| Basic Information | |
|---|---|
| Family ID | F019365 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 230 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MIKRTLGCVALCGWLMAGGSLQAHHSLAGVYDMKKEMEM |
| Number of Associated Samples | 186 |
| Number of Associated Scaffolds | 230 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.56 % |
| % of genes near scaffold ends (potentially truncated) | 97.83 % |
| % of genes from short scaffolds (< 2000 bps) | 90.43 % |
| Associated GOLD sequencing projects | 176 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.174 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (6.522 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.217 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.957 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.24% β-sheet: 0.00% Coil/Unstructured: 47.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 230 Family Scaffolds |
|---|---|---|
| PF00135 | COesterase | 3.48 |
| PF00903 | Glyoxalase | 3.48 |
| PF13620 | CarboxypepD_reg | 1.74 |
| PF12681 | Glyoxalase_2 | 1.30 |
| PF07638 | Sigma70_ECF | 1.30 |
| PF00216 | Bac_DNA_binding | 1.30 |
| PF07519 | Tannase | 0.87 |
| PF07366 | SnoaL | 0.87 |
| PF02146 | SIR2 | 0.87 |
| PF12543 | DUF3738 | 0.87 |
| PF01494 | FAD_binding_3 | 0.87 |
| PF11141 | DUF2914 | 0.87 |
| PF07995 | GSDH | 0.87 |
| PF00929 | RNase_T | 0.87 |
| PF01799 | Fer2_2 | 0.43 |
| PF00374 | NiFeSe_Hases | 0.43 |
| PF00691 | OmpA | 0.43 |
| PF07676 | PD40 | 0.43 |
| PF00593 | TonB_dep_Rec | 0.43 |
| PF03951 | Gln-synt_N | 0.43 |
| PF09720 | Unstab_antitox | 0.43 |
| PF04909 | Amidohydro_2 | 0.43 |
| PF07746 | LigA | 0.43 |
| PF01381 | HTH_3 | 0.43 |
| PF13460 | NAD_binding_10 | 0.43 |
| PF00561 | Abhydrolase_1 | 0.43 |
| PF02537 | CRCB | 0.43 |
| PF13683 | rve_3 | 0.43 |
| PF12840 | HTH_20 | 0.43 |
| PF02687 | FtsX | 0.43 |
| PF07883 | Cupin_2 | 0.43 |
| PF07244 | POTRA | 0.43 |
| PF01266 | DAO | 0.43 |
| PF04366 | Ysc84 | 0.43 |
| PF07714 | PK_Tyr_Ser-Thr | 0.43 |
| PF13557 | Phenol_MetA_deg | 0.43 |
| PF03683 | UPF0175 | 0.43 |
| PF01425 | Amidase | 0.43 |
| PF00702 | Hydrolase | 0.43 |
| PF04273 | BLH_phosphatase | 0.43 |
| PF12847 | Methyltransf_18 | 0.43 |
| PF00550 | PP-binding | 0.43 |
| PF09579 | Spore_YtfJ | 0.43 |
| PF04248 | NTP_transf_9 | 0.43 |
| PF01081 | Aldolase | 0.43 |
| PF01436 | NHL | 0.43 |
| PF13847 | Methyltransf_31 | 0.43 |
| PF03795 | YCII | 0.43 |
| PF01979 | Amidohydro_1 | 0.43 |
| PF03551 | PadR | 0.43 |
| PF00583 | Acetyltransf_1 | 0.43 |
| PF00034 | Cytochrom_C | 0.43 |
| PF01694 | Rhomboid | 0.43 |
| PF12680 | SnoaL_2 | 0.43 |
| PF02775 | TPP_enzyme_C | 0.43 |
| PF00440 | TetR_N | 0.43 |
| PF00174 | Oxidored_molyb | 0.43 |
| PF16576 | HlyD_D23 | 0.43 |
| PF00535 | Glycos_transf_2 | 0.43 |
| PF08818 | DUF1801 | 0.43 |
| PF01609 | DDE_Tnp_1 | 0.43 |
| PF00271 | Helicase_C | 0.43 |
| PF01717 | Meth_synt_2 | 0.43 |
| PF01909 | NTP_transf_2 | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 230 Family Scaffolds |
|---|---|---|---|
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 3.48 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.74 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.74 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.30 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.30 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.87 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.87 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.87 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.87 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.43 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.43 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.43 |
| COG3259 | Coenzyme F420-reducing hydrogenase, alpha subunit | Energy production and conversion [C] | 0.43 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.43 |
| COG3453 | Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family | General function prediction only [R] | 0.43 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.43 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.43 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.43 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.43 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.43 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.43 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.43 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.43 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.43 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.43 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.43 |
| COG0800 | 2-keto-3-deoxy-6-phosphogluconate aldolase | Carbohydrate transport and metabolism [G] | 0.43 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.43 |
| COG0374 | Ni,Fe-hydrogenase I large subunit | Energy production and conversion [C] | 0.43 |
| COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 0.43 |
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.17 % |
| Unclassified | root | N/A | 7.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11780708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300001686|C688J18823_10530577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300004156|Ga0062589_102869773 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300004157|Ga0062590_100586581 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300004480|Ga0062592_101026658 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300004480|Ga0062592_101937389 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300004643|Ga0062591_101354796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 703 | Open in IMG/M |
| 3300005179|Ga0066684_11044146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005187|Ga0066675_10274577 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300005332|Ga0066388_107725314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 539 | Open in IMG/M |
| 3300005335|Ga0070666_10294061 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300005337|Ga0070682_100592944 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300005345|Ga0070692_10264588 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300005354|Ga0070675_101242141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300005354|Ga0070675_101451201 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005356|Ga0070674_101421737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300005356|Ga0070674_102160008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 508 | Open in IMG/M |
| 3300005367|Ga0070667_101452570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300005440|Ga0070705_101329964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300005451|Ga0066681_10359825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 894 | Open in IMG/M |
| 3300005466|Ga0070685_10297946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1086 | Open in IMG/M |
| 3300005471|Ga0070698_101305654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300005533|Ga0070734_10694359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300005534|Ga0070735_10588361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300005535|Ga0070684_100286769 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300005541|Ga0070733_11073414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300005544|Ga0070686_100858469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300005558|Ga0066698_10657494 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005591|Ga0070761_10429439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300005598|Ga0066706_11183630 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005615|Ga0070702_100167801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300005618|Ga0068864_101016000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 823 | Open in IMG/M |
| 3300005712|Ga0070764_10840464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300005718|Ga0068866_11287903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300005764|Ga0066903_101223758 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300005764|Ga0066903_101654918 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300005764|Ga0066903_104117091 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300005764|Ga0066903_107766592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300005836|Ga0074470_11175040 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005836|Ga0074470_11630206 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300005840|Ga0068870_11459874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300005841|Ga0068863_100262022 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300005841|Ga0068863_102025253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Allosalinactinospora → Allosalinactinospora lopnorensis | 586 | Open in IMG/M |
| 3300005842|Ga0068858_100244666 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300005844|Ga0068862_101891896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300005921|Ga0070766_10251733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300005937|Ga0081455_10966579 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006034|Ga0066656_10387076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300006046|Ga0066652_101612904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300006049|Ga0075417_10475455 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006057|Ga0075026_101057776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300006059|Ga0075017_100160556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia rhizosphera | 1606 | Open in IMG/M |
| 3300006174|Ga0075014_100687135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300006174|Ga0075014_100908513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300006237|Ga0097621_100387230 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300006237|Ga0097621_100585330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300006237|Ga0097621_100676449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 949 | Open in IMG/M |
| 3300006358|Ga0068871_100001598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15233 | Open in IMG/M |
| 3300006358|Ga0068871_101041332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300006358|Ga0068871_101599182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300006796|Ga0066665_10830322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300006804|Ga0079221_11319235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300006844|Ga0075428_100645947 | Not Available | 1129 | Open in IMG/M |
| 3300006844|Ga0075428_100825835 | Not Available | 985 | Open in IMG/M |
| 3300006854|Ga0075425_101531718 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300006904|Ga0075424_101108059 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300006914|Ga0075436_101553627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300006918|Ga0079216_11179822 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300007076|Ga0075435_100280480 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300007076|Ga0075435_100383640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300007788|Ga0099795_10585330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300009101|Ga0105247_10016178 | All Organisms → cellular organisms → Bacteria | 4468 | Open in IMG/M |
| 3300009156|Ga0111538_12072240 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300009177|Ga0105248_11428788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 783 | Open in IMG/M |
| 3300009551|Ga0105238_11701237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300009553|Ga0105249_12761978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300010038|Ga0126315_10953499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300010046|Ga0126384_12162567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 535 | Open in IMG/M |
| 3300010047|Ga0126382_10111289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1794 | Open in IMG/M |
| 3300010047|Ga0126382_10143394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1624 | Open in IMG/M |
| 3300010048|Ga0126373_10141916 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300010048|Ga0126373_10299205 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300010358|Ga0126370_12578192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300010358|Ga0126370_12612221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300010360|Ga0126372_11202542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300010375|Ga0105239_12859331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300010376|Ga0126381_104421138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300011120|Ga0150983_15165805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300012519|Ga0157352_1060801 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012685|Ga0137397_10019875 | All Organisms → cellular organisms → Bacteria | 4712 | Open in IMG/M |
| 3300012930|Ga0137407_11472793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300012948|Ga0126375_10199453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1312 | Open in IMG/M |
| 3300012948|Ga0126375_10247846 | Not Available | 1204 | Open in IMG/M |
| 3300012984|Ga0164309_11491902 | Not Available | 578 | Open in IMG/M |
| 3300013306|Ga0163162_13401436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 508 | Open in IMG/M |
| 3300013308|Ga0157375_12521460 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300014745|Ga0157377_11595280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300015077|Ga0173483_10385552 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300015200|Ga0173480_11048158 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300015201|Ga0173478_10040715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1467 | Open in IMG/M |
| 3300015372|Ga0132256_100770298 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300015373|Ga0132257_100269511 | All Organisms → cellular organisms → Bacteria | 2038 | Open in IMG/M |
| 3300015374|Ga0132255_102867963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300016404|Ga0182037_10440133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
| 3300016422|Ga0182039_11499778 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300016422|Ga0182039_11877628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300017659|Ga0134083_10162587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300017792|Ga0163161_10657617 | Not Available | 869 | Open in IMG/M |
| 3300017792|Ga0163161_11653731 | Not Available | 566 | Open in IMG/M |
| 3300017933|Ga0187801_10396355 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300017947|Ga0187785_10711526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300017965|Ga0190266_10238290 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300018013|Ga0187873_1026096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2864 | Open in IMG/M |
| 3300018057|Ga0187858_10256681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1120 | Open in IMG/M |
| 3300018060|Ga0187765_10526683 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300018083|Ga0184628_10659766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300018088|Ga0187771_11827942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300018469|Ga0190270_12797302 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300018476|Ga0190274_10912435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300018481|Ga0190271_11970935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300019269|Ga0184644_1641563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300019362|Ga0173479_10871574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300020580|Ga0210403_10610849 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300021181|Ga0210388_11616651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300021402|Ga0210385_10322062 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300021404|Ga0210389_10493464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300021406|Ga0210386_11381419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300021432|Ga0210384_11691954 | Not Available | 538 | Open in IMG/M |
| 3300021433|Ga0210391_11441849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300021445|Ga0182009_10121695 | Not Available | 1214 | Open in IMG/M |
| 3300021474|Ga0210390_10344247 | Not Available | 1262 | Open in IMG/M |
| 3300025324|Ga0209640_10431640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1083 | Open in IMG/M |
| 3300025326|Ga0209342_11295310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300025862|Ga0209483_1059370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1770 | Open in IMG/M |
| 3300025899|Ga0207642_10007640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3661 | Open in IMG/M |
| 3300025900|Ga0207710_10049185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1888 | Open in IMG/M |
| 3300025901|Ga0207688_10636644 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300025906|Ga0207699_10814872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300025911|Ga0207654_10024271 | All Organisms → cellular organisms → Bacteria | 3258 | Open in IMG/M |
| 3300025917|Ga0207660_11082960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300025918|Ga0207662_10703801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300025923|Ga0207681_10276228 | Not Available | 1321 | Open in IMG/M |
| 3300025923|Ga0207681_10991993 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300025923|Ga0207681_11297724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300025925|Ga0207650_10831459 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300025926|Ga0207659_10915928 | Not Available | 754 | Open in IMG/M |
| 3300025926|Ga0207659_11772541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300025930|Ga0207701_10810382 | Not Available | 788 | Open in IMG/M |
| 3300025931|Ga0207644_11249229 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300025935|Ga0207709_11068975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300025936|Ga0207670_10091362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2153 | Open in IMG/M |
| 3300025936|Ga0207670_11012801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300025936|Ga0207670_11320764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300025936|Ga0207670_11855933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300025940|Ga0207691_10050942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3788 | Open in IMG/M |
| 3300025941|Ga0207711_10839941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300025941|Ga0207711_11179100 | Not Available | 707 | Open in IMG/M |
| 3300025941|Ga0207711_11345161 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 657 | Open in IMG/M |
| 3300025941|Ga0207711_11497584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300025941|Ga0207711_12028743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300025945|Ga0207679_10852210 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300025960|Ga0207651_11030866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300025961|Ga0207712_10009781 | All Organisms → cellular organisms → Bacteria | 6077 | Open in IMG/M |
| 3300025986|Ga0207658_11295097 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300026023|Ga0207677_10622624 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300026075|Ga0207708_11490030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300026088|Ga0207641_11536958 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300026088|Ga0207641_11695614 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300026095|Ga0207676_10433158 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300026095|Ga0207676_11935625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300026095|Ga0207676_11973978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300026116|Ga0207674_10136640 | All Organisms → cellular organisms → Bacteria | 2413 | Open in IMG/M |
| 3300026118|Ga0207675_101971138 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300026121|Ga0207683_10007588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9293 | Open in IMG/M |
| 3300026121|Ga0207683_10354129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1348 | Open in IMG/M |
| 3300026121|Ga0207683_11160728 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300026121|Ga0207683_11553767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300026320|Ga0209131_1030396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3170 | Open in IMG/M |
| 3300027045|Ga0207726_1054204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300027063|Ga0207762_1065720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300027609|Ga0209221_1002708 | All Organisms → cellular organisms → Bacteria | 4418 | Open in IMG/M |
| 3300027880|Ga0209481_10523064 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300027895|Ga0209624_10736643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300027907|Ga0207428_10323124 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300027908|Ga0209006_11120382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300028381|Ga0268264_11561520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300028803|Ga0307281_10413033 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300028884|Ga0307308_10347274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300028906|Ga0308309_11259700 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300029636|Ga0222749_10549890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300029910|Ga0311369_10847211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300030007|Ga0311338_11380396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300030047|Ga0302286_10655036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300030058|Ga0302179_10044272 | All Organisms → cellular organisms → Bacteria | 2021 | Open in IMG/M |
| 3300030617|Ga0311356_11540103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300031057|Ga0170834_108096727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300031231|Ga0170824_117883661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1329 | Open in IMG/M |
| 3300031236|Ga0302324_101238638 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300031366|Ga0307506_10353737 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031562|Ga0310886_10504529 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300031573|Ga0310915_11211534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300031708|Ga0310686_105098501 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300031708|Ga0310686_107712599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1360 | Open in IMG/M |
| 3300031708|Ga0310686_109546785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300031845|Ga0318511_10289667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300031854|Ga0310904_10492169 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300031858|Ga0310892_10797088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300031910|Ga0306923_11226018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300031910|Ga0306923_12160971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300031943|Ga0310885_10004489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4385 | Open in IMG/M |
| 3300031944|Ga0310884_10726785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300031946|Ga0310910_10364184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300031947|Ga0310909_11415652 | Not Available | 556 | Open in IMG/M |
| 3300031947|Ga0310909_11471953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300031954|Ga0306926_11810759 | Not Available | 693 | Open in IMG/M |
| 3300032094|Ga0318540_10112615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1287 | Open in IMG/M |
| 3300032122|Ga0310895_10299074 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300032782|Ga0335082_10640829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300032805|Ga0335078_10009266 | All Organisms → cellular organisms → Bacteria | 14592 | Open in IMG/M |
| 3300032805|Ga0335078_10949455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300032805|Ga0335078_11687782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300032828|Ga0335080_10485766 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300032892|Ga0335081_10169676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3080 | Open in IMG/M |
| 3300032892|Ga0335081_11003822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300032893|Ga0335069_12115032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300033513|Ga0316628_103568213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300034670|Ga0314795_069307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.04% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.17% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.17% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.30% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.30% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.30% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.30% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.30% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.87% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.43% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.43% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.43% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.43% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.43% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034670 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_117807083 | 3300000890 | Soil | MIGRALGCVVVCGCLMASASLQAHHSLAGVYDMKAEK |
| C688J18823_105305772 | 3300001686 | Soil | MTGRISGCLILCAAMLAGVSLQAHHSLAGVYDMKKETELS |
| Ga0062589_1028697732 | 3300004156 | Soil | MNKRMLVCVVLCGFMTAGSLLAHHSLAGVYDMKKDMELSG |
| Ga0062590_1005865811 | 3300004157 | Soil | MSRRTLGGVVLCGWLLAAGSLQAHHSLAGVYDMHKEAEVHGAVEKIQ |
| Ga0062592_1010266582 | 3300004480 | Soil | MIGRALGYVVACGCLMAGASLQAHHSLAGVYDMKGEKEIAGTLTQIK |
| Ga0062592_1019373891 | 3300004480 | Soil | MIKRVLGCVVVCGCLMASASLQAHHSLAGVFDMKAEKEIDGTLTAIKFVN |
| Ga0062591_1013547963 | 3300004643 | Soil | MIGRALGCVVLCGCLMAGASLQAHHSLAGVFDMKAEKEIDGTLTAIKFVN |
| Ga0066684_110441461 | 3300005179 | Soil | MIGRALGCVVVCGCLVAGASLQAHHSLAGVYDMKAEKEIAGTLTTIKFVNPH |
| Ga0066675_102745773 | 3300005187 | Soil | MIKRTLGCVALYGCLMGLLASGQLQAHHSLAGVYDMKKESEM |
| Ga0066388_1077253141 | 3300005332 | Tropical Forest Soil | MLKRTLGRAALLGLLMASGPLQAHHSLAGVYDMKAEKEVSG |
| Ga0070677_106262212 | 3300005333 | Miscanthus Rhizosphere | MTKRILGCVLVCGWLGAAASLQAHHSLAGVYDMNREEEKSGALTSI |
| Ga0070666_102940611 | 3300005335 | Switchgrass Rhizosphere | MIGRALGCVVVCGCLMLGASVQAHHSLAGVYDMKAEKEIAGTLTAI |
| Ga0070682_1005929441 | 3300005337 | Corn Rhizosphere | MIGRALGCVVVCGCLMLGASVQAHHSLAGVYDMKAEKEIAG |
| Ga0070692_102645881 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKRTLGCVALFGWLMASGLQAHHSLAGVYDMKAEKEITG |
| Ga0070675_1012421411 | 3300005354 | Miscanthus Rhizosphere | MIKRTLVGCLALVGLMASVSLQAHHSLAGVYDMKADKEVS |
| Ga0070675_1014512011 | 3300005354 | Miscanthus Rhizosphere | MIGRTLGCALVCGCLLAGAALQAHHSLAGVYDMKAEKEIAG |
| Ga0070674_1014217372 | 3300005356 | Miscanthus Rhizosphere | MVRRALGCVVVCGCLMAGASLQAHHSLAGVFDMKAEKEIDGTLTA |
| Ga0070674_1021600081 | 3300005356 | Miscanthus Rhizosphere | MFKRTLGCVAVAGWLLASGSLFAHHSLAGVYDMKDEKEIA |
| Ga0070667_1014525702 | 3300005367 | Switchgrass Rhizosphere | MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTLTAIK |
| Ga0070705_1013299642 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAG |
| Ga0066681_103598251 | 3300005451 | Soil | MIKRTFGYLALCGLLASGSLQAHHSLAGVYDMKKEMEMSGSVE |
| Ga0070685_102979462 | 3300005466 | Switchgrass Rhizosphere | MIKRILGGVALLGLMASTTLLAHHSLAGVYDMKAEKELSG |
| Ga0070698_1013056542 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKRTVGCVLLGGLLMAGVSVQAHHSLAGVYDMKKEAEVSGSVEKIQFV |
| Ga0070734_106943593 | 3300005533 | Surface Soil | MIKRTLVCVVLCGFMTAGSLMAHHSLAGVYDMKKDMELS |
| Ga0070735_105883612 | 3300005534 | Surface Soil | MIKRTLGWVALCGFLMTASVSLQAHHSLAGVYDMKK |
| Ga0070684_1002867691 | 3300005535 | Corn Rhizosphere | MKRTLKCVALCGWLMAGKSLLAHHSLAATYDVKKEMELSGE |
| Ga0070733_110734141 | 3300005541 | Surface Soil | MIKRTFEYVALCVSFMAATGLMQAHHSLAEVYDMKAEKELTGT |
| Ga0070686_1008584692 | 3300005544 | Switchgrass Rhizosphere | MIGRALGCIVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTL |
| Ga0066698_106574942 | 3300005558 | Soil | MIKRTLGCVALCGWLMAGGSLQAHHSLAGVYDMKKEMEM |
| Ga0070761_104294391 | 3300005591 | Soil | MIKRIFGCVALCGWLVAGAGLLQAHHSLAGVYDMKNEKEMSGT |
| Ga0066706_111836301 | 3300005598 | Soil | MIKRTLGYVALYGCVMGLLASGQLQAHHSLAGVYDMKADKEVSGTIK |
| Ga0070702_1001678011 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKRTVGCVLVGGLLMAGVSLQAHHSLAGVYDMKKEAEVSGSVEKIQFV |
| Ga0068864_1010160002 | 3300005618 | Switchgrass Rhizosphere | MIKRTLGCVALFGWLMASGLQAHHSLAGVYDMKAEKE |
| Ga0070764_108404641 | 3300005712 | Soil | MTQRTLGTLALFGWLMAASSTLQAHHSLAGVYDMKKETVMSGTVASIKFSNP |
| Ga0068866_112879032 | 3300005718 | Miscanthus Rhizosphere | MVRRALGCVVVCGCLMTGVSLQAHHSLAGVFDMKAEKEIDGTLTA |
| Ga0066903_1012237583 | 3300005764 | Tropical Forest Soil | MIKRTLVCVVLCGFMTAGSLLAHHSLAGVYDMKKDMELSG |
| Ga0066903_1016549181 | 3300005764 | Tropical Forest Soil | MIKRTLGCVVLFSLMATISLQAHHSLAGVYDMKKEVEMEGSLDS |
| Ga0066903_1041170911 | 3300005764 | Tropical Forest Soil | MKGRTLGWVVCGWLMAGGAVMAHHSLAGVYDMKAKDSEVAGTL |
| Ga0066903_1077665922 | 3300005764 | Tropical Forest Soil | MIKRTLGCLAFCGLLASGSLQAHHSLAGVYDMKKEMEM |
| Ga0074470_111750402 | 3300005836 | Sediment (Intertidal) | MITRTLGCVALWGWLMASGSLQAHHSLAGVYDMKKDMELSGAVET |
| Ga0074470_116302063 | 3300005836 | Sediment (Intertidal) | MIKRTLAGCLALGGLCVWMASVSLQAHHSLAGVYDMKKDMELAG |
| Ga0068870_114598742 | 3300005840 | Miscanthus Rhizosphere | MIGRALGCIVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTLT |
| Ga0068863_1002620223 | 3300005841 | Switchgrass Rhizosphere | MTKRIMGCVALGAWLLAGVALQAHHSLAGVYDMKKESE |
| Ga0068863_1020252532 | 3300005841 | Switchgrass Rhizosphere | MLKRTLVPVAFFCGWLIANGSLQAHHSLAGVYDMKAEKEIAGTVEKVQ |
| Ga0068858_1002446661 | 3300005842 | Switchgrass Rhizosphere | MTKRIMGCVALGAWLLAGVALQAHHSLAGVYDMKKESEVAGSVEKIQFV |
| Ga0068862_1018918961 | 3300005844 | Switchgrass Rhizosphere | MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEK |
| Ga0070766_102517331 | 3300005921 | Soil | MIQRTLGSLALLGWLMAASVSLQAHHSLAGVYDMKKETNVEGT |
| Ga0081455_109665791 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MIKRTLGCVALCGWLMGSGSLQAHHSLAGVYDMKKEMEMSGEVES |
| Ga0066656_103870761 | 3300006034 | Soil | MIKRTLGCVALCGWLMANGSLQAHHSLAGVYDMKKETELS |
| Ga0066652_1016129041 | 3300006046 | Soil | MIKRTLGCVALCGCLLSLLASGQLQAHHSLAGVYDMKKEMELSG |
| Ga0075417_104754552 | 3300006049 | Populus Rhizosphere | MIKRTLGCVAVCGWLMASGSLQAHHSLAGVYDMKKEMEMSGE |
| Ga0075026_1010577761 | 3300006057 | Watersheds | MKRTQMMQRTLGYAVLCGWLMASATLQAHHSLAGVYDMKKDME |
| Ga0075017_1001605561 | 3300006059 | Watersheds | MIKRTLGCVALFGWLMATNTSLQAHHSLAVVYDMEAEKEMSGT |
| Ga0075014_1006871351 | 3300006174 | Watersheds | MLKRILGCVALCGCLMIASGTLQAHHSLAGVYDMKAEKELSG |
| Ga0075014_1009085133 | 3300006174 | Watersheds | MIGRALGRVVVCGCLMAGVSLEAHHSLAGVYDMKAEKEI |
| Ga0097621_1003872301 | 3300006237 | Miscanthus Rhizosphere | MIGRALGCVVVCGCLMLGASVQAHHSLAGVYDMKAEKEI |
| Ga0097621_1005853301 | 3300006237 | Miscanthus Rhizosphere | MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIVGT |
| Ga0097621_1006764491 | 3300006237 | Miscanthus Rhizosphere | MIGRALGYVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTLTAIKFVNP |
| Ga0068871_1000015981 | 3300006358 | Miscanthus Rhizosphere | MKRTLKCVALCGWLMAGKSLLAHHSLAATYDVKKEMELSGEVEQI |
| Ga0068871_1010413322 | 3300006358 | Miscanthus Rhizosphere | MTKRTLGCVVVYGVLMASGVLQAHHSLAGVYDMKKESEVAGSVEK |
| Ga0068871_1015991822 | 3300006358 | Miscanthus Rhizosphere | MIKRILGGVALLGLMASTTLLAHHSLAGVYDMKSEKELTGTVK |
| Ga0066665_108303221 | 3300006796 | Soil | MMKRILACVVLCGFMTAGSLLAHHSLAGVYDMKKDMELSGSL |
| Ga0079221_113192351 | 3300006804 | Agricultural Soil | MIKRTIVCVVLCGFIMAGSLLAHHSLAGVYDMKKD |
| Ga0075428_1006459471 | 3300006844 | Populus Rhizosphere | MNARTLGCVVMFGWLMAGTMAQAHHSLAATYDIRKESE |
| Ga0075428_1008258351 | 3300006844 | Populus Rhizosphere | MIGRALGCVVLCGWLMAGASLQAHHSLAGVYDMKAEKE |
| Ga0075425_1015317181 | 3300006854 | Populus Rhizosphere | MTKRILVCVVLCGFMTAGSLLAHHSLAGVYDMKKDMELSG |
| Ga0075424_1011080591 | 3300006904 | Populus Rhizosphere | MIKRILVCVVLCGFMTAGSLLAHHSLAGVYDMKKDMELSG |
| Ga0075436_1015536271 | 3300006914 | Populus Rhizosphere | MKRTLGCLALFGWLMMGSLQAHHSLAGVYDMKGEKELSGEV |
| Ga0079216_111798222 | 3300006918 | Agricultural Soil | MTKRIAGCIALCGFVMAASLQAHHSLAGVYDMKKEAEMAGAVE |
| Ga0075435_1002804803 | 3300007076 | Populus Rhizosphere | MIKRTLGCLALCGWLMAGGPLQAHHSLAGVYDMKKEM |
| Ga0075435_1003836401 | 3300007076 | Populus Rhizosphere | MIKRTLGCVVLCGLMASVSLQAHHSLAGVYDMKKDMELS |
| Ga0099795_105853301 | 3300007788 | Vadose Zone Soil | MIKRTLGSVVVLGAVLIAGASLQAHHSLAGVYDMKAEKEIAGT |
| Ga0105247_100161781 | 3300009101 | Switchgrass Rhizosphere | MVKKAMGVLVAVSGLMMAGASLQAHHSLAGVYDMKAEKEINGTLTAI |
| Ga0111538_120722402 | 3300009156 | Populus Rhizosphere | VIKRTLGCLVLGGLMASGSLLAHHSLAGVYDMKGEME |
| Ga0105248_114287881 | 3300009177 | Switchgrass Rhizosphere | VALLGLLMASGSLQAHHSLAGVYDMKAEKELTGTVEK |
| Ga0105238_117012372 | 3300009551 | Corn Rhizosphere | MIKRIPGCVALLASLIAASGSLQAHHSLAGVYDMKKE |
| Ga0105249_127619781 | 3300009553 | Switchgrass Rhizosphere | MTKWTVGCVVLCGCLIAGVSLQAHHSLAGVYDVKANDG* |
| Ga0126315_109534991 | 3300010038 | Serpentine Soil | MIARTLGCVVLGGWVMAGAAVQAHHSLAGVYDMKKETEL |
| Ga0126384_121625671 | 3300010046 | Tropical Forest Soil | MVKRTLGRIVLCGLIASSSLLAHHSLAGVYDMKKEME |
| Ga0126382_101112891 | 3300010047 | Tropical Forest Soil | MIKRILVFVVLCEFMTAGSLLAHHSLAGVYDMKKDMELSGAVESVKFV |
| Ga0126382_101433942 | 3300010047 | Tropical Forest Soil | MIKRTLVCVVLCGFMTAGSLLAHHSLAGVYDMKKDMEVSG |
| Ga0126373_101419165 | 3300010048 | Tropical Forest Soil | MVKRSLGYAALFGWLMATGPLQAHHSLAGVYDMKAEKELSGEVAQIKFS |
| Ga0126373_102992053 | 3300010048 | Tropical Forest Soil | MIKRTLGFVATLCAAAGLLQAHHSLAGVYDMKAEKELQGEVAQIKFSNPHGSL |
| Ga0126370_125781921 | 3300010358 | Tropical Forest Soil | MIKRTLVCVALCGFMTAGSLLAHHSLAGVYDMKKDMEL |
| Ga0126370_126122212 | 3300010358 | Tropical Forest Soil | MIKRTLGWAALGAWLMAGSLQAHHSLAGVYDMKAE |
| Ga0126372_112025421 | 3300010360 | Tropical Forest Soil | MFKRILGSVAVFGWLMAVGPLQAHHSLAGVYDMKTDKELSGT |
| Ga0105239_128593311 | 3300010375 | Corn Rhizosphere | MMKRTSGFVALCGWLMASGSLLAHHSLAATYDVKKEME |
| Ga0126381_1044211382 | 3300010376 | Tropical Forest Soil | MIKRILGCAAVVALMTGSLLAHHSLAGVYDMKGDKEVSGEVSSIKFS |
| Ga0150983_151658053 | 3300011120 | Forest Soil | MKRILGSVALLGLLLTGSVTLQAHHSLAGVYDMKNPKEMSGTVA |
| Ga0157352_10608011 | 3300012519 | Unplanted Soil | MIGRIFGCLVVCGLVASVSLQAHHSLAGVYDMKAEK |
| Ga0137397_100198755 | 3300012685 | Vadose Zone Soil | MIKRTLVCIVLCGFMTAGSLLAHHSLAGVYDMKKDME |
| Ga0137407_114727931 | 3300012930 | Vadose Zone Soil | MLKRTLGCAALLCGWLMASGSLWAHHSLAGVYDMK |
| Ga0126375_101994531 | 3300012948 | Tropical Forest Soil | MIKRTLVCVVLCGFMTAGSLLAHHSLAGVYDMKKD |
| Ga0126375_102478461 | 3300012948 | Tropical Forest Soil | MVKRTLGCVALCGWLMAGSSLQAHHSLAGVYDMKKEMEM |
| Ga0164309_114919022 | 3300012984 | Soil | MIKRTLGGLALLGLLMAGALQAHHSLAGVYDMKAQ |
| Ga0163162_134014362 | 3300013306 | Switchgrass Rhizosphere | MFKRTLGCVAVAGWLLASGSLFAHHSLAGVYDMKDEK |
| Ga0157375_125214602 | 3300013308 | Miscanthus Rhizosphere | VALLGLLMASGSLQAHHSLAGVYDMKAEKELTGTVE |
| Ga0157380_112318391 | 3300014326 | Switchgrass Rhizosphere | MTKRILGCVLVCGWLGAAASLQAHHSLAGVYDMNREEEKSGALTSIRL |
| Ga0157377_115952801 | 3300014745 | Miscanthus Rhizosphere | MTKRTVGCVLLGGLLMAGVSLQAHHSLAGVYDMKK |
| Ga0173483_103855522 | 3300015077 | Soil | MIRRAVGCVVVCGCLMAGASLQAHHSLAGVYDMKAEK |
| Ga0173480_110481581 | 3300015200 | Soil | MIGRALGCVVLCGCLMAGASLQAHHSLAGVFDMKAEKE |
| Ga0173478_100407153 | 3300015201 | Soil | MIGRALGCVVLCGCLMASASLQAHHSLAGVFDMKAE |
| Ga0132256_1007702981 | 3300015372 | Arabidopsis Rhizosphere | MIARTLGCVVLGGWLMASVSLQAHHSLAGVYDMKKE |
| Ga0132257_1002695111 | 3300015373 | Arabidopsis Rhizosphere | MFYGGALMIGRTLGCALVGGCLVAGVALEAHPSLAGVYDMKKETELS |
| Ga0132255_1028679632 | 3300015374 | Arabidopsis Rhizosphere | MIKRILVCVVLCGFMTAGSLLAHHSLAGVYDMKKDM |
| Ga0182037_104401332 | 3300016404 | Soil | MIKRALGCVVACGCLMAGASLQAHHSLAGVYDMKSE |
| Ga0182039_114997782 | 3300016422 | Soil | MIKRTLVCVVLGGFMTAGSLLAHHSLAGVYDMKKDMELS |
| Ga0182039_118776281 | 3300016422 | Soil | MIKRTLVCVVLCGFMTAGSLLAHHSLAGVYDMKKDMEL |
| Ga0134083_101625871 | 3300017659 | Grasslands Soil | MIKRTFGYLALCGLLASGSLQAHHSLAGVYDMKKEMEMS |
| Ga0163161_106576172 | 3300017792 | Switchgrass Rhizosphere | MTVRTLGCVVLCGCLMTTAVLQAHHSLAGVYDMKQES |
| Ga0163161_116537311 | 3300017792 | Switchgrass Rhizosphere | MIKRTLLCLAIFGLTASTTLLAHHSLAGVYDMQAKDGEVS |
| Ga0187801_103963552 | 3300017933 | Freshwater Sediment | MIKRTLGYVALFGCLMAASSSLQAHHSLAGVYDMKKETN |
| Ga0187785_107115261 | 3300017947 | Tropical Peatland | MIKRTLGCVALYGLLATGLLQAHHSLAGVYDMKAEKELAGTVTSIK |
| Ga0190266_102382901 | 3300017965 | Soil | MIGRTFGCVVLCGWLMVIASLQAHHSLAGVYDMRKEG |
| Ga0187873_10260961 | 3300018013 | Peatland | MIQRTLGCVALFGWLMAASVSLQAHHSLAGVYDMKK |
| Ga0187858_102566814 | 3300018057 | Peatland | MIKRTLGFVAMWGLMATGLLQAHHSLAGVYDMKKDMELSGTVGQI |
| Ga0187765_105266832 | 3300018060 | Tropical Peatland | MIKRALGCVVACGFLMAGVSLQAHHSLAGVYDMKSEKEIVG |
| Ga0184628_106597662 | 3300018083 | Groundwater Sediment | MNKRTVGCALLGGLLMAGVSLQAHHSLAGVYDMKK |
| Ga0187771_118279421 | 3300018088 | Tropical Peatland | MIKRTFACLALLGLLMAAGVSLWAHHSLAGVYDMKNEKE |
| Ga0190270_127973022 | 3300018469 | Soil | MIGRILGCVVLCGWLMAGVALQAHHSLAATYDIRKESEMS |
| Ga0190274_109124352 | 3300018476 | Soil | MNKRTVGCVVVYGVLMASGVLQAHHSLAGVYDMKKESEV |
| Ga0190271_119709351 | 3300018481 | Soil | MAGRILGCVVLGGWLVASVSLQAHHSLAGVYDMKKDAE |
| Ga0184644_16415632 | 3300019269 | Groundwater Sediment | MMGRMWGCVIVCGWLMAGGSLQAHHSLAGVYDMKGEK |
| Ga0173479_108715741 | 3300019362 | Soil | MIGRVLGCVVVCGILMAGASLQAHHSLAGVYDMKSEKE |
| Ga0210403_106108492 | 3300020580 | Soil | MIQRTLGFVALCGWLMAASGSLQAHHSLAGVYDMKKETN |
| Ga0210388_116166512 | 3300021181 | Soil | MIKRTLGCVALFGWLTVAAVSLQAHHSLAGVYDMKKETNIEGTVASIKFS |
| Ga0210385_103220621 | 3300021402 | Soil | MIKRTLGCVALCGWLLASTGLLQAHHSLAGVYDMKNE |
| Ga0210389_104934641 | 3300021404 | Soil | MIKRTLGYVALFGWLMTSAVSLQAHHSLAGVYDMKAEKELQGTVTS |
| Ga0210386_113814192 | 3300021406 | Soil | MIKRTLGCAALFGWLMAASVSLQAHHSLAGVYDMKKETN |
| Ga0210384_116919541 | 3300021432 | Soil | MIKRTALCVALCGLMASGSLLAHHSLAGVYDTKAKDSEISGSVETIKFVN |
| Ga0210391_114418491 | 3300021433 | Soil | MKRTLGCVALLGWLMTAAVSLQAHHSLAGVYDMKKETNLEGTVASIKF |
| Ga0182009_101216953 | 3300021445 | Soil | MVKRIFGSVLVGVCVMGGASLQAHHSLAGVYDMSAEKEI |
| Ga0210390_103442473 | 3300021474 | Soil | MFQRTLGCVALFGCLMATSVSLQAHHSLAGVYDMKKETNVEG |
| Ga0209640_104316401 | 3300025324 | Soil | MIKRTLGCVVVGGWLIASVSLQAHHSLAATYDIRKE |
| Ga0209342_112953101 | 3300025326 | Soil | MIKRTLVCVALFGLMATGSLLAHHSLAGVYDMVGNKE |
| Ga0209483_10593701 | 3300025862 | Arctic Peat Soil | MIRRAFGCVVVCGCLMAGASLQAHHSLAGVYDMKGEKEVTGTLTIIKFVN |
| Ga0207682_105905421 | 3300025893 | Miscanthus Rhizosphere | MTKRIWKSVLVCGWLLAAASLQAHHSLAGVYDMNKEEEKTGTLASIR |
| Ga0207642_100076406 | 3300025899 | Miscanthus Rhizosphere | MIGRALGCVVVCGCLMLGASVQAHHSLAGVYDMKAEKEIAGTL |
| Ga0207710_100491852 | 3300025900 | Switchgrass Rhizosphere | MVKKAMGVLVAVSGLMMAGASLQAHHSLAGVYDMKAEKEINGTLTAIKFVN |
| Ga0207688_106366442 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRRALGCVVVCGCLMAGASLQAHHSLAGVYDMKA |
| Ga0207699_108148722 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKRTLICVVLCGFMTAGSLLAHHSLAGVYDMKKDM |
| Ga0207654_100242714 | 3300025911 | Corn Rhizosphere | MVKRTLASVVLLYGWLMTSGLLQAHHSLAGVYDMKAEKELTGTVEKVQFV |
| Ga0207660_110829601 | 3300025917 | Corn Rhizosphere | MIGRALGCVVVCGCLMAGASLQAHHSLAGVFDMKAEKEI |
| Ga0207662_107038011 | 3300025918 | Switchgrass Rhizosphere | MIKRILGGVAVLGLLASTTLQAHHSLAGVYDMKSEKELTGTVKSIKF |
| Ga0207681_102762281 | 3300025923 | Switchgrass Rhizosphere | MTVRTLGSVVLCGCLTATGVLQAHHSLAGVYDMKQEKELSGS |
| Ga0207681_109919931 | 3300025923 | Switchgrass Rhizosphere | MIRRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTL |
| Ga0207681_112977241 | 3300025923 | Switchgrass Rhizosphere | MIGRALGCVVVCGCLMAGASLQAHHSLAGVFDMKAEKEIDGTL |
| Ga0207650_108314592 | 3300025925 | Switchgrass Rhizosphere | MIRRVLGCVVVCGCLMAGASLQAHHSLAGVFDMKSE |
| Ga0207659_109159281 | 3300025926 | Miscanthus Rhizosphere | MTVRTLGSAVFCGCLIATASLGAHHSLAGVYDMKKESEVAG |
| Ga0207659_117725411 | 3300025926 | Miscanthus Rhizosphere | MIKRTLVGCLALVGLMASVSLQAHHSLAGVYDMKADKEVSGTIKS |
| Ga0207701_108103822 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGRILGGVVLCGWLLAAGSLQAHHSLAGVYDMHKEAEVHG |
| Ga0207644_112492291 | 3300025931 | Switchgrass Rhizosphere | MIRRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKE |
| Ga0207709_110689751 | 3300025935 | Miscanthus Rhizosphere | MIGRALGRVVVCGCLMAGASLQAHHSLAGVYDMKGEKEIAGTLTQI |
| Ga0207670_100913622 | 3300025936 | Switchgrass Rhizosphere | MIKRTLGCVALLGWLMASGSLQAHHSLAGVYDMKST |
| Ga0207670_110128013 | 3300025936 | Switchgrass Rhizosphere | IKRILGGVAVLGLLASTTLQAHHSLAGVYDMKSEKELTGTVNRSSL |
| Ga0207670_113207641 | 3300025936 | Switchgrass Rhizosphere | MIKRTLVCVALVSLMATGSLLAHHSLAGVYDMKADKE |
| Ga0207670_118559331 | 3300025936 | Switchgrass Rhizosphere | MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAG |
| Ga0207691_100509422 | 3300025940 | Miscanthus Rhizosphere | MNKRTVGCVLVGGLLMAGVSLQAHHSLAGVYDMKKEAEVSGS |
| Ga0207711_108399411 | 3300025941 | Switchgrass Rhizosphere | MTKRIMGCVALGAWLLAGVALQAHHSLAGVYDMKKESEVAGSV |
| Ga0207711_111791002 | 3300025941 | Switchgrass Rhizosphere | MIGRALGYIVVCGCLMTGASLQAHHSLAGVYDMKAEKEIAGT |
| Ga0207711_113451611 | 3300025941 | Switchgrass Rhizosphere | MKRTLKCVALCGWLMAGKSLLAHHSLAATYDVKKEMELS |
| Ga0207711_114975842 | 3300025941 | Switchgrass Rhizosphere | MTRTLGCVVLCGCLMGGASLQAHHSLAGVYDMKAEKEIAGT |
| Ga0207711_120287431 | 3300025941 | Switchgrass Rhizosphere | MIGRALGYVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTLTLIK |
| Ga0207679_108522101 | 3300025945 | Corn Rhizosphere | MIRRALGYVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTL |
| Ga0207651_110308662 | 3300025960 | Switchgrass Rhizosphere | MIRRTSSCVVLFGWLMASTSLQAHHSLAGVYDMHKE |
| Ga0207712_100097811 | 3300025961 | Switchgrass Rhizosphere | MVKRTLGCVAVLGLMASVSLQAHHSLAGVYDMKAEKELT |
| Ga0207658_112950971 | 3300025986 | Switchgrass Rhizosphere | MIRRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGTLTAIKF |
| Ga0207677_106226242 | 3300026023 | Miscanthus Rhizosphere | MMNRTLGCVALCGWLMSSGSLLAHHSLAASYDVKKEMELSGE |
| Ga0207708_114900301 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKRTLFFLAMLGVMASSTLLAHHSLAGVYDMQAKD |
| Ga0207641_115369581 | 3300026088 | Switchgrass Rhizosphere | MIGRTLGCALVCGCLMAGAALQAHHSLAGVYDMKKETELS |
| Ga0207641_116956141 | 3300026088 | Switchgrass Rhizosphere | MKRILGCAVVCGWLMASGSLQAHHSLAGVYDMKAEKEIAGTLTKIQFVN |
| Ga0207676_104331582 | 3300026095 | Switchgrass Rhizosphere | MIRRAVGCVVVCGCLMAGASLQAHHSLAGVYDMKAE |
| Ga0207676_119356252 | 3300026095 | Switchgrass Rhizosphere | MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKE |
| Ga0207676_119739781 | 3300026095 | Switchgrass Rhizosphere | MVRRILGCVVMFGWLMAGVSLQAHHSLAGVYDMHKEAEVS |
| Ga0207674_101366401 | 3300026116 | Corn Rhizosphere | MIGRVLRCVVVCGCLMAAAPLQAHHSLAGVYDMKSEKEV |
| Ga0207675_1019711382 | 3300026118 | Switchgrass Rhizosphere | MTVRTLGSVVLCGYVMAAATLQAHHSLAGVYDMKQA |
| Ga0207683_100075888 | 3300026121 | Miscanthus Rhizosphere | MVRRALGCVVVCGCLMAGASLQAHHSLAGVFDMKAEKEI |
| Ga0207683_103541293 | 3300026121 | Miscanthus Rhizosphere | MIKRTLGGLALLGLLMASALQAHHSLAGVYDMKAQKEIAGTLDKIQFV |
| Ga0207683_111607281 | 3300026121 | Miscanthus Rhizosphere | MIRRVLGCVVVCGCLMAGASLQAHHSLAGVYDMKSEKTI |
| Ga0207683_115537672 | 3300026121 | Miscanthus Rhizosphere | MIQRTRCSTIVCVALFGLMASGLQAHHSLAGVYDM |
| Ga0209131_10303961 | 3300026320 | Grasslands Soil | MIGRALGRVVVCGCLMAGASLQAHHSLAGVYDMKAEKEI |
| Ga0207726_10542042 | 3300027045 | Tropical Forest Soil | MIKRTLGCVALYGFLATGWLQAHHSLAGVYDMKAEKELAGT |
| Ga0207762_10657201 | 3300027063 | Tropical Forest Soil | MIKRTLGCVALYGFLATGWLQAHHSLAGVYDMKAEKELAG |
| Ga0209221_10027084 | 3300027609 | Forest Soil | MIKRTVGSVVLVGWLMAASVSLQAHHSLAGVYDMKGRKNFPGW |
| Ga0209481_105230642 | 3300027880 | Populus Rhizosphere | MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKDIAG |
| Ga0209624_107366431 | 3300027895 | Forest Soil | MIKRTLGWVALAGWFMAASVSLQAHHSLAGVYDMKQDK |
| Ga0207428_103231241 | 3300027907 | Populus Rhizosphere | MTKRTVGCVLLGGLLMAGVSLQAHHSLAGVYDMKKEAEVS |
| Ga0209006_111203821 | 3300027908 | Forest Soil | MIKRTLGSVALFGCLMAASSSLQAHHSLAGVYDMKKETNVEGTVASIKFS |
| Ga0268264_115615201 | 3300028381 | Switchgrass Rhizosphere | MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKADKEIA |
| Ga0307281_104130331 | 3300028803 | Soil | MMKRIFGSVVMCGCLMAGVALQAHHSLAGVYDMKG |
| Ga0307308_103472741 | 3300028884 | Soil | MIGRALGCVVVCGCLMAGASLQAHHSLAGVYDMKGEKEIAGT |
| Ga0308309_112597001 | 3300028906 | Soil | MIKRTLGCVALWGVLASGSLQAHHSLAGVYDMKAEKEITG |
| Ga0222749_105498902 | 3300029636 | Soil | MIGRTLGCSVLCVWLMAGGSLQAHHSLAGVYDMKGEKEVLGTLTIIKFV |
| Ga0311369_108472111 | 3300029910 | Palsa | MIQRILGCLALFGWLTAASVSLQAHHSLAGVYDMKKETIVSGTVTTIKFSNPHGSL |
| Ga0311338_113803962 | 3300030007 | Palsa | MIQRILGCLALFGWLTAASVSLQAHHSLAGVYDMKKETIVSGTVTTI |
| Ga0302286_106550361 | 3300030047 | Fen | MIKRTLGRVALCGWSVVGSGVLQAHHSLAGVYDMKGDKEVAG |
| Ga0302179_100442724 | 3300030058 | Palsa | MTQRTLGSLALFGWLMAASSTLQAHHSLAGVYDMKKETVVS |
| Ga0311356_115401032 | 3300030617 | Palsa | MTQRTLGSLALFGWLMAASSTLQAHHSLAGVYDMKK |
| Ga0170834_1080967274 | 3300031057 | Forest Soil | MIKRTLGFVALCGWLMAASGSLLAHHSLAGVYDMKKETNLSG |
| Ga0170824_1178836614 | 3300031231 | Forest Soil | MIKRTLGFVALCGWLMAASGSLLAHHSLAGVYDMKKE |
| Ga0302324_1012386381 | 3300031236 | Palsa | MIYKRPLGPAAFLCGLLMACASLQAHHSLAGVYDMKAE |
| Ga0307506_103537371 | 3300031366 | Soil | MNKRTVGCALLGGLLMAGVSLQAHHSLAGVYDMKKEAEVSG |
| Ga0310886_105045292 | 3300031562 | Soil | MTGRILGCAVVCGWLMAAGSLQAHHSLAGVYDMKK |
| Ga0310915_112115341 | 3300031573 | Soil | MVKRTLVGLALCGLMATGSLLAHHSLAGVYDMKKDMELA |
| Ga0310686_1050985012 | 3300031708 | Soil | MIKRTLGCVALFGWLMAASVSLQAHHSLAGVYDMKK |
| Ga0310686_1077125994 | 3300031708 | Soil | MIKRTLGCVALFGCLVASTGLLQAHHSLAGVYDMKNEKEMSGTVASIKF |
| Ga0310686_1095467851 | 3300031708 | Soil | MVKRTLGSIAFFGLLMTVGGTLQAHHSLAGVYDMKAEKEMAG |
| Ga0318511_102896672 | 3300031845 | Soil | MLRRILGYVALWGWLMTCGPLQAHHSLAGVYDMKAEKELSGEV |
| Ga0310904_104921692 | 3300031854 | Soil | MIGRTFGCVVLCGWLMVTASLQAHHSLAGVYDMRK |
| Ga0310892_107970882 | 3300031858 | Soil | MIGRALGWVVVCGYLMAGASLQAHHSLAGVYDMKA |
| Ga0306923_112260182 | 3300031910 | Soil | MIKRALGCVVACGCLIAGVSLQAHHSLAGVYDMKAEKEIQGTLSVIK |
| Ga0306923_121609711 | 3300031910 | Soil | MIKRTLVGVVLCGFMTAGSLLAHHSLAGVYDMKKD |
| Ga0310885_100044891 | 3300031943 | Soil | MVRRILGCVVMFGWLMAGVSLQAHHSLAGVYDMHKE |
| Ga0310884_107267852 | 3300031944 | Soil | MIGRALGCIVVCGCLMAGASLQAHHSLAGVYDMKAEKEIAGT |
| Ga0310910_103641841 | 3300031946 | Soil | MLRRILGYVALCGWLMTCGPLQAHHSLAGVYDMKAEKDVTGSVEK |
| Ga0310909_114156521 | 3300031947 | Soil | MIRRALGCVVACGCLMAGASLQAHHSLAGVYDMKSEKE |
| Ga0310909_114719531 | 3300031947 | Soil | MIKRILGCAALCAWLMASGSLQAHHSIAGVYDMRKDMELEGAVEKI |
| Ga0306926_118107592 | 3300031954 | Soil | MIGRTLGCLVLCGCFFAGVSLQAHHSLAGVYDIRQDAQV |
| Ga0318540_101126154 | 3300032094 | Soil | MLRRILGYVALWGWLMTCGPLQAHHSLAGVYDMKAEKELSGEVAQIKFS |
| Ga0310895_102990741 | 3300032122 | Soil | MIRRALGCVVVCGCLMAGASLQAHHSLAGVYDMKAEKDI |
| Ga0335082_106408291 | 3300032782 | Soil | MKRILGCMALFGWLMAGSLQAHHSLAGVYDMKAEKEVSGEVASIK |
| Ga0335078_1000926614 | 3300032805 | Soil | MVKRTLGFSALVCGWLMASGLLQAHHSLAGVYDMKAEKEV |
| Ga0335078_109494553 | 3300032805 | Soil | MFKRTIGCLVLVCGWLVSGGLLQAHHSLAGVYDMKADKELDGTVTSVK |
| Ga0335078_116877822 | 3300032805 | Soil | MIKRTLGYVALFGLLMGASVSLQAHHSLAGVYDMKKETTVSG |
| Ga0335080_104857663 | 3300032828 | Soil | MIKRTLGCAALFGWLMAGSLQAHHSLAGVYDMKAEKELSGEV |
| Ga0335081_101696767 | 3300032892 | Soil | MIKRTLGCVALFGWLMTGSLQAHHSLAGVYDMKAEKELSGEVS |
| Ga0335081_110038221 | 3300032892 | Soil | MMKRTLGFAALAGLLLAAAGSLQAHHSLAGVYDMKVEKELAGT |
| Ga0335069_121150322 | 3300032893 | Soil | MIRRILGWAALVGCLMGASVSLVAHHSLAGVYDMKKDMELAGTVTSIKFTNPHGS |
| Ga0316628_1035682132 | 3300033513 | Soil | MIQRTLGCVALWGLIASGSLQAHHSLAGVYDMKAE |
| Ga0314795_069307_549_659 | 3300034670 | Soil | MIRRVLGSLVVCGCLMAGASLQAHHSLAGVYDMKAEK |
| ⦗Top⦘ |