG/M
3300017783|Ga0181379_1050655All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1594Open in IMG/M
3300020281|Ga0211483_10000245All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.24747Open in IMG/M
3300020396|Ga0211687_10161490All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.921Open in IMG/M
3300020438|Ga0211576_10386888All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.717Open in IMG/M
3300020441|Ga0211695_10023515All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1937Open in IMG/M
3300020450|Ga0211641_10218294All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.946Open in IMG/M
3300020463|Ga0211676_10433302Not Available711Open in IMG/M
3300021356|Ga0213858_10007818All Organisms → cellular organisms → Bacteria → Proteobacteria5043Open in IMG/M
3300022065|Ga0212024_1102110All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.511Open in IMG/M
3300022068|Ga0212021_1078244All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.679Open in IMG/M
3300022072|Ga0196889_1001128All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.7382Open in IMG/M
3300022074|Ga0224906_1000515All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.21494Open in IMG/M
3300022074|Ga0224906_1002370All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.8677Open in IMG/M
3300022074|Ga0224906_1015733All Organisms → Viruses → Predicted Viral2811Open in IMG/M
3300022074|Ga0224906_1062111All Organisms → Viruses → Predicted Viral1168Open in IMG/M
3300022074|Ga0224906_1103392Not Available839Open in IMG/M
3300022164|Ga0212022_1042959All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.700Open in IMG/M
3300025071|Ga0207896_1046253All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.718Open in IMG/M
3300025079|Ga0207890_1015256Not Available1551Open in IMG/M
3300025086|Ga0208157_1105009All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.674Open in IMG/M
3300025101|Ga0208159_1098769All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.523Open in IMG/M
3300025120|Ga0209535_1006339All Organisms → Viruses7135Open in IMG/M
3300025120|Ga0209535_1031744All Organisms → cellular organisms → Bacteria → Proteobacteria2484Open in IMG/M
3300025120|Ga0209535_1050450Not Available1778Open in IMG/M
3300025120|Ga0209535_1063203All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1496Open in IMG/M
3300025120|Ga0209535_1083808All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1198Open in IMG/M
3300025120|Ga0209535_1102735All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1018Open in IMG/M
3300025120|Ga0209535_1120721All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.892Open in IMG/M
3300025120|Ga0209535_1204427All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.551Open in IMG/M
3300025128|Ga0208919_1190257Not Available620Open in IMG/M
3300025132|Ga0209232_1012369All Organisms → cellular organisms → Bacteria → Proteobacteria3487Open in IMG/M
3300025132|Ga0209232_1045941All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1615Open in IMG/M
3300025137|Ga0209336_10018642All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2523Open in IMG/M
3300025138|Ga0209634_1118385Not Available1135Open in IMG/M
3300025138|Ga0209634_1122248All Organisms → Viruses → Predicted Viral1109Open in IMG/M
3300025138|Ga0209634_1191535All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.791Open in IMG/M
3300025138|Ga0209634_1324800All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.518Open in IMG/M
3300025151|Ga0209645_1016058All Organisms → cellular organisms → Bacteria → Proteobacteria2916Open in IMG/M
3300025168|Ga0209337_1060013All Organisms → Viruses → Predicted Viral1925Open in IMG/M
3300025168|Ga0209337_1069806All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1742Open in IMG/M
3300025168|Ga0209337_1260929All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.656Open in IMG/M
3300025266|Ga0208032_1049967All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.988Open in IMG/M
3300025276|Ga0208814_1004553All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.5491Open in IMG/M
3300025276|Ga0208814_1012201All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.3043Open in IMG/M
3300025277|Ga0208180_1062218Not Available921Open in IMG/M
3300025277|Ga0208180_1117423Not Available571Open in IMG/M
3300025280|Ga0208449_1060021All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.990Open in IMG/M
3300025280|Ga0208449_1122128All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.591Open in IMG/M
3300025282|Ga0208030_1084895All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.824Open in IMG/M
3300025282|Ga0208030_1168201All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.504Open in IMG/M
3300025300|Ga0208181_1043557Not Available955Open in IMG/M
3300025301|Ga0208450_1127107All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.537Open in IMG/M
3300025305|Ga0208684_1054454All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1089Open in IMG/M
3300025543|Ga0208303_1045908All Organisms → Viruses → Predicted Viral1083Open in IMG/M
3300025645|Ga0208643_1013758All Organisms → cellular organisms → Bacteria → Proteobacteria2998Open in IMG/M
3300025647|Ga0208160_1055410All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1113Open in IMG/M
3300025687|Ga0208019_1071909All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1128Open in IMG/M
3300025815|Ga0208785_1056742All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1075Open in IMG/M
3300025818|Ga0208542_1044767Not Available1395Open in IMG/M
3300025853|Ga0208645_1070633Not Available1561Open in IMG/M
3300027522|Ga0209384_1000913Not Available16601Open in IMG/M
3300027668|Ga0209482_1049390All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1549Open in IMG/M
3300027672|Ga0209383_1003366All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.9014Open in IMG/M
3300027687|Ga0209710_1020381All Organisms → Viruses → Predicted Viral3479Open in IMG/M
3300027687|Ga0209710_1082622All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1321Open in IMG/M
3300027704|Ga0209816_1090128All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1225Open in IMG/M
3300028125|Ga0256368_1017942All Organisms → Viruses → Predicted Viral1237Open in IMG/M
3300030720|Ga0308139_1050604All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.623Open in IMG/M
3300030721|Ga0308133_1026020All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.802Open in IMG/M
3300030724|Ga0308138_1014652Not Available1129Open in IMG/M
3300031540|Ga0308143_106960All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1137Open in IMG/M
3300031540|Ga0308143_116372All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.742Open in IMG/M
3300031542|Ga0308149_1007997All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1287Open in IMG/M
3300031557|Ga0308148_1031418All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.601Open in IMG/M
3300031579|Ga0308134_1100222All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.661Open in IMG/M
3300031594|Ga0302131_1032871Not Available2052Open in IMG/M
3300031622|Ga0302126_10161270All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.825Open in IMG/M
3300031627|Ga0302118_10484783All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.545Open in IMG/M
3300031637|Ga0302138_10166476All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.750Open in IMG/M
3300031638|Ga0302125_10060261All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1282Open in IMG/M
3300032277|Ga0316202_10504142All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.569Open in IMG/M
3300033742|Ga0314858_080108All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.818Open in IMG/M
3300034418|Ga0348337_008116All Organisms → cellular organisms → Bacteria → Proteobacteria6438Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater26.52%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine26.09%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous13.91%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean11.30%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.70%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.61%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.74%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.30%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.30%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.87%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.87%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.43%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.43%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.43%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.43%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.43%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.43%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent0.43%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water0.43%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water0.43%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300003542Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS900_Dependable_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300005086Microbial Community from Halfdan Field MHDA3EnvironmentalOpen in IMG/M
3300005747Seawater microbial communities from Vineyard Sound, MA, USA - control T14EnvironmentalOpen in IMG/M
3300005882Hydrocarbon microbial community from Halfdan Field MHFEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008216Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_GeostarEnvironmentalOpen in IMG/M
3300008217Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215EnvironmentalOpen in IMG/M
3300008218Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6EnvironmentalOpen in IMG/M
3300008220Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908EnvironmentalOpen in IMG/M
3300008221Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009412Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2EnvironmentalOpen in IMG/M
3300009413Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009601Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38EnvironmentalOpen in IMG/M
3300009602Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231EnvironmentalOpen in IMG/M
3300009603Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904EnvironmentalOpen in IMG/M
3300009604Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16EnvironmentalOpen in IMG/M
3300009605Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011129Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02EnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300020281Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116)EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020441Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006)EnvironmentalOpen in IMG/M
3300020450Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025266Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025277Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes)EnvironmentalOpen in IMG/M
3300025280Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes)EnvironmentalOpen in IMG/M
3300025282Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes)EnvironmentalOpen in IMG/M
3300025300Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes)EnvironmentalOpen in IMG/M
3300025301Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes)EnvironmentalOpen in IMG/M
3300025305Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027522Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031594Marine microbial communities from Western Arctic Ocean, Canada - CB9_20mEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031627Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1EnvironmentalOpen in IMG/M
3300031637Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1001540443300000101MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS*
DelMOSum2010_1022068923300000101MarineMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGI
DelMOSum2011_1003938033300000115MarineMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
DelMOSpr2010_1003224023300000116MarineMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
DelMOSpr2010_1012185223300000116MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAXAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS*
DelMOWin2010_1002605643300000117MarineMTVTPQFYEREFNGKIRDFVRITVNGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNEKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
JGI24006J15134_1002215443300001450MarineMSVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTSLKELPAMSEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLSKRS*
JGI24006J15134_1011215623300001450MarineMSVTPQFYEREFNGQIRDFVRXTVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS*
JGI24003J15210_1005231123300001460MarineMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
JGI24004J15324_1010265613300001472MarineMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS*
JGI24005J15628_1002136623300001589MarineMSVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRXPEEWEAYKKTKGTKKQVGTSLKELPAMXEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLPERS*
JGI25128J35275_105466923300002488MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPEEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTMNAKPKAKKIHKPLNLG
FS900DNA_1087265413300003542Diffuse Hydrothermal Flow Volcanic VentLTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS*
Ga0055584_10125915413300004097Pelagic MarineMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
Ga0065861_101845313300004448MarineDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKIHKPLNLGIPDEPINDMSERS*
Ga0066222_100574913300004460MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKIHKPLNLGIPDEPINDMSERS*
Ga0068511_102510023300005057Marine WaterMSVEPQFYEREFNGKMRDFVRITIKGMKDVFECPVRPEDLTRFPTEWEAYKKTKGKTKTKGTPLKELPAMSEPRRVELELVGIETVEQLADADVEILRNIGEPYVELQRIAELQTKSKPKIEKVHKPLNLGIPDEPIDDMPKRS*
Ga0072334_1039609813300005086WaterMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESVEDLAKADIDNLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPD
Ga0076924_109816033300005747MarineMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
Ga0080455_108588123300005882WaterMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESVEDLAKADIDNLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
Ga0075441_1007141413300006164MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNMSERS*
Ga0075441_1033209413300006164MarineMSVVPQFYEREFNGQMRDFVRITVKGMRDVFEAPVRPQDLTRFPDEWQSYKKTKGTKKITGMSLKELPAMSEDRRIELELFGVESIEQLAEANVDKLRNLGQAFVELQRIAELTVKAKTSPKKVHKPLTIGIPDEPIDNLPERS*
Ga0075443_1003717813300006165MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS*
Ga0075446_1006134533300006190MarineDVFEAPVRPQDLTRFPDEWQSYKKTKGTKKITGMSLKELPAMSEDRRIELELFGVESIEQLAEANVDKLRNLGQAFVELQRIAELTVKAKTSPKKVHKPLTIGIPDEPIDNLPERS*
Ga0075447_1029623413300006191MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPI
Ga0075445_1031004613300006193MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDN
Ga0075448_1016014813300006352MarineMSVVPQFYEREFNGQMRDFVRITIKGMKDVFEAPVRPQDLTRFPDEWQSYKKTKGTKKITGMSLKELPAMSEDRRIELELFGVESIEQLAEANVDKLRNLGQAFVELQRIAELTVKAKTSPKKVHKPLTIGIPDEPIDNLPERS*
Ga0098038_103301723300006735MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPDEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTMNAKPKAKKIHKPLNLGIPDEPTNDMSERS*
Ga0098037_116035123300006737MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPDEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTMNAKPKAKKIHKPLNLGIPDEPTNDMSEC
Ga0098042_101814313300006749MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFECPVRPEDLSRFPTEWEAYKKTKGKTKAKGTSLKELPAMSEPRRVELELVGIETVEQLADADVEILRNIGEPYVELQRIAELQTKSKPKIEKVHKPLNIGIPDEPIDDMPKRS*
Ga0070749_1013839733300006802AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPER
Ga0070749_1025258823300006802AqueousKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS*
Ga0075467_1002486933300006803AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS*
Ga0070754_1007067833300006810AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLLERS*
Ga0070754_1047690313300006810AqueousMTVTPQFYEREFNGKIRDFVRITVNGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS*
Ga0075475_1014472923300006874AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS*
Ga0070750_1024303313300006916AqueousTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
Ga0070750_1030385423300006916AqueousMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS*
Ga0070748_100912423300006920AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS*
Ga0070748_122566023300006920AqueousMTVTPQFYEREFNGKIRDFVRITVNGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNEKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS*
Ga0098060_106581123300006921MarineMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPEDLSRFPDEWEAYKKTKGTKKIVGTSLKDLPAMSESRRIELELIGIESVEDLAKAEIDKLRSIGEPYVELQRIAELTVNAKPSPKKVHKPLNIGIADEPIDDMPKRS*
Ga0098041_123357013300006928MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFECPVRPEDLSRFPTEWEAYKKTKGKAKAKGTSLKELPAMSEPRRVELELVGIETVEQLADADVEILRNIGEPYVELQRIAELQTKSKPKIEKVHKPLNLGIPDEP
Ga0098036_112954613300006929MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPDEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTMNAKPKANKIHKPLNLG
Ga0098036_114346623300006929MarineMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGSPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS*
Ga0075444_1036649313300006947MarineMSVVPQFYEREFNGQMRDFVRITIKGMKDVFEAPVRPQDLTRFPDEWQSYKKTKGTKKITGMSLKELPAMSEDRRIELELFGVESIEQLAEANVDKLRNLGQAFVELQRIAELTVKAKTSPKKVHKPLTIGIPDEPIDNLP
Ga0075460_1006293613300007234AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINNLPERS*
Ga0075463_1005664023300007236AqueousMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
Ga0070747_131362313300007276AqueousTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS*
Ga0070752_135711513300007345AqueousMTVTPQFYEREFNGKIRDFVRITVNGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNEKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMS
Ga0070753_103771613300007346AqueousMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS*
Ga0099849_108761623300007539AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS*
Ga0099846_106740033300007542AqueousMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
Ga0070751_101294233300007640AqueousMSVTPQFYEREFNGKIRDFVRITVNGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNEKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
Ga0070751_127524023300007640AqueousMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVH
Ga0099850_100372253300007960AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS*
Ga0110931_111355513300007963MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPDEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTINAKPKAKKIHKPLNLGIPDEPTNDMSERS*
Ga0110931_115650013300007963MarineMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGSPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS*
Ga0114898_103738633300008216Deep OceanMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYAELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS*
Ga0114899_124390213300008217Deep OceanVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPDEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTMNAKPKAKKIHKPLNLGIPDEPTNNMSERS*
Ga0114904_102723133300008218Deep OceanMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS*
Ga0114910_104059823300008220Deep OceanMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS*
Ga0114916_104068633300008221Deep OceanMSVVPQFYEREFNGQMRDFVRITVKGMRDVFEAPVRPQDLTRFPDEWQSYKKTKGTKKITGMSLKELPAMSEDRRIELELFGVESIEQLAEADVDKLRNLGQAFVELQRIAELTVKAKTSPKKVHKPLTIGIPDEPIDNLPERS*
Ga0102860_112147713300009056EstuarineGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS
Ga0114903_103006323300009412Deep OceanMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS*
Ga0114902_118921313300009413Deep OceanFVRITIKGMKDVFECPVRPEDLSRFPTEWEAYKKTKGKAKAKGTSLKELPAMSEPRRVELELVGIETVEQLADADVEILRNIGEPYVELQRIAELQTKSKPKIEKVHKPLNLGIPDEPIDDLPKRS*
Ga0114994_1037080013300009420MarineMSVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEQWEAYKKTKGTKKIVGTSLKELPAMSEPRRVELELVGIESVEDLAKAEVDKLRNLGQPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLSKRS*
Ga0114998_1023276413300009422MarineMTVKPQFYEREFNGKIRDFIRISVSGLKDIFEAPVRPQDLSRFPDEWLNYKKTKGTKKIVGTSLKELPAMSEPRRIELELIGIESVEDFAKAEIQILRNLGEPYVELQRIAELTMKAKQPKQQVEVKPLNIGIPHESTDNMPKRS*
Ga0114915_114855113300009428Deep OceanDVFEAPVRPQDLTRFPDEWQSYKKTKGTKKITGMSLKELPAMSEDRRIELELFGVESIEQLAEADVDKLRNLGQAFVELQRIAELTVKAKTSPKKVHKPLTIGIPDEPIDNLPERS*
Ga0115545_113736223300009433Pelagic MarineMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDM
Ga0115546_118138913300009435Pelagic MarineMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESVEDLAKADIDNLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
Ga0115008_1053049013300009436MarineMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS*
Ga0114932_1004632523300009481Deep SubsurfaceMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPDEWEAYKKSKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTINAKPKAKKIHKPLNLGIPDEPTNDMSERS*
Ga0115003_1008504633300009512MarineMLVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEQWEAYKKTKGTKKIVGTSLKELPAMSEPRRVELELVGIESVEDLAKAEVDKLRNLGQPYVELQRIAELTVKAKQAPKKIHKPLNIGIPDEPINNLPERS*
Ga0115013_1011978133300009550MarineMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPEDLSRFPDEWEAYKKTKGTKKIVGTSLKDLPAMSESRRIELELIGIESVEDLAKAEIDKLRSIGEPYVELQRIAELTVNAKPSPKKVHKPLNIGIADEPIDDMPKRS*
Ga0114914_103938623300009601Deep OceanMSVVPQFYEREFNGQMRDFVRITIKGMKDVFEAPVRPQDLTRFPDEWQSYKKTKGTKKITGMSLKELPAMSEDRRIELELFGVESIEQLAEADVDKLRNLGQAFVELQRIAELTVKAKTSPKKVHKPLTIGIPDEPIDNLPKRS*
Ga0114900_106535513300009602Deep OceanMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS*
Ga0114911_106261313300009603Deep OceanMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKPKAKKIHKPLNLGIP
Ga0114901_102890533300009604Deep OceanMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS*
Ga0114901_103897633300009604Deep OceanMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPEEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTINAKPKAKKIHKPLNLGIPDEPTNDMSERS*
Ga0114906_117462713300009605Deep OceanKMRDFVRITIKGMKDVFECPVRPEDLSRFPTEWEAYKKTKGKAKAKGTSLKELPAMSEPRRVELELVGIETVEQLADADVEILRNIGEPYVELQRIAELQTKSKPKIEKVHKPLNLGIPDEPTNDMSERS*
Ga0115104_1114010223300009677MarineMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
Ga0114933_1023688123300009703Deep SubsurfaceMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS*
Ga0114933_1065203823300009703Deep SubsurfaceMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFSDEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTINAKPKAKKIHKPLNLGIPDEPTNDMSERS*
Ga0098059_119500723300010153MarineMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIQKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS*
Ga0129351_114220223300010300Freshwater To Marine Saline GradientMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKK
Ga0129324_1006339833300010368Freshwater To Marine Saline GradientMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS*
Ga0151672_14904013300011129MarineREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLAKADIDNLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS*
Ga0151672_15244013300011129MarineREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS*
Ga0151671_100323313300011253MarineMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLAKADIDNLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS*
Ga0151677_100463583300011258MarineMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLAKADIDNLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS*
Ga0180120_1026426313300017697Freshwater To Marine Saline GradientTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0181387_107608223300017709SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESKEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0181403_102451623300017710SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0181391_106462023300017713SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIN
Ga0181412_102344023300017714SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0181404_100273363300017717SeawaterMSVTPQFYEREFNGQLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEADKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0181404_102697233300017717SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0181390_111651923300017719SeawaterMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPD
Ga0181390_114790223300017719SeawaterGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPKRS
Ga0181390_117137213300017719SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0181388_103311533300017724SeawaterNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0181388_117301313300017724SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGSPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0181398_100871743300017725SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNI
Ga0181401_102590323300017727SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKNPSPKKVHKPLNIGIPDEPINDMPERS
Ga0181419_104668823300017728SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0181396_105144423300017729SeawaterMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0181415_107116213300017732SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKV
Ga0187222_100692933300017734SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS
Ga0187218_102886623300017737SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0187218_110749013300017737SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKPKAKKIHKPLNLGIPDEPTNDMSERS
Ga0181433_115636223300017739SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0181402_101723933300017743SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0181397_105125923300017744SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0181389_106455913300017746SeawaterMGAGKLALLTTNLEGLLMSVTPQFYEREFNGKVRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLAKADIDNLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0181389_114738523300017746SeawaterVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0181392_108687613300017749SeawaterMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0181405_103871623300017750SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0187219_112136813300017751SeawaterMGAGKLALLTTNLEGLLMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPID
Ga0181400_101565813300017752SeawaterRFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0181400_107251913300017752SeawaterMTVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKNPSPKKVHKPLNI
Ga0181407_102177833300017753SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKNPSPKKVQKPLNIGIPDEPINDMSERS
Ga0181407_109298623300017753SeawaterKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPER
Ga0181382_106101813300017756SeawaterFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0181382_118129523300017756SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKIHKPLNLGIPDEPIDDMSERS
Ga0181420_101780023300017757SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0181414_106632823300017759SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKQVHKPLNIGIPDEPIDDMSERS
Ga0181414_108693013300017759SeawaterMGAGKLALLTTNLEGLLMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0181422_103151633300017762SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0181385_111245923300017764SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0181413_106834613300017765SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0181406_104294823300017767SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGRPDEPINDMPERS
Ga0187220_116247223300017768SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPK
Ga0187220_127200023300017768SeawaterIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0187221_105071913300017769SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEEPGRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0187217_105700023300017770SeawaterMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0187217_110709423300017770SeawaterMGAGKLALLSTNLEGLLMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0181425_103510813300017771SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS
Ga0181430_107321423300017772SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLREIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0181430_122829313300017772SeawaterMGAGKLALLTTNLEGLLMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0181386_116018423300017773SeawaterYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0181394_105405823300017776SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0181423_131299513300017781SeawaterMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0181423_131434023300017781SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIQDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDM
Ga0181380_111116723300017782SeawaterVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0181380_111223413300017782SeawaterFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0181380_131688013300017782SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMP
Ga0181379_105065523300017783SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0211483_10000245243300020281MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFECPVRPEDLTRFPTEWEAYKKTKGKKKTKGTSLKELPAMSEPRRVELELVGIETVEQLADADVEILRNIGEPYVELQRIAELQTKSKPKIEKVHKPLNLGIPDEPIDDMPKRS
Ga0211687_1016149023300020396MarineRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0211576_1038688813300020438MarineMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0211558_1012480233300020439MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFECPVRPEDLSRFPTEWEAYKKTKGKTKAKGTSLKELPAMSEPRRVELELVGIETVEQLADADVEILRNIGEPYVELQRIAELQTKSKPKIEKV
Ga0211695_1002351523300020441MarineMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPEDLSRFPDEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESVEDLAKAEIDKLRSIGEPYVELQRIAELTVNAKPSPKKVHKPLNIGIPDEPINNMPKRS
Ga0211641_1021829423300020450MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFECPVRPEDLSRFPEEWEAYKKTKGKAKPKGTSLKELPAMSEPRRIELELIGIETVEQLAKADIEHLRTIGEPYVELQRIAELSTNSKPKQEKVHKPLNLGIPDEPTNDMSERS
Ga0211676_1043330213300020463MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPDEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTMNAKPKAKKIHKPLNLGIPDEPTN
Ga0213858_1000781843300021356SeawaterMSVEPQFYEREFNGKMRDFVRITIKGMKDVFECPVRPEDLTRFPTEWEAYKKTKGKAKAKGTSLKELPAMSEPRRVELELVGIETVEQLADADVEILRNIGEPYVELQRIAELQTKSKPKIEKVHKPLNLGIPDEPIDDMPKRS
Ga0212024_110211013300022065AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHN
Ga0212021_107824413300022068AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0196889_100112823300022072AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS
Ga0224906_1000515413300022074SeawaterMSVEPQFYEREFNGKMRDFVRITIKGMKDVFECPVRPEDLSRFPTEWEAYKKTKGKTKAKGTSLKELPAMSEPRRVELELVGIETVEQLADADVEILRNIGEPYVELQRIAELQTKSKPKIEKVHKPLNLGIPDEPIDDMPKRS
Ga0224906_100237083300022074SeawaterMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0224906_101573323300022074SeawaterMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPDEWAAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTINAKPKAKKIHKPLNLGIPDEPTNDMSERS
Ga0224906_106211113300022074SeawaterTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0224906_110339213300022074SeawaterMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0212022_104295923300022164AqueousMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0207896_104625323300025071MarineKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKIHKPLNLGIPDEPINDMSERS
Ga0207890_101525613300025079MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKIHKPLNLGIPDEPINDMSERS
Ga0208157_110500923300025086MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPDEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLARADIEKLRTIGEPYVELQRIAELTMNAKPKAKKIHKPLNLGIPDEPTNDMSERS
Ga0208159_109876913300025101MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFECPVRPEDLSRFPTEWEAYKKTKGKAKAKGTSLKELPAMSEPRRVELELVGIETVEQLADADVEILRNIGEPYVELQRIAELQTKSKPKIEKVHKPLNIGIPDEPIDDMPKRS
Ga0209535_100633993300025120MarineMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0209535_103174433300025120MarineMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS
Ga0209535_105045023300025120MarineMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0209535_106320323300025120MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTSLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKIHKPLNLGIPDEPINDMSERS
Ga0209535_108380823300025120MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS
Ga0209535_110273523300025120MarineMSVTPQFYEREFNGKLRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTPLKDLPAMSESRRIELELIGIESVEDLAKADIDNLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0209535_112072113300025120MarineMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0209535_120442713300025120MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKIHKPLNLGIPDEPINDMSE
Ga0208919_119025723300025128MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPDEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTMNAKPKAKKIHKPLNLGIPDEPTNDMSERS
Ga0209232_101236943300025132MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPEEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTMNAKPKAKKIHKPLNLGIPDEPTNDMSERS
Ga0209232_104594123300025132MarineMSEKGIFFERELNGQKRDFCRIEIAGMRDIWEGPARPEDLQRFPAEWKAYKGKKKKPRTKGTGLAELPGMTEPRRTELELHDIETIEALAAAEETTLRGIGEPYVELQRIAELQTKSKPKIEKVHKPLNIGIPDEPIDDMPKRS
Ga0209336_1001864213300025137MarineMSVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTSLKELPAMSEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLPERS
Ga0209634_111838513300025138MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKIHKPLNLGIPDEPINDM
Ga0209634_112224813300025138MarineFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0209634_119153523300025138MarineSVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTSLKELPAMSEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLSKRS
Ga0209634_132480023300025138MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSP
Ga0209645_101605833300025151MarineMSVEPQFYEREFNGKMRDFVRITIKGMKDVFECPVRPEDLTRFPTEWEAYKKTKGKTKTKGTPLKELPAMSEPRRVELELVGIETVEQLADADVEILRNIGEPYVELQRIAELQTKSKPKIEKVHKPLNIGIPDEPIDDMPKRS
Ga0209337_106001313300025168MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0209337_106980623300025168MarineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0209337_126092913300025168MarineMSVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTSLKELPAMSEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLSKRS
Ga0208032_104996723300025266Deep OceanMSVVPQFYEREFNGQMRDFVRITIKGMRDVFEAPVRPQDLTRFPDEWQSYKKTKGTKKITGMSLKELPAMSEDRRIELELFGVESIEQLAEADVDKLRNLGQAFVELQRIAELTVKAKTSPKKVHKPLTIGIPDEPIDNLPERS
Ga0208814_100455373300025276Deep OceanMSVVPQFYEREFNGQMRDFVRITIKGMKDVFEAPVRPQDLTRFPDEWQSYKKTKGTKKITGMSLKELPAMSEDRRIELELFGVESIEQLAEADVDKLRNLGQAFVELQRIAELTVKAKTSPKKVHKPLTIGIPDEPIDNLPERS
Ga0208814_101220133300025276Deep OceanMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMSERS
Ga0208180_106221823300025277Deep OceanMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0208180_111742313300025277Deep OceanMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPDEWEAYKKSKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTINAKPKAKKIHKPLNLGIPDEPTNDMSERS
Ga0208449_106002123300025280Deep OceanMSVEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPDEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTINAKPKAKKIHKPLNLGIPDEPTNDMSERS
Ga0208449_112212813300025280Deep OceanMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0208030_108489513300025282Deep OceanMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0208030_116820113300025282Deep OceanKMRDFVRITIKGMKDVFECPVRPEDLSRFPTEWEAYKKTKGKAKAKGTSLKELPAMSEPRRVELELVGIETVEQLADADVEILRNIGEPYVELQRIAELQTKSKPKIEKVHKPLNLGIPDEPTNDMSERS
Ga0208181_104355723300025300Deep OceanMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0208450_112710723300025301Deep OceanEPQFYEREFNGKMRDFVRITIKGMKDVFEAPVRPQDISRFPEEWEAYKKTKGIKKQVGTALKELPAMSEPRRIELELIGIESVEDLAKADIEKLRTIGEPYVELQRIAELTINAKPKAKKIHKPLNLGIPDEPTNDMSERS
Ga0208684_105445423300025305Deep OceanMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMPERS
Ga0208303_104590813300025543AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDDMPERS
Ga0208643_101375833300025645AqueousMTVTPQFYEREFNGKIRDFVRITVNGMKDIFEAPVRPQDLSRFPKEWEAYKKTKGNEKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0208160_105541013300025647AqueousMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0208019_107190923300025687AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0208785_105674223300025815AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0208542_104476723300025818AqueousMSVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINNLPERS
Ga0208645_107063333300025853AqueousMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPIEWEAYKKTKGNKKQVGTPLKDLPAMSESRRIELELIGIESVEDLANAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS
Ga0209384_1000913253300027522MarineMSVVPQFYEREFNGQMRDFVRITIKGMKDVFEAPVRPQDLTRFPDEWQSYKKTKGTKKITGMSLKELPAMSEDRRIELELFGVESIEQLAEANVDKLRNLGQAFVELQRIAELTVKAKTSPKKVHKPLTIGIPDEPIDNLPERS
Ga0209482_104939023300027668MarineMSVVPQFYEREFNGQMRDFVRITVKGMRDVFEAPVRPQDLTRFPDEWQSYKKTKGTKKITGMSLKELPAMSEDRRIELELFGVESIEQLAEADVDKLRNLGQAFVELQRIAELTVKAKTSPKKVHKPLTIGIPDEPIDNLPERS
Ga0209383_100336613300027672MarineMSVVPQFYEREFNGQMRDFVRITVKGMRDVFEAPVRPQDLTRFPDEWQSYKKTKGTKKITGMSLKELPAMSEDRRIELELFGVESIEQLAEANVDKLRNLGQAFVELQRIAELTVKAKTSPKKVHKPLTIGIPDEPIDNLPERS
Ga0209710_102038133300027687MarineMLVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEQWEAYKKTKGTKKIVGTSLKELPAMSEPRRVELELVGIESVEDLAKAEVDKLRNLGQPYVELQRIAELTVKAKQAPKKIHKPLNIGIPDEPINNLPERS
Ga0209710_108262223300027687MarineMSVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTSLKELPAMSEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLSKRS
Ga0209816_109012813300027704MarineQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNMSERS
Ga0256368_101794213300028125Sea-Ice BrineMLVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTSLKELPAMSEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPIDDMPERS
Ga0308139_105060423300030720MarineVRITIKGMKDIFEAPVRPQDLSRFPEQWEAYKKTKGTKKIVGTSLKELPAMSEPRRVELELVGIESVEDLAKAEVDKLRNLGQPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINNMPERS
Ga0308133_102602013300030721MarineMLVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTSLKELPAMSEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLSKRS
Ga0308138_101465213300030724MarineMLVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEQWEAYKKTKGTKKIVGTSLKELPAMSEPRRVELELVGIESVEDLAKAEVDKLRNLGQPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDE
Ga0308143_10696013300031540MarineVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTSLKELPAMSEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLSKRS
Ga0308143_11637223300031540MarineLVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEQWEAYKKTKGTKKIVGTSLKELPAMSEPRRVELELVGIESVEDLAKAEVDKLRNLGQPYVELQRIAELTVKAKQAPKKIHKPLNIGIPDEPINNLPERS
Ga0308149_100799723300031542MarineMSVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTSLKELPAMSEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLPERS
Ga0308148_103141823300031557MarineEFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEQWEAYKKTKGTKKIVGTSLKELPAMSEPRRVELELVGIESVEDLAKAEVDKLRNLGQPYVELQRIAELTVKAKQAPKKIHKPLNIGIPDEPINDLSKRS
Ga0308134_110022223300031579MarineMSVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTSLKELPAMSEPRRIELELIGIESVEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLSKRS
Ga0302131_103287123300031594MarineMSVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEQWEAYKKTKGTKKIVGTSLKELPAMSEPRRVELELVGIESVEDLAKAEVDKLRNLGQPYVELQRIAELTVKAKQAPKKIHKPLNIGIPDEPINDLSKRS
Ga0302126_1016127013300031622MarineMSVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTSLKELPAMSEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDL
Ga0302118_1048478313300031627MarineMSVTPQFYEREFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEQWEAYKKTKGTKKIVGTSLKELPAMSEPRRVELELVGIESVEDLAKAEVDKLRNLGQPYVELQRIAELTVKAKQAPKKIHKPLNIGIPDEPINNLPERS
Ga0302138_1016647623300031637MarineFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKIVGTSLKELPAMSEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLSKRS
Ga0302125_1006026113300031638MarineFNGKMRDFVRITIKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTSLKELPAMSEPRRIELELIGIESIEDLAKAEIDKLRSIGEPYVELQRIAELTMNAKKPSPKIVHKPLNIGIPDEPINDLSKRS
Ga0316202_1050414223300032277Microbial MatMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGNKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLATAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPINDMSERS
Ga0314858_080108_452_8173300033742Sea-Ice BrineMSVTPQFYEREFNGQIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELIGIESIEDLAKAEIEKLRGIGEPYVELQRIAELTMNAKKPSL
Ga0348337_008116_1026_14633300034418AqueousMTVTPQFYEREFNGKIRDFVRITVKGMKDIFEAPVRPQDLSRFPEEWEAYKKTKGTKKQVGTPLKDLPAMSEPRRIELELVGIESIEDLANAEIEKLRGIGEPYVELQRIAELTMNAKKPSPKKVHKPLNIGIPDEPIDNLPERS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.