| Basic Information | |
|---|---|
| Family ID | F019322 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 230 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VIIRYADSFAAATSTTGSPTITVAGGYRVYQWTSSGSITF |
| Number of Associated Samples | 156 |
| Number of Associated Scaffolds | 230 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 9.72 % |
| % of genes near scaffold ends (potentially truncated) | 83.48 % |
| % of genes from short scaffolds (< 2000 bps) | 76.96 % |
| Associated GOLD sequencing projects | 143 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.72 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.087 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (22.174 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.870 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.043 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.94% Coil/Unstructured: 72.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.72 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 230 Family Scaffolds |
|---|---|---|
| PF00041 | fn3 | 3.48 |
| PF01833 | TIG | 1.74 |
| PF00768 | Peptidase_S11 | 1.74 |
| PF13385 | Laminin_G_3 | 1.30 |
| PF01391 | Collagen | 1.30 |
| PF00415 | RCC1 | 1.30 |
| PF01171 | ATP_bind_3 | 0.87 |
| PF00004 | AAA | 0.43 |
| PF11651 | P22_CoatProtein | 0.43 |
| PF13884 | Peptidase_S74 | 0.43 |
| PF07719 | TPR_2 | 0.43 |
| PF00454 | PI3_PI4_kinase | 0.43 |
| PF12236 | Head-tail_con | 0.43 |
| PF13649 | Methyltransf_25 | 0.43 |
| PF13539 | Peptidase_M15_4 | 0.43 |
| PF04550 | Phage_holin_3_2 | 0.43 |
| PF12708 | Pectate_lyase_3 | 0.43 |
| PF01370 | Epimerase | 0.43 |
| PF12224 | Amidoligase_2 | 0.43 |
| PF13692 | Glyco_trans_1_4 | 0.43 |
| PF06048 | DUF927 | 0.43 |
| PF11351 | GTA_holin_3TM | 0.43 |
| PF09374 | PG_binding_3 | 0.43 |
| PF03819 | MazG | 0.43 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.43 |
| PF00383 | dCMP_cyt_deam_1 | 0.43 |
| PF05226 | CHASE2 | 0.43 |
| PF13489 | Methyltransf_23 | 0.43 |
| PF13481 | AAA_25 | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 230 Family Scaffolds |
|---|---|---|---|
| COG5184 | Alpha-tubulin suppressor ATS1 and related RCC1 domain-containing proteins | Cell cycle control, cell division, chromosome partitioning [D] | 2.61 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.74 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.87 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.87 |
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.43 |
| COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.91 % |
| Unclassified | root | N/A | 46.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10067942 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
| 3300001842|RCM30_1099968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
| 3300001843|RCM34_1049539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1226 | Open in IMG/M |
| 3300002363|B570J29624_104807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300002835|B570J40625_100974377 | Not Available | 727 | Open in IMG/M |
| 3300003394|JGI25907J50239_1045416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300004763|Ga0007746_1369574 | Not Available | 769 | Open in IMG/M |
| 3300005528|Ga0068872_10159911 | Not Available | 1307 | Open in IMG/M |
| 3300005528|Ga0068872_10630371 | Not Available | 567 | Open in IMG/M |
| 3300005581|Ga0049081_10010369 | All Organisms → Viruses → Predicted Viral | 3529 | Open in IMG/M |
| 3300005581|Ga0049081_10235282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300005581|Ga0049081_10273961 | Not Available | 587 | Open in IMG/M |
| 3300005581|Ga0049081_10349628 | Not Available | 501 | Open in IMG/M |
| 3300005583|Ga0049085_10043806 | All Organisms → Viruses → Predicted Viral | 1627 | Open in IMG/M |
| 3300005758|Ga0078117_1110419 | Not Available | 2242 | Open in IMG/M |
| 3300006484|Ga0070744_10014004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2378 | Open in IMG/M |
| 3300006484|Ga0070744_10017153 | Not Available | 2149 | Open in IMG/M |
| 3300006484|Ga0070744_10135148 | Not Available | 709 | Open in IMG/M |
| 3300006802|Ga0070749_10225252 | Not Available | 1068 | Open in IMG/M |
| 3300006805|Ga0075464_10432592 | Not Available | 802 | Open in IMG/M |
| 3300007538|Ga0099851_1226889 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300007541|Ga0099848_1036714 | Not Available | 2021 | Open in IMG/M |
| 3300007559|Ga0102828_1087756 | Not Available | 750 | Open in IMG/M |
| 3300007559|Ga0102828_1176663 | Not Available | 542 | Open in IMG/M |
| 3300007559|Ga0102828_1184395 | Not Available | 531 | Open in IMG/M |
| 3300007973|Ga0105746_1095536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
| 3300008266|Ga0114363_1210504 | Not Available | 587 | Open in IMG/M |
| 3300008448|Ga0114876_1209764 | Not Available | 648 | Open in IMG/M |
| 3300008448|Ga0114876_1238421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300008450|Ga0114880_1084714 | All Organisms → Viruses → Predicted Viral | 1257 | Open in IMG/M |
| 3300008450|Ga0114880_1132862 | Not Available | 919 | Open in IMG/M |
| 3300009026|Ga0102829_1037763 | Not Available | 1426 | Open in IMG/M |
| 3300009151|Ga0114962_10478778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300009152|Ga0114980_10202504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1167 | Open in IMG/M |
| 3300009152|Ga0114980_10486995 | Not Available | 703 | Open in IMG/M |
| 3300009158|Ga0114977_10245616 | Not Available | 1035 | Open in IMG/M |
| 3300009158|Ga0114977_10492105 | Not Available | 672 | Open in IMG/M |
| 3300009159|Ga0114978_10384803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
| 3300009159|Ga0114978_10410624 | Not Available | 809 | Open in IMG/M |
| 3300009160|Ga0114981_10202644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1088 | Open in IMG/M |
| 3300009161|Ga0114966_10097648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1980 | Open in IMG/M |
| 3300009161|Ga0114966_10132303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1641 | Open in IMG/M |
| 3300009161|Ga0114966_10238307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
| 3300009163|Ga0114970_10338063 | Not Available | 849 | Open in IMG/M |
| 3300009164|Ga0114975_10096290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1714 | Open in IMG/M |
| 3300009164|Ga0114975_10100570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1672 | Open in IMG/M |
| 3300009164|Ga0114975_10197294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1138 | Open in IMG/M |
| 3300009180|Ga0114979_10093266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1864 | Open in IMG/M |
| 3300009180|Ga0114979_10172660 | Not Available | 1318 | Open in IMG/M |
| 3300009180|Ga0114979_10241768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1083 | Open in IMG/M |
| 3300009180|Ga0114979_10323448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
| 3300009180|Ga0114979_10764864 | Not Available | 543 | Open in IMG/M |
| 3300009181|Ga0114969_10161248 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300009184|Ga0114976_10452787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300009185|Ga0114971_10025780 | Not Available | 3783 | Open in IMG/M |
| 3300009185|Ga0114971_10790526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300010157|Ga0114964_10183233 | Not Available | 1010 | Open in IMG/M |
| 3300010160|Ga0114967_10064931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2231 | Open in IMG/M |
| 3300010160|Ga0114967_10157735 | Not Available | 1254 | Open in IMG/M |
| 3300010318|Ga0136656_1154028 | Not Available | 785 | Open in IMG/M |
| 3300010334|Ga0136644_10611657 | Not Available | 598 | Open in IMG/M |
| 3300010354|Ga0129333_10106705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2586 | Open in IMG/M |
| 3300010354|Ga0129333_10129694 | All Organisms → Viruses → Predicted Viral | 2319 | Open in IMG/M |
| 3300010370|Ga0129336_10266113 | Not Available | 960 | Open in IMG/M |
| 3300010885|Ga0133913_10775184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2502 | Open in IMG/M |
| 3300010885|Ga0133913_10822458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2419 | Open in IMG/M |
| 3300010885|Ga0133913_10866722 | Not Available | 2348 | Open in IMG/M |
| 3300010885|Ga0133913_11810164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1528 | Open in IMG/M |
| 3300010885|Ga0133913_12303373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1322 | Open in IMG/M |
| 3300010885|Ga0133913_12449014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1274 | Open in IMG/M |
| 3300012012|Ga0153799_1069583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300012013|Ga0153805_1025295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300012013|Ga0153805_1088350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300012663|Ga0157203_1017452 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300012665|Ga0157210_1020496 | Not Available | 1072 | Open in IMG/M |
| 3300012920|Ga0160423_10524309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300013004|Ga0164293_11064357 | Not Available | 501 | Open in IMG/M |
| 3300013005|Ga0164292_10655124 | Not Available | 674 | Open in IMG/M |
| 3300013006|Ga0164294_10333583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1047 | Open in IMG/M |
| 3300013372|Ga0177922_10521961 | Not Available | 725 | Open in IMG/M |
| 3300013372|Ga0177922_10771407 | Not Available | 510 | Open in IMG/M |
| 3300015050|Ga0181338_1004757 | All Organisms → Viruses → Predicted Viral | 2314 | Open in IMG/M |
| 3300017700|Ga0181339_1012295 | Not Available | 992 | Open in IMG/M |
| 3300017700|Ga0181339_1013903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
| 3300017700|Ga0181339_1032013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 576 | Open in IMG/M |
| 3300017701|Ga0181364_1016947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1210 | Open in IMG/M |
| 3300017716|Ga0181350_1003034 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4875 | Open in IMG/M |
| 3300017716|Ga0181350_1141195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300017716|Ga0181350_1150679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300017747|Ga0181352_1106485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300017761|Ga0181356_1117911 | Not Available | 850 | Open in IMG/M |
| 3300017766|Ga0181343_1046205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1288 | Open in IMG/M |
| 3300017766|Ga0181343_1111547 | Not Available | 772 | Open in IMG/M |
| 3300017774|Ga0181358_1235517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300017777|Ga0181357_1000677 | Not Available | 13040 | Open in IMG/M |
| 3300017777|Ga0181357_1014654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3123 | Open in IMG/M |
| 3300017780|Ga0181346_1283688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300017784|Ga0181348_1086838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1235 | Open in IMG/M |
| 3300017785|Ga0181355_1031365 | All Organisms → Viruses → Predicted Viral | 2293 | Open in IMG/M |
| 3300017785|Ga0181355_1247326 | Not Available | 685 | Open in IMG/M |
| 3300017785|Ga0181355_1319885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300017785|Ga0181355_1361048 | Not Available | 532 | Open in IMG/M |
| 3300017785|Ga0181355_1367927 | Not Available | 525 | Open in IMG/M |
| 3300018036|Ga0181600_10209899 | Not Available | 1032 | Open in IMG/M |
| 3300018424|Ga0181591_11053849 | Not Available | 550 | Open in IMG/M |
| 3300020141|Ga0211732_1509202 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
| 3300020151|Ga0211736_10523735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300020151|Ga0211736_10610375 | Not Available | 525 | Open in IMG/M |
| 3300020159|Ga0211734_11286458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga alba | 751 | Open in IMG/M |
| 3300020161|Ga0211726_10360064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1089 | Open in IMG/M |
| 3300020162|Ga0211735_10066365 | Not Available | 932 | Open in IMG/M |
| 3300020196|Ga0194124_10124250 | Not Available | 1426 | Open in IMG/M |
| 3300020205|Ga0211731_10154055 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 783 | Open in IMG/M |
| 3300020533|Ga0208364_1056875 | Not Available | 504 | Open in IMG/M |
| 3300021519|Ga0194048_10146090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
| 3300021962|Ga0222713_10691110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300022179|Ga0181353_1098402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300022198|Ga0196905_1133234 | Not Available | 646 | Open in IMG/M |
| 3300022407|Ga0181351_1086521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1238 | Open in IMG/M |
| 3300022752|Ga0214917_10424751 | Not Available | 539 | Open in IMG/M |
| 3300022927|Ga0255769_10270574 | Not Available | 705 | Open in IMG/M |
| 3300023179|Ga0214923_10137547 | Not Available | 1556 | Open in IMG/M |
| 3300023184|Ga0214919_10231096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1348 | Open in IMG/M |
| 3300024346|Ga0244775_10182953 | Not Available | 1762 | Open in IMG/M |
| 3300024346|Ga0244775_11534825 | Not Available | 508 | Open in IMG/M |
| 3300024348|Ga0244776_10364533 | Not Available | 968 | Open in IMG/M |
| 3300024495|Ga0255164_1032423 | Not Available | 856 | Open in IMG/M |
| 3300025416|Ga0208877_1046297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300025595|Ga0208248_1013969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1947 | Open in IMG/M |
| 3300025616|Ga0208613_1134857 | Not Available | 554 | Open in IMG/M |
| 3300025687|Ga0208019_1186212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300025715|Ga0209310_1048513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1452 | Open in IMG/M |
| 3300027621|Ga0208951_1093001 | Not Available | 829 | Open in IMG/M |
| 3300027631|Ga0208133_1007206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3175 | Open in IMG/M |
| 3300027631|Ga0208133_1011870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2365 | Open in IMG/M |
| 3300027631|Ga0208133_1075965 | Not Available | 794 | Open in IMG/M |
| 3300027649|Ga0208960_1116266 | Not Available | 703 | Open in IMG/M |
| 3300027659|Ga0208975_1000533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18103 | Open in IMG/M |
| 3300027679|Ga0209769_1017393 | All Organisms → Viruses → Predicted Viral | 2554 | Open in IMG/M |
| 3300027697|Ga0209033_1059294 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
| 3300027712|Ga0209499_1170375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300027712|Ga0209499_1319261 | Not Available | 521 | Open in IMG/M |
| 3300027732|Ga0209442_1053519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1732 | Open in IMG/M |
| 3300027746|Ga0209597_1385586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300027747|Ga0209189_1411611 | Not Available | 500 | Open in IMG/M |
| 3300027759|Ga0209296_1151201 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
| 3300027759|Ga0209296_1397099 | Not Available | 517 | Open in IMG/M |
| 3300027763|Ga0209088_10177732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300027763|Ga0209088_10332257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300027770|Ga0209086_10054355 | Not Available | 2229 | Open in IMG/M |
| 3300027772|Ga0209768_10085530 | Not Available | 1578 | Open in IMG/M |
| 3300027782|Ga0209500_10197235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
| 3300027785|Ga0209246_10305308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300027793|Ga0209972_10246640 | Not Available | 807 | Open in IMG/M |
| 3300027797|Ga0209107_10238299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300027798|Ga0209353_10362218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300027805|Ga0209229_10013392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3488 | Open in IMG/M |
| 3300027808|Ga0209354_10220653 | Not Available | 766 | Open in IMG/M |
| 3300027808|Ga0209354_10267029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300027808|Ga0209354_10444187 | Not Available | 500 | Open in IMG/M |
| 3300027896|Ga0209777_10491519 | Not Available | 906 | Open in IMG/M |
| 3300027899|Ga0209668_10496596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300027899|Ga0209668_11021186 | Not Available | 557 | Open in IMG/M |
| 3300027963|Ga0209400_1028113 | Not Available | 3170 | Open in IMG/M |
| 3300027963|Ga0209400_1160507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
| 3300028025|Ga0247723_1166198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300028394|Ga0304730_1160302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300028394|Ga0304730_1226290 | Not Available | 689 | Open in IMG/M |
| 3300028394|Ga0304730_1330780 | Not Available | 513 | Open in IMG/M |
| 3300031857|Ga0315909_10541119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
| 3300031999|Ga0315274_11944959 | Not Available | 531 | Open in IMG/M |
| 3300032050|Ga0315906_10497507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
| 3300032116|Ga0315903_10737499 | Not Available | 730 | Open in IMG/M |
| 3300032118|Ga0315277_11677779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300032164|Ga0315283_12290167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300033981|Ga0334982_0000093 | Not Available | 48844 | Open in IMG/M |
| 3300033981|Ga0334982_0000880 | Not Available | 18883 | Open in IMG/M |
| 3300033981|Ga0334982_0013593 | All Organisms → Viruses → Predicted Viral | 4800 | Open in IMG/M |
| 3300033992|Ga0334992_0000029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 144450 | Open in IMG/M |
| 3300033992|Ga0334992_0333570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300033993|Ga0334994_0031472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3434 | Open in IMG/M |
| 3300033994|Ga0334996_0265361 | Not Available | 874 | Open in IMG/M |
| 3300033996|Ga0334979_0002114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14507 | Open in IMG/M |
| 3300034012|Ga0334986_0000667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30168 | Open in IMG/M |
| 3300034013|Ga0334991_0139074 | All Organisms → Viruses → Predicted Viral | 1119 | Open in IMG/M |
| 3300034019|Ga0334998_0182792 | All Organisms → Viruses → Predicted Viral | 1316 | Open in IMG/M |
| 3300034022|Ga0335005_0022229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 4436 | Open in IMG/M |
| 3300034022|Ga0335005_0203811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1225 | Open in IMG/M |
| 3300034023|Ga0335021_0408995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300034062|Ga0334995_0003523 | Not Available | 16002 | Open in IMG/M |
| 3300034062|Ga0334995_0025474 | All Organisms → cellular organisms → Bacteria | 5182 | Open in IMG/M |
| 3300034062|Ga0334995_0030478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4642 | Open in IMG/M |
| 3300034062|Ga0334995_0186066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1460 | Open in IMG/M |
| 3300034062|Ga0334995_0632618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300034073|Ga0310130_0006583 | All Organisms → Viruses → Predicted Viral | 4400 | Open in IMG/M |
| 3300034082|Ga0335020_0067796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1848 | Open in IMG/M |
| 3300034082|Ga0335020_0103096 | Not Available | 1454 | Open in IMG/M |
| 3300034092|Ga0335010_0442904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300034093|Ga0335012_0403258 | Not Available | 668 | Open in IMG/M |
| 3300034106|Ga0335036_0005173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11057 | Open in IMG/M |
| 3300034106|Ga0335036_0012902 | Not Available | 6830 | Open in IMG/M |
| 3300034106|Ga0335036_0148360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1672 | Open in IMG/M |
| 3300034106|Ga0335036_0306159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1054 | Open in IMG/M |
| 3300034106|Ga0335036_0465291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300034106|Ga0335036_0581960 | Not Available | 683 | Open in IMG/M |
| 3300034108|Ga0335050_0078444 | All Organisms → Viruses → Predicted Viral | 1970 | Open in IMG/M |
| 3300034108|Ga0335050_0078807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1964 | Open in IMG/M |
| 3300034108|Ga0335050_0414168 | Not Available | 601 | Open in IMG/M |
| 3300034111|Ga0335063_0368923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
| 3300034117|Ga0335033_0605652 | Not Available | 509 | Open in IMG/M |
| 3300034118|Ga0335053_0533983 | Not Available | 686 | Open in IMG/M |
| 3300034121|Ga0335058_0206805 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1146 | Open in IMG/M |
| 3300034122|Ga0335060_0026858 | Not Available | 3767 | Open in IMG/M |
| 3300034200|Ga0335065_0455447 | Not Available | 774 | Open in IMG/M |
| 3300034284|Ga0335013_0682281 | Not Available | 589 | Open in IMG/M |
| 3300034355|Ga0335039_0455353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 22.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 21.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.35% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.48% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.61% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.17% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.74% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.74% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.74% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.30% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.30% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.30% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.30% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.87% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.87% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.43% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.43% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.43% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.43% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.43% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.43% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.43% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.43% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.43% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
| 3300002363 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300025416 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_100679421 | 3300001282 | Freshwater | VIRYSDSFPLASSTTGSPTITTAGGFRTYKFTGSGSITF* |
| RCM30_10999681 | 3300001842 | Marine Plankton | VVIRYADTSPAATSTTGSPTDTVTGGYRIYKWTSSGSITF* |
| RCM34_10495393 | 3300001843 | Marine Plankton | RYADSFAAAASTTGSPTVTVAGGYRVYSFTASGSITF* |
| B570J29624_1048073 | 3300002363 | Freshwater | VILRYPDTNAAATSITGSPTVTVAGGYRVYKWTSSGSITF* |
| B570J29032_1092741701 | 3300002408 | Freshwater | IVIVRYSDSYAAAVSTTGSPSVSVSGGFRTYTFTGSGSITW* |
| B570J40625_1009743773 | 3300002835 | Freshwater | IVRYSDSFPAAASTTGSPTVTVAGGFRIYKWTGSGSITF* |
| JGI25907J50239_10454163 | 3300003394 | Freshwater Lake | GIVILRYPDTFIAATSTTGSPTITVAGGFRVYKWTSSGSITF* |
| Ga0007746_13695741 | 3300004763 | Freshwater Lake | LLSYPSAYPAATSTTGSPSVLVSGGLRVYKFTSSGSITF* |
| Ga0068872_101599114 | 3300005528 | Freshwater Lake | VIVRYSDSYAAAVSTTGSPTYTVSGGYRVYKFTGSGSITW* |
| Ga0068872_106303712 | 3300005528 | Freshwater Lake | VILRYPDTFRAATSTTGSPTIAVAGGFRVYQFTANGSITF* |
| Ga0049081_100103693 | 3300005581 | Freshwater Lentic | RYADSYAAATSTTGSPTITVSGGYRTYKFTASGSITF* |
| Ga0049081_102352821 | 3300005581 | Freshwater Lentic | VIIRYADTYIAATSTTGSPTITVAGGYRVYKWTASGSITF* |
| Ga0049081_102739611 | 3300005581 | Freshwater Lentic | RYPSNQPAVTSTTGSPTVTVAGGYRHYIFTSSGTLTW* |
| Ga0049081_103496282 | 3300005581 | Freshwater Lentic | GIVIIRYADTYAAATTTTGSPTITVAGGYRVYKWTGSGTITF* |
| Ga0049085_100438061 | 3300005583 | Freshwater Lentic | YPDTFIAATSTTGSPTITVAGGFRVYQYTANGSITF* |
| Ga0078117_11104191 | 3300005758 | Lake Water | IVAIRYPSTYPAATSTTGTVNVYVSGGYRTYVWTSSGTITF* |
| Ga0070744_100140041 | 3300006484 | Estuarine | VVIIRYPDSYPLATSAPGAGVSTTGGYRIYQWTSSGSITF* |
| Ga0070744_100171531 | 3300006484 | Estuarine | EIRYSDSFGPAVSTTGSPTTSTNGGYRYYIFTSSGSIRF* |
| Ga0070744_101351482 | 3300006484 | Estuarine | IRYPDSYSAASSTTGSPTITVAGGYRTYKFTTSGSITF* |
| Ga0070749_102252521 | 3300006802 | Aqueous | NGGSGVVIIRYPDTYAIAYTTGSPSYTVSGGYRIYRYTSSGSIIF* |
| Ga0075464_104325924 | 3300006805 | Aqueous | RYPDTFIAATSTTGSPTITVAGGFRVYKFTANGSITF* |
| Ga0099851_12268891 | 3300007538 | Aqueous | DTFDAAAATTGSPTITVSGGYRIYTFTASGSITF* |
| Ga0099848_10367141 | 3300007541 | Aqueous | YADTFAAAASTTGSPTVTVAGGYRVYKFTGSGSITW* |
| Ga0102828_10877561 | 3300007559 | Estuarine | QGVVAIQYPDTYPLATSTTGSPTITNPTGYRVYTWTSSGSITF* |
| Ga0102828_11766631 | 3300007559 | Estuarine | IIRYADSYAAAASTTGSPTVTVAGGYRVYSWTGSGTITF* |
| Ga0102828_11843953 | 3300007559 | Estuarine | IKYADTYPAATSTTGSPTISVSDGFRTYTFTSSGSITF* |
| Ga0105746_10955363 | 3300007973 | Estuary Water | IVIIRYADTFAAATATTGSPTITVAGGYRVYKWTTVGSGSITF* |
| Ga0114340_10301641 | 3300008107 | Freshwater, Plankton | VIIRYSDAFAAAASTTGSPTVTVSGGFRTYTFNGSGSITW* |
| Ga0114346_11935851 | 3300008113 | Freshwater, Plankton | YSDAFAAAASTTGSPTVTVSGGFRTYTFNGSGSITW* |
| Ga0114363_12105043 | 3300008266 | Freshwater, Plankton | IRYPDTFIAAASTTGSPTITVAGGFRVYRFTASGSITF* |
| Ga0114876_12097641 | 3300008448 | Freshwater Lake | SDTYAAATSTTGSPTITTAGGYRVYKYTSSGSITF* |
| Ga0114876_12384212 | 3300008448 | Freshwater Lake | ADSFAAATATTGSPTITVAGGYRIYKWTSSGSITF* |
| Ga0114880_10847141 | 3300008450 | Freshwater Lake | GSNGIAGIVAIKYADSFAPATATTGSPTITVANGFRVYEWTSSGSITF* |
| Ga0114880_11328623 | 3300008450 | Freshwater Lake | RYADTFPAATSTTGSPATVTSGGYRYYTWTGSGSVTF* |
| Ga0102829_10377632 | 3300009026 | Estuarine | GGSGVVIIRYPDTYPAATSTSGSPTVTVTGGYRIYRFTATGTITL* |
| Ga0114962_104787782 | 3300009151 | Freshwater Lake | GGSGIVIIRYEDSYAAATTTGSPNVTVAGGYRVYKFTNSGSIIF* |
| Ga0114980_102025043 | 3300009152 | Freshwater Lake | GGSGIVIIRYADSYAAATTTGSPNVTVAGGYRVYKFTNSGSIIF* |
| Ga0114980_104869952 | 3300009152 | Freshwater Lake | VIIRYADVYTAASNTTGSPNVTVTGGYRVYQFNSSGSITF* |
| Ga0114977_102456162 | 3300009158 | Freshwater Lake | VIFRYADTYPAAVSTTGSPTITVAGGYRVYKYTSSGSITF* |
| Ga0114977_104921051 | 3300009158 | Freshwater Lake | DTYAAATTTTGSPTITTAGGYIIYKWTSSGSITF* |
| Ga0114978_103848031 | 3300009159 | Freshwater Lake | SGIVIIRYADTYAAATATTGSPTITTAGGYRVYKWTTVGTWSITF* |
| Ga0114978_104106243 | 3300009159 | Freshwater Lake | VVVIRYADTFAAAITTGSPTVTVSGGYRTYRFTGSGSIEF* |
| Ga0114981_102026444 | 3300009160 | Freshwater Lake | VVIRYVDSFDAATATTGSPTITVAGGYRVYKFTGSGSITF* |
| Ga0114966_100976483 | 3300009161 | Freshwater Lake | ILRYPDTFRAATSTTGSPTITVAGGFRVYQFTASGSITF* |
| Ga0114966_101323031 | 3300009161 | Freshwater Lake | IRYADTSAAATATTGSPTITVAGGYRVYQWTSSGSITF* |
| Ga0114966_102383071 | 3300009161 | Freshwater Lake | TNQGGSGVVIIRYADSFAVASATGSPTITVAGGYRYYKFTTSGTITF* |
| Ga0114970_103380634 | 3300009163 | Freshwater Lake | VIIRYVNTYDAATGTTGSPTITNTGGYRYYTFNDTGTITF* |
| Ga0114975_100962902 | 3300009164 | Freshwater Lake | IVIIRYSDAYVAATSTTGSPTITTAGGYRVYQWTSSGSITF* |
| Ga0114975_101005701 | 3300009164 | Freshwater Lake | IVIIRYPDSYLAATSTTGSPTITVTGGYRIYTWTGSGSITI* |
| Ga0114975_101972941 | 3300009164 | Freshwater Lake | YADSYAAATSTTGSPTITVTGGYRIYKWTSSGSITF* |
| Ga0114979_100932662 | 3300009180 | Freshwater Lake | YADTYAAATATTGSPTITTAGGYRVYKWTTVGTWSITF* |
| Ga0114979_101726603 | 3300009180 | Freshwater Lake | SGIVIIRYADTYPAATSTTGSPTITTAGGYRVYQWTTSGSITF* |
| Ga0114979_102417681 | 3300009180 | Freshwater Lake | GIVIIRYADSYTAASNTTGSPNVTVSGGYRVYQFTSSGSITF* |
| Ga0114979_103234481 | 3300009180 | Freshwater Lake | VVVIRYADSTPAATVVTGSPTVTVSGGYRIYTWTSSGSITI* |
| Ga0114979_107648641 | 3300009180 | Freshwater Lake | RYADTYAAATATTGSPTITVAGGYRTYKFTGDGSITF* |
| Ga0114969_101612484 | 3300009181 | Freshwater Lake | GIVIIRYADTFPAATANTGSPTITVAGGYRVYKWTTVGNGSITF* |
| Ga0114969_103734284 | 3300009181 | Freshwater Lake | GIVIIRYANTFTKTPTTTGSPSTVNTGGYIYYTWTGNGSIVF* |
| Ga0114976_104527871 | 3300009184 | Freshwater Lake | IIRYADTYPAATSTTGSPTITTGGGYRVYQWTSSGSITF* |
| Ga0114971_100257807 | 3300009185 | Freshwater Lake | GGSGIVIIRYADTYAAATSTTGSPDITVAGGYRVYKWTTVGTWSITF* |
| Ga0114971_107905261 | 3300009185 | Freshwater Lake | DTFPAATATTGSPTITVAGGYRVYKWTTVGNGSITF* |
| Ga0114964_101832333 | 3300010157 | Freshwater Lake | IRYSDSYAAASATTGSPTITITNGYRYYAFTSSGSITF* |
| Ga0114967_100649311 | 3300010160 | Freshwater Lake | GGSGIVIIRYADTYPAATATTGSPTITVAGGYRVYSWASSGSLTL* |
| Ga0114967_101577353 | 3300010160 | Freshwater Lake | VILRYPDTFRAATSTTGSPTITVAGGFRVYQFTASGSITF* |
| Ga0136656_11540283 | 3300010318 | Freshwater To Marine Saline Gradient | SSKPEATSTTGSPTVSVANGYRVYKWTGSGSITF* |
| Ga0136644_106116571 | 3300010334 | Freshwater Lake | YADSYAAATSTTGSPTITVAGGYRVYKFTDNGTITF* |
| Ga0129333_101067051 | 3300010354 | Freshwater To Marine Saline Gradient | DTYDAAVSTTGSPTITVAGGYRVYKWTGSGSITF* |
| Ga0129333_101296941 | 3300010354 | Freshwater To Marine Saline Gradient | DTFTAAASTTGSPTITVSGGYRIYKWTGSGSITF* |
| Ga0129336_102661131 | 3300010370 | Freshwater To Marine Saline Gradient | IIRYADSYAAATSTTGSPTITVSGGYRIYQWTGNGSITF* |
| Ga0133913_107751843 | 3300010885 | Freshwater Lake | VIIRYSNIYPEAASATGTYTITIKDGYRIYRWTSSGSITF* |
| Ga0133913_108224586 | 3300010885 | Freshwater Lake | GIVIIRYPDTFALATSSTGSPTITTANGWRLYVWTASGTITI* |
| Ga0133913_108667221 | 3300010885 | Freshwater Lake | DSYAAATSTTGSPTITVAGGYRVYKFTDNGTITF* |
| Ga0133913_118101641 | 3300010885 | Freshwater Lake | GIVIIRYPDTYDAASATTGSPTVTVTGGYRIYKWTSSGSITF* |
| Ga0133913_123033733 | 3300010885 | Freshwater Lake | IIRYADTFTAATSTTGSPTTIVTGGYRYYKFTSSGSITF* |
| Ga0133913_124490143 | 3300010885 | Freshwater Lake | IVIIRYADTYDAATSTTGSPSIVVSGGYRTYTFTSSGSITF* |
| Ga0153799_10695831 | 3300012012 | Freshwater | VIIRYADSFAAATSTTGSPTITVAGGYRVYQWTSSGSITF* |
| Ga0153805_10252952 | 3300012013 | Surface Ice | IVIIRYSDAYALATSTTGSPLITTTGGYNIYKFTTSGSITF* |
| Ga0153805_10883502 | 3300012013 | Surface Ice | DTSAAATATTGSPTITVAGGYRVYKFTSSGSITF* |
| Ga0157203_10174521 | 3300012663 | Freshwater | IRYPDSNPAATATTGSPTITVSGGYRIYQWTASGSITF* |
| Ga0157210_10204964 | 3300012665 | Freshwater | IILRHLDSLPAASATTGSPTITVAGGYRIYQFTASGSITF* |
| Ga0160423_105243091 | 3300012920 | Surface Seawater | VVIFRYNDAFGTLTSTTGSPTITTSGGYRYYKYTGSGGVTI* |
| Ga0164293_110643571 | 3300013004 | Freshwater | ILQYPDSYAAATTSGSPNVTVSGGYRTYRFWQSGTITF* |
| Ga0164292_106551241 | 3300013005 | Freshwater | YPDTFAAATSTTGSPTITVTGGYRIYKYTGSGTFTF* |
| Ga0164294_103335832 | 3300013006 | Freshwater | IRYPDSYAAATATTGSPTITVAGGYRIYAWTSSGSITF* |
| Ga0177922_105219613 | 3300013372 | Freshwater | VIIRYADTFSAASSTTGSPTITVTGGYRYYTWTGSGSITF* |
| Ga0177922_107714071 | 3300013372 | Freshwater | ADTYSAATATTGSPTITVTGGYRVYKWTGNGTITF* |
| Ga0181338_10047575 | 3300015050 | Freshwater Lake | RYADTFAAATSTTGSPTITVAGGYRVYQWTSSGSITF* |
| Ga0181339_10122951 | 3300017700 | Freshwater Lake | YSDAYDAATSTTGSPTITTSGGFRYYTFTATGTITF |
| Ga0181339_10139032 | 3300017700 | Freshwater Lake | IVIIRYADTYGAATSTTGSPTITVAGGYRVYQWTSSGSITF |
| Ga0181339_10320133 | 3300017700 | Freshwater Lake | IVILRYPDTFRAATSTTGSPTITVAGGFRVYQFTANGSITF |
| Ga0181364_10169471 | 3300017701 | Freshwater Lake | IVVIRYADSFPAASATTGSPTITVAGGYRVYKWTSSGSVTF |
| Ga0181350_10030348 | 3300017716 | Freshwater Lake | IIRYADTYNAASSTTGSPTIAVTGGYRIYTFTGTGSITF |
| Ga0181350_11411951 | 3300017716 | Freshwater Lake | YPDTFIAATSTTGSPTITVAGGFRVYQFTANGSITF |
| Ga0181350_11506791 | 3300017716 | Freshwater Lake | SGIVIIRYADSFAAASATTGSPTITVAGGYRIYQWTSSGSITF |
| Ga0181352_11064852 | 3300017747 | Freshwater Lake | VIIRYADSFAAAVSTTGSPTITVAGGYRVYQWTSSGSITF |
| Ga0181356_11179113 | 3300017761 | Freshwater Lake | YADTYAAANATTGTPTITVAGGYRKYTWTGNGSITF |
| Ga0181343_10462053 | 3300017766 | Freshwater Lake | RYPDSYVAATSTTGSPTITVAGGYRVYNFASSGSITF |
| Ga0181343_11115471 | 3300017766 | Freshwater Lake | IVIIRYADTYPAATSTTGSPTITVSGGYRVYKFTGSGSITF |
| Ga0181358_12355172 | 3300017774 | Freshwater Lake | VVIRYADTFAAATATTGSPTITVAGGYRVYQWTSSGSITF |
| Ga0181357_100067715 | 3300017777 | Freshwater Lake | VIIRYADTYGAATTTTGSPTITVAGGYRVYKWTGSGTITF |
| Ga0181357_10146541 | 3300017777 | Freshwater Lake | GSGIVIIRYADTYDAATSTTGSPTITVAGGYRVYSWAGSGSITI |
| Ga0181346_12836882 | 3300017780 | Freshwater Lake | GSGIVIIRYADTFAAAASSTGSPKITVSGGYRIHTWTSSGSITI |
| Ga0181348_10868383 | 3300017784 | Freshwater Lake | RYADTFAAATSTTGSPTITVAGGYRVYQWTSSGSITF |
| Ga0181355_10313651 | 3300017785 | Freshwater Lake | YPDTFIAATSTTGSPTITVAGGFRVYKWTSSGSITF |
| Ga0181355_12473261 | 3300017785 | Freshwater Lake | RYADTFTAAASTTGSPTITVSGGFRTYSWTGSGSITF |
| Ga0181355_13198851 | 3300017785 | Freshwater Lake | IRYADTYNAATSTTGSPTITVAGGYRVYKWTASGSITF |
| Ga0181355_13610481 | 3300017785 | Freshwater Lake | LIIRYGANYAAAQSTTGSPTITVAGGYRVYEWTGSGSITF |
| Ga0181355_13679273 | 3300017785 | Freshwater Lake | GVVIIRYPDSFKLATSSTGSPTITTANGFRVYQWTSSGSITF |
| Ga0181600_102098992 | 3300018036 | Salt Marsh | PEGLVAATSTTGSPDIFTAGGYKYYIFKQNGSITW |
| Ga0181591_110538493 | 3300018424 | Salt Marsh | ILRYPSSMGEVTSTVGSPTTTTSGGYIYYTFTGSGSITF |
| Ga0211732_15092021 | 3300020141 | Freshwater | IIRYADTYAAASSTTGSPTITVAGGYRVYQWTSSGSITF |
| Ga0211736_105237351 | 3300020151 | Freshwater | PVVDVAATSTTGSPTITVAGGYRVYKFTASGSITF |
| Ga0211736_106103752 | 3300020151 | Freshwater | SGLVQIRYPDSYAAPNATTGSPSATTNTEYRTYTWTGNGSITF |
| Ga0211734_112864582 | 3300020159 | Freshwater | RYADTFPAATSTTGNPVITVSGGYRIYKWISSGTITF |
| Ga0211726_103600641 | 3300020161 | Freshwater | VILRYADTYPPLLGTTGSPTITVSGGYRIYKWTSTGSATI |
| Ga0211735_100663651 | 3300020162 | Freshwater | YADSYSAASNTTGSPNVIIDGGYRIYVWTTSGTITF |
| Ga0194124_101242506 | 3300020196 | Freshwater Lake | GIVIIAYPDSYAAATSTTGSPTVVVSGGYRRYTFTGNGSITF |
| Ga0211731_101540551 | 3300020205 | Freshwater | VIIRYADTYPVATSTTGSPTITTAGGYRVYQWTTSGSITF |
| Ga0208364_10568751 | 3300020533 | Freshwater | YPDTFAAATSTTGSPTVATSGGYRKYTFTGDGSITF |
| Ga0194048_101460901 | 3300021519 | Anoxic Zone Freshwater | IRYADTFPAATATTGSPTITVAGGYRVYKWTTVGNGSITF |
| Ga0222713_106911101 | 3300021962 | Estuarine Water | SGIVIIRYADTFAAATATTGSPTITVAGGYRVYQWTSSGSITF |
| Ga0181353_10984021 | 3300022179 | Freshwater Lake | VVIIRYSSIYAPAASTSGSPTVTISGGYRIYQWTGNGSIKF |
| Ga0196905_11332341 | 3300022198 | Aqueous | SDTYPAATSTTGSPTITNTGGYRIYKFTGSGSITF |
| Ga0181351_10865211 | 3300022407 | Freshwater Lake | YADSFAAATSTTGSPTITVTGGYRIYQWTSSGSITF |
| Ga0214917_104247512 | 3300022752 | Freshwater | VIIRYSDTYAAATSTTGSPTITVSGGYRTYKFTDNGSITF |
| Ga0255769_102705744 | 3300022927 | Salt Marsh | ADSYAAATATTGSPTITVAGGYRVYSWAGSGTITF |
| Ga0214923_101375473 | 3300023179 | Freshwater | GSGIVLIRYSDTYPAATSTTGSPSTITSGGYRYYKFTGDGSITF |
| Ga0214919_102310963 | 3300023184 | Freshwater | IRYAVDYKAATATTGSPTVTVADGYRVYKWTSSGSITF |
| Ga0244775_101829534 | 3300024346 | Estuarine | LRYADTYSAAIATTGSPTYTTSGGYRVYTFTSSGSITF |
| Ga0244775_112192831 | 3300024346 | Estuarine | GIVSIRYSDSFTAAAATSGSPTYVVSGGFRTYTWTGDGSITF |
| Ga0244775_115348252 | 3300024346 | Estuarine | YPDAFPLATSTTGSPTVTNPTGYRVYTFTASGSITF |
| Ga0244776_103645331 | 3300024348 | Estuarine | YPDSWLAAASTTGSPTVTVSGGYRIYKFTASGSITF |
| Ga0255164_10324231 | 3300024495 | Freshwater | IRYPSSYDAASSTTGSPTYTVSGGYRIYQWTGSGSITF |
| Ga0255176_10858622 | 3300024507 | Freshwater | YPSSFPAATSTTGSPTVSTSSRPGYRVYTFTGSGSITF |
| Ga0208877_10462971 | 3300025416 | Freshwater | ISYPNTYPAASSTTGSPSIVNTGGNRIYTWTSSGSITF |
| Ga0208248_10139691 | 3300025595 | Freshwater | VILSYPSLYPAATSTTGSPTITTASGYRIYTWTGNGSITF |
| Ga0208613_11348572 | 3300025616 | Freshwater | VIIRYPSGYAAASATTGSPTINVSGGYRTYIWTSSGSITF |
| Ga0208019_11862122 | 3300025687 | Aqueous | VVRYSDDYAAATTTGSPTYTVSGGFRIYKFTGSGSIRWG |
| Ga0209310_10485135 | 3300025715 | Anaerobic Digestor Sludge | VVIIRYPDTYDAAIATTGSPTVTVTGGYRIYQWTASGSITF |
| Ga0255073_10817231 | 3300027135 | Freshwater | GRVILRYPDSFPAASATTGSPGVSVSGGYRIYNFSGTGSITL |
| Ga0208951_10930011 | 3300027621 | Freshwater Lentic | GIVIIRYLSGYDAAASTTGATVTVAGGYRIYQWANSGSITF |
| Ga0208133_10072061 | 3300027631 | Estuarine | VIIRYADTYAAASSTTGSPTITTAGGYRVYQWTSSGSITF |
| Ga0208133_10118705 | 3300027631 | Estuarine | IIRYPDSYPLATSAPGASVSTTGGYRIYQWTSSGSITF |
| Ga0208133_10759651 | 3300027631 | Estuarine | IIRYLDTYLPASSTTGSPTYTVVNGYRVYKFTASGSITF |
| Ga0208960_11162661 | 3300027649 | Freshwater Lentic | VIIIRYPDTYLAATSTTGSPTVTVTGGYRIYKWTGSGSITI |
| Ga0208975_10005331 | 3300027659 | Freshwater Lentic | GIVIIRYADTYAAATTTTGSPTITVAGGYRVYKWTGSGTITF |
| Ga0209769_10173931 | 3300027679 | Freshwater Lake | RYADTFPAATSTTGSPTITVSGGYRIYKWTSSGSITL |
| Ga0209033_10592941 | 3300027697 | Freshwater Lake | RYPSTGNTNAASTTGSPSFVESGGYKYYKFTGTGSITF |
| Ga0209499_11703753 | 3300027712 | Freshwater Lake | IRYSDSFSAASSTTGSPTITVAGGYRVYKFTDNGTITF |
| Ga0209499_13192612 | 3300027712 | Freshwater Lake | IRYPDSYSAAASTTGSPTVTVTGGYRIYKWTGNGSITF |
| Ga0209442_10535191 | 3300027732 | Freshwater Lake | GIVIVRYADTYPAATATTGSPTITTSGGFRIYVWTSSGSITI |
| Ga0209597_13855862 | 3300027746 | Freshwater Lake | DTFPAATATTGSPTITVAGGYRVYKWTTVGNGSITF |
| Ga0209189_14116111 | 3300027747 | Freshwater Lake | SDSYAAASATTGSPTITITNGYRYYAFTSSGSITF |
| Ga0209296_11512011 | 3300027759 | Freshwater Lake | TYAAATATTGSPTITTAGGYRVYKWTTVGTWSITF |
| Ga0209296_13970991 | 3300027759 | Freshwater Lake | AGIVIVTYPDSYPAAASTTGSPTITVTNGFRYYAFTSSGSITF |
| Ga0209088_101777322 | 3300027763 | Freshwater Lake | VVIRYADSTPAATVVTGSPTVTVSGGYRIYTWTSSGSITI |
| Ga0209088_103322571 | 3300027763 | Freshwater Lake | LDTYAVASSTTGSPTITVAGGYRIYKFTSSGSITF |
| Ga0209086_100543551 | 3300027770 | Freshwater Lake | LDGYKAATSTTGSPNVIVSGGYRTYIWTSSGSITF |
| Ga0209768_100855301 | 3300027772 | Freshwater Lake | DTFDAALSTTGSPTITQTGGYRIYKWLSGTGSVTF |
| Ga0209500_101972351 | 3300027782 | Freshwater Lake | RYADTYPAATSTTGSPTITTGGGYRVYQWTSSGSITF |
| Ga0209246_103053082 | 3300027785 | Freshwater Lake | IVILRYADTFDAATATTGSPTITVAGGYRVYKFTSSGSITF |
| Ga0209972_100217684 | 3300027793 | Freshwater Lake | YADSYPAATTTGSPTVTVSGGFRVYVFNASGSITF |
| Ga0209972_102466403 | 3300027793 | Freshwater Lake | IRYADSFPAATSTTGSPTTVTSGGYRYYKWTGSGSITF |
| Ga0209107_102382991 | 3300027797 | Freshwater And Sediment | YADTYPAATATTGSPDITVAGGYRVYKWTTVGSWSVTF |
| Ga0209353_103622181 | 3300027798 | Freshwater Lake | VIIRYADSYPAATSTTGSPTITVSGGYRIYQWTSSGSITF |
| Ga0209229_100133921 | 3300027805 | Freshwater And Sediment | IVVIRYADTYGVATSTTGSPTVTTAGGYRVYKWTSSGSITF |
| Ga0209354_102206533 | 3300027808 | Freshwater Lake | YLATYNAATATTGSPTVTIINGYRIYTWSTTGSGSITF |
| Ga0209354_102670291 | 3300027808 | Freshwater Lake | YADTYDAAASTTGSPTITVAGGYRVYKFTSSGTITF |
| Ga0209354_104441871 | 3300027808 | Freshwater Lake | YADTYSAATATTGSPAITVSGGYRVYMFTSSGTITF |
| Ga0209777_104915191 | 3300027896 | Freshwater Lake Sediment | GVVIISYPDSYPAASATTGSPTITVAGGYRVYIWTSSGSITF |
| Ga0209668_104965961 | 3300027899 | Freshwater Lake Sediment | SGNGGSGGSGIVIIRYADTFAAATTTVGSPTITVAGGYRVYKFTGTGSITF |
| Ga0209668_110211861 | 3300027899 | Freshwater Lake Sediment | VRIQYSDTFSAAASTTGSPTYSVSGGLRIYTWYNNGSITW |
| Ga0209400_10281132 | 3300027963 | Freshwater Lake | IKVPVTAVSTTGSPTVVNSGGFNYYKFTASGSITF |
| Ga0209400_11605071 | 3300027963 | Freshwater Lake | VIIRYSDAYAAATATTGSPTITVAGGYRVYKWTTVGTWSITF |
| Ga0209299_10486254 | 3300027974 | Freshwater Lake | GGSGIVIIRYASTYPAATSTTGSPATVVTGGYRYYTWTGSGSITL |
| Ga0247723_11661981 | 3300028025 | Deep Subsurface Sediment | SGVVIIRYADSFAAATATTGSPTITVTGGYRIYQWNSSGSITF |
| Ga0256331_11339982 | 3300028286 | Freshwater | VIAYPSSFPAATSTTGSPTVSTSSRPGYRVYTFTGSGSITF |
| Ga0304730_11603022 | 3300028394 | Freshwater Lake | IRYSDAYAAATATTGSPTITVAGGYRVYKWTTVGTWSITF |
| Ga0304730_12262901 | 3300028394 | Freshwater Lake | IRYADTSAAATATTGSPTITVAGGYRVYQWTSSGSITF |
| Ga0304730_13307801 | 3300028394 | Freshwater Lake | YPDAYSLATSTTGSPTVTTEGGYRIYTFTATGSIGW |
| Ga0315909_105411191 | 3300031857 | Freshwater | SGTVIIRTANTDPVGTATGSPTITTAGGYRLYQWTAVGTWSITF |
| Ga0315274_119449592 | 3300031999 | Sediment | IRYADTFAAAASTTGSPTITVAGGYRVYNWTGSGSITF |
| Ga0315906_104975072 | 3300032050 | Freshwater | GASGFVAIRYSDTYELARSTTGSPTITTSGGYRIYQWTGSGTIRF |
| Ga0315903_107374992 | 3300032116 | Freshwater | LRYPDTFRAATSTTGSPTITVAGGFRVYQFTANGSITF |
| Ga0315277_116777792 | 3300032118 | Sediment | GSGIVIIRYADTYNAATSTTGSPTITVAGGYRVYKWTASGTITF |
| Ga0315283_122901671 | 3300032164 | Sediment | IRYADTYQAATSTTGSPTVTVAGGYRVYQWTASGTITF |
| Ga0334982_0000093_42806_42928 | 3300033981 | Freshwater | MIIRYLESYQAAVSTTGSPTVTTSGGYRIYTWTASGSITF |
| Ga0334982_0000880_2828_2947 | 3300033981 | Freshwater | MLIRYPDAYRPATTTGSPTITVSGGYRIYKFTGNGSITF |
| Ga0334982_0013593_2219_2344 | 3300033981 | Freshwater | VVIIRYPDSYAAATSTTGSPTITVSGGYRTYTFTGNGTITF |
| Ga0334992_0000029_135676_135792 | 3300033992 | Freshwater | MRYPDAYLAATSTTGSPTITNPTGYRVYTFTASGSITF |
| Ga0334992_0333570_593_700 | 3300033992 | Freshwater | ADSYASATATTGSPNVTIAGGYRIYKWTSSGSITF |
| Ga0334994_0031472_2330_2452 | 3300033993 | Freshwater | MIIRYADTFTAAASTTGSPTITVSGGYRIYKWTGSGSITF |
| Ga0334996_0265361_357_479 | 3300033994 | Freshwater | MIIRYPDSFSEAVATTGSPSVTVSGGYRIYQWTGSGSITF |
| Ga0334979_0002114_11783_11908 | 3300033996 | Freshwater | MVVIRYLDTYPAATSTTGSPSITTSGGYRIYQWTGSGSITI |
| Ga0334986_0000667_15485_15607 | 3300034012 | Freshwater | MIIRYEDIYPAAASTTGSPSVSVTGGYRIYTWTGSGSITF |
| Ga0334986_0078983_1111_1233 | 3300034012 | Freshwater | MIIRYSDAFAPATSTTGSPTYTVSGGNNIYVFNASGSITF |
| Ga0334991_0139074_994_1119 | 3300034013 | Freshwater | IVIIRYADSYPAATSTTGSPTITTAGGYRVYKWTSSGSITF |
| Ga0334998_0182792_3_110 | 3300034019 | Freshwater | ADTFAAATATTGSPTYTVAGGYRIYKFTGSGSITW |
| Ga0335005_0022229_2546_2671 | 3300034022 | Freshwater | MVIIRCSSSLPVLAGTTGSPTITVSGGYRIYKFTTSGSITF |
| Ga0335005_0203811_1_114 | 3300034022 | Freshwater | RYADSTAEASSTTGSPTITVAGGYRVYKWTSSGSITF |
| Ga0335021_0408995_224_346 | 3300034023 | Freshwater | MVIRYPDSIAAATSTTGSPTITVSGGYRIYSYTSTGTFVL |
| Ga0334995_0003523_11648_11764 | 3300034062 | Freshwater | MRYSDSFPAAASTTGSPTVTVAGGFRIYKWTGSGSITF |
| Ga0334995_0025474_588_710 | 3300034062 | Freshwater | MIIRYPDSFSAAVATTGSPSVTVSGGYRIYQWTGSGSITF |
| Ga0334995_0030478_3276_3398 | 3300034062 | Freshwater | MIVRYADTYPAATATTGSPTITTSGGFRIYVWTSSGSITI |
| Ga0334995_0186066_1340_1459 | 3300034062 | Freshwater | MVRYSDAFAAAASTTGSPTVTVSGGYRVYTWTASGSITW |
| Ga0334995_0632618_399_521 | 3300034062 | Freshwater | MIIRYSDAFEAASSTTGSPTITVSGGYRIYQWTSSGSITF |
| Ga0310130_0006583_2624_2749 | 3300034073 | Fracking Water | MVVIRYPSTLPLATSTTGSPTVTTSGGYRIYQWTSNGSITF |
| Ga0335020_0067796_444_551 | 3300034082 | Freshwater | MDSYPAATSTTGSPTITVSGGYRIYKWITSGSITF |
| Ga0335020_0103096_511_633 | 3300034082 | Freshwater | MIIRYADTFAAATSTTGSPTITTAGGYRVYQWTSSGSITF |
| Ga0335010_0442904_579_698 | 3300034092 | Freshwater | ILRYPDTNAAATSITGSPTVTVAGGYRVYKWTSSGSITF |
| Ga0335012_0403258_535_666 | 3300034093 | Freshwater | SGFVAIRYSDTFPLATSTTGSPSITTAGGYRIYQWTSSGTITF |
| Ga0335029_0239554_370_498 | 3300034102 | Freshwater | VIIAYPDSFPAAVSTTGSPTVSLVSRAGYRVYTFTGSGSITF |
| Ga0335036_0005173_10608_10730 | 3300034106 | Freshwater | MIIRYPDTYAAATSTTGSPTITTTGGYRIYKWTGNGSITF |
| Ga0335036_0012902_5080_5202 | 3300034106 | Freshwater | MIIRYADSFAAAASTTGSPTITVSGGFRTYLWTGNGSITF |
| Ga0335036_0148360_517_639 | 3300034106 | Freshwater | MVIRYASSFAAALSTTGSPTVTVAGGYRVYTWTGSGSITF |
| Ga0335036_0306159_3_131 | 3300034106 | Freshwater | GVVIIRYADTFPAATTTTGSPEVTTAGGFRIYRWTSSGSITF |
| Ga0335036_0465291_2_109 | 3300034106 | Freshwater | PDTFSLAISTTGSPTVTNPTGYRVYTFTASGSITF |
| Ga0335036_0581960_107_229 | 3300034106 | Freshwater | MIIRYADSAPAAASTTGSPTVTVAGGYRVYKWTGSGSITF |
| Ga0335050_0078444_2_121 | 3300034108 | Freshwater | IIRYLDSYPAATSTTGSPTITVSGGYRIYQWTTSGSITF |
| Ga0335050_0078807_1837_1962 | 3300034108 | Freshwater | IVIIRYADTYPAATSTTGSPTITVAGGYRVYKWTSSGSITF |
| Ga0335050_0414168_2_145 | 3300034108 | Freshwater | AGGGSGVVILRYPDSYALASSTTGTISTVQSGGYRYYTFTSSGSITF |
| Ga0335063_0368923_180_302 | 3300034111 | Freshwater | MIIRYADTYAAATSTTGSPTITVAGGYRVYSWTGSGSITF |
| Ga0335033_0605652_395_508 | 3300034117 | Freshwater | RYPDAYSLATSTTGSPTVTTAGGYRIYTFTSTGSIGW |
| Ga0335053_0533983_561_686 | 3300034118 | Freshwater | IVIIRYPDTYPAAASYTGSPTITNPTGYRVYKFTGDGTITF |
| Ga0335056_0015577_3552_3677 | 3300034120 | Freshwater | MVIIRYPDNFVLASATTGSPTVSNPTGYRVYTFTSSGSITF |
| Ga0335058_0206805_1038_1145 | 3300034121 | Freshwater | VDSYPAATSTTGSPTITVSGGYRVYKYTSSGSITF |
| Ga0335060_0026858_3651_3767 | 3300034122 | Freshwater | VRYADSFPAAASTTGSPTVTVAGGFRIYKWTGSGSITF |
| Ga0335065_0455447_3_116 | 3300034200 | Freshwater | IRYADKYLAAKSTTGATITVAGGYRVYTWTSSGTITF |
| Ga0335049_0009481_2603_2725 | 3300034272 | Freshwater | MIVRYPDTFPLASATTGSPTITNPTGYRVYTFTASGSITF |
| Ga0335013_0682281_3_137 | 3300034284 | Freshwater | GGSGIVIIRHVDTFPLATTTGSVAVTSSGGYRTYKFTGNGSITF |
| Ga0335039_0455353_240_365 | 3300034355 | Freshwater | MVIIRYADTFAAATSTTGSPTLTVTGGYRIYQWASSGSITF |
| ⦗Top⦘ |