Basic Information | |
---|---|
Family ID | F019237 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 231 |
Average Sequence Length | 43 residues |
Representative Sequence | MANPFRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQERDQ |
Number of Associated Samples | 190 |
Number of Associated Scaffolds | 231 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 96.10 % |
% of genes near scaffold ends (potentially truncated) | 97.40 % |
% of genes from short scaffolds (< 2000 bps) | 92.64 % |
Associated GOLD sequencing projects | 178 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.316 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.706 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.844 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 231 Family Scaffolds |
---|---|---|
PF05137 | PilN | 77.92 |
PF11104 | PilM_2 | 16.88 |
PF06305 | LapA_dom | 1.30 |
PF01977 | UbiD | 1.30 |
PF13531 | SBP_bac_11 | 0.43 |
PF00120 | Gln-synt_C | 0.43 |
PF13673 | Acetyltransf_10 | 0.43 |
PF04185 | Phosphoesterase | 0.43 |
COG ID | Name | Functional Category | % Frequency in 231 Family Scaffolds |
---|---|---|---|
COG3166 | Type IV pilus assembly protein PilN | Cell motility [N] | 155.84 |
COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 1.30 |
COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 1.30 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573000|GPBTN7E02I7UTV | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300001593|JGI12635J15846_10306345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 991 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100247334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1671 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101249037 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300002561|JGI25384J37096_10012043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3312 | Open in IMG/M |
3300002562|JGI25382J37095_10211102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300002911|JGI25390J43892_10119624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300002914|JGI25617J43924_10290315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10278425 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300004080|Ga0062385_10616615 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300004117|Ga0058893_1308723 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300004139|Ga0058897_11018354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300004140|Ga0058894_1477716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 959 | Open in IMG/M |
3300005167|Ga0066672_10207755 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300005172|Ga0066683_10260319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1076 | Open in IMG/M |
3300005179|Ga0066684_10941365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300005180|Ga0066685_10070656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2287 | Open in IMG/M |
3300005180|Ga0066685_10545684 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300005435|Ga0070714_101429895 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300005445|Ga0070708_101009508 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300005447|Ga0066689_10223277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1151 | Open in IMG/M |
3300005537|Ga0070730_10052359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2941 | Open in IMG/M |
3300005540|Ga0066697_10096452 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
3300005542|Ga0070732_10712600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
3300005575|Ga0066702_10595867 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300005598|Ga0066706_10471568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
3300005607|Ga0070740_10310258 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300005713|Ga0066905_101361644 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300005764|Ga0066903_108013049 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005841|Ga0068863_100217995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1838 | Open in IMG/M |
3300005842|Ga0068858_101454610 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300005921|Ga0070766_10202379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1242 | Open in IMG/M |
3300005952|Ga0080026_10178296 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300006050|Ga0075028_100596970 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300006163|Ga0070715_10994466 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300006354|Ga0075021_10205770 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
3300006797|Ga0066659_10236341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1359 | Open in IMG/M |
3300006806|Ga0079220_10609241 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300006806|Ga0079220_10775997 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300006806|Ga0079220_10803542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
3300006903|Ga0075426_11164168 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300009012|Ga0066710_100803971 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300009038|Ga0099829_10261066 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
3300009038|Ga0099829_10640772 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300009038|Ga0099829_10675777 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300009088|Ga0099830_11340759 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300009090|Ga0099827_11055539 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300009174|Ga0105241_11703700 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300009519|Ga0116108_1014875 | All Organisms → cellular organisms → Bacteria | 2785 | Open in IMG/M |
3300009553|Ga0105249_11688927 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300009792|Ga0126374_10553147 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300009824|Ga0116219_10450879 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300010043|Ga0126380_10921203 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300010043|Ga0126380_11152737 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300010043|Ga0126380_12029773 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300010047|Ga0126382_10520060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
3300010304|Ga0134088_10581930 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300010325|Ga0134064_10027917 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
3300010329|Ga0134111_10059064 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
3300010360|Ga0126372_10940249 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300010362|Ga0126377_12401281 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300010366|Ga0126379_10745162 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300010366|Ga0126379_10839370 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300010366|Ga0126379_12223290 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300010376|Ga0126381_102699860 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300010396|Ga0134126_10417224 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
3300011090|Ga0138579_1244669 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300011120|Ga0150983_10841124 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300011120|Ga0150983_11553690 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300011270|Ga0137391_10227863 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
3300011270|Ga0137391_10483078 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300011270|Ga0137391_10801001 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300011271|Ga0137393_11012303 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300012202|Ga0137363_11806789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300012205|Ga0137362_10680161 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300012205|Ga0137362_10748796 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300012206|Ga0137380_10933388 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300012350|Ga0137372_10034837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4587 | Open in IMG/M |
3300012359|Ga0137385_11464801 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300012469|Ga0150984_103733063 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300012685|Ga0137397_10755717 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300012918|Ga0137396_10900355 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300012923|Ga0137359_10891601 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300012927|Ga0137416_10148378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1832 | Open in IMG/M |
3300012929|Ga0137404_11603953 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300012930|Ga0137407_11359487 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300012944|Ga0137410_11005717 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300014154|Ga0134075_10013002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3240 | Open in IMG/M |
3300015053|Ga0137405_1429116 | All Organisms → cellular organisms → Bacteria | 3034 | Open in IMG/M |
3300015054|Ga0137420_1048767 | All Organisms → cellular organisms → Bacteria | 2728 | Open in IMG/M |
3300015054|Ga0137420_1103803 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300015054|Ga0137420_1251925 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300015356|Ga0134073_10028583 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300015359|Ga0134085_10243966 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300016357|Ga0182032_10539220 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300016387|Ga0182040_10543162 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300016387|Ga0182040_11957798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300016422|Ga0182039_11912277 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300016445|Ga0182038_11006779 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300017930|Ga0187825_10172621 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300017936|Ga0187821_10269993 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300017955|Ga0187817_10416593 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300017966|Ga0187776_11394908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300017995|Ga0187816_10548652 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300017999|Ga0187767_10105987 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300018012|Ga0187810_10420217 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300018047|Ga0187859_10207026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1047 | Open in IMG/M |
3300018088|Ga0187771_11183764 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300018089|Ga0187774_10737316 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300018431|Ga0066655_10149285 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
3300018468|Ga0066662_10659169 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
3300019786|Ga0182025_1035571 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300019877|Ga0193722_1081651 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300020199|Ga0179592_10009733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4143 | Open in IMG/M |
3300020579|Ga0210407_10779056 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300020580|Ga0210403_10209801 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
3300021046|Ga0215015_10244030 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300021046|Ga0215015_10929283 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300021168|Ga0210406_10180103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1761 | Open in IMG/M |
3300021178|Ga0210408_10630636 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300021180|Ga0210396_11717549 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300021401|Ga0210393_10310188 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
3300021403|Ga0210397_10108082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1890 | Open in IMG/M |
3300021403|Ga0210397_10513141 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300021404|Ga0210389_10658225 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300021405|Ga0210387_11459814 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300021406|Ga0210386_11475296 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300021420|Ga0210394_10454356 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300021420|Ga0210394_11087674 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300021478|Ga0210402_11232006 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300021479|Ga0210410_11247305 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300022504|Ga0242642_1060975 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300022505|Ga0242647_1003224 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300022509|Ga0242649_1037402 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300022532|Ga0242655_10173722 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300022533|Ga0242662_10149481 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300024182|Ga0247669_1054037 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300024232|Ga0247664_1051347 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300024288|Ga0179589_10014757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2442 | Open in IMG/M |
3300025928|Ga0207700_11640608 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300026035|Ga0207703_11383639 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300026294|Ga0209839_10192812 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300026308|Ga0209265_1147742 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300026315|Ga0209686_1163304 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300026330|Ga0209473_1282928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300026330|Ga0209473_1289319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300026481|Ga0257155_1044461 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300026515|Ga0257158_1119049 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300026528|Ga0209378_1172991 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300026530|Ga0209807_1354970 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300026542|Ga0209805_1344436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300026548|Ga0209161_10223907 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300026548|Ga0209161_10510217 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300026551|Ga0209648_10394216 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300026551|Ga0209648_10685739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300026557|Ga0179587_10014485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4152 | Open in IMG/M |
3300026557|Ga0179587_10111440 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
3300026557|Ga0179587_10579322 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300027047|Ga0208730_1005092 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300027096|Ga0208099_1019693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 942 | Open in IMG/M |
3300027297|Ga0208241_1030358 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300027334|Ga0209529_1010570 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
3300027371|Ga0209418_1016012 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300027512|Ga0209179_1027581 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300027546|Ga0208984_1047533 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
3300027562|Ga0209735_1052410 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300027587|Ga0209220_1016941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1941 | Open in IMG/M |
3300027643|Ga0209076_1116255 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300027671|Ga0209588_1187132 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300027698|Ga0209446_1147142 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300027701|Ga0209447_10004666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kyorinense | 4105 | Open in IMG/M |
3300027701|Ga0209447_10058607 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300027795|Ga0209139_10218699 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300027812|Ga0209656_10022532 | All Organisms → cellular organisms → Bacteria | 3835 | Open in IMG/M |
3300027821|Ga0209811_10105033 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300027821|Ga0209811_10206280 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300027846|Ga0209180_10162995 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300027862|Ga0209701_10224202 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300027862|Ga0209701_10436907 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300027867|Ga0209167_10187148 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300027882|Ga0209590_10785374 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300027882|Ga0209590_11010730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300027894|Ga0209068_10165321 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300027903|Ga0209488_10403195 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300028789|Ga0302232_10658141 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300028800|Ga0265338_10996866 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300029943|Ga0311340_10352287 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
3300030737|Ga0302310_10006473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8562 | Open in IMG/M |
3300030740|Ga0265460_11500473 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300030848|Ga0075388_11078167 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300030923|Ga0138296_1696776 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300031057|Ga0170834_101786840 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300031122|Ga0170822_15704767 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300031564|Ga0318573_10630212 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300031715|Ga0307476_10026754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3801 | Open in IMG/M |
3300031715|Ga0307476_10115845 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
3300031718|Ga0307474_11375697 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300031720|Ga0307469_10840533 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300031720|Ga0307469_10915529 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300031747|Ga0318502_10951626 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300031754|Ga0307475_10387265 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300031754|Ga0307475_11104812 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300031754|Ga0307475_11501352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300031754|Ga0307475_11524194 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300031820|Ga0307473_11307582 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300031823|Ga0307478_10243659 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
3300031823|Ga0307478_10612340 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300031823|Ga0307478_11446218 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300031859|Ga0318527_10458733 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300031890|Ga0306925_11474289 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300031910|Ga0306923_10911976 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300031912|Ga0306921_10267539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2002 | Open in IMG/M |
3300031941|Ga0310912_11154094 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300031946|Ga0310910_11516927 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300031954|Ga0306926_11301095 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300031959|Ga0318530_10219132 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300031962|Ga0307479_10224474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1853 | Open in IMG/M |
3300031962|Ga0307479_11461048 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300032035|Ga0310911_10752904 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300032035|Ga0310911_10889827 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300032065|Ga0318513_10559483 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300032091|Ga0318577_10626832 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300032180|Ga0307471_100004210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8778 | Open in IMG/M |
3300032180|Ga0307471_102976801 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300032180|Ga0307471_103584478 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300032261|Ga0306920_102308891 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300032261|Ga0306920_102366432 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300032828|Ga0335080_11255030 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300032897|Ga0335071_10247583 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
3300033004|Ga0335084_11646017 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300033402|Ga0326728_10858331 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.79% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.79% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.90% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.60% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.60% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.16% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.73% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.30% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.30% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.30% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.30% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.30% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.30% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.87% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.43% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.43% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.43% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.43% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.43% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.43% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.43% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.43% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.43% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.43% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.43% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.43% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.43% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004117 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF222 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004140 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N55_04806270 | 2189573000 | Grass Soil | MSVVMQALVALAIAVILVLVGLYLPFSPVAQKRAEYD |
JGI12635J15846_103063453 | 3300001593 | Forest Soil | MTNPLRDMSVIVQALVAAALAVVIVLIGVYLPFSPVAQERSS |
JGIcombinedJ26739_1002473341 | 3300002245 | Forest Soil | MSVIVQALVAAALAVVIVLIGVYLPFSPVAQERNAVDKAVDQ |
JGIcombinedJ26739_1012490372 | 3300002245 | Forest Soil | MANPLRDMSVIMQGLLALAIAVVLVLAGVYVPLSPVARERDEFDQAV |
JGI25384J37096_100120435 | 3300002561 | Grasslands Soil | MTSLRDMSVIMQALVALTIAVVLAAVGIFVPGSPVAREKDEYDQAV |
JGI25382J37095_102111021 | 3300002562 | Grasslands Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYLPGSPIARERDEVDQAVQKRT |
JGI25390J43892_101196241 | 3300002911 | Grasslands Soil | MANPLRDMSVFMQALVAVAVAVVLMVAGVYTPGSPIARER |
JGI25617J43924_102903152 | 3300002914 | Grasslands Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARER |
JGIcombinedJ51221_102784252 | 3300003505 | Forest Soil | MANPLRDMSLAMQVLLALAITVVLVVVGVYVPGSPVAQERDEVD |
Ga0062385_106166152 | 3300004080 | Bog Forest Soil | MANPFRDMSVILQVLLGVALGFVLVLAGVFLPVSPVAQEKAEYE* |
Ga0058893_13087232 | 3300004117 | Forest Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDS |
Ga0058897_110183541 | 3300004139 | Forest Soil | MANPFRDMSVFMQGLVAVAIAVVVLLLGVYIPLSPVAQERDAV |
Ga0058894_14777161 | 3300004140 | Forest Soil | MANPFRDMSVFMQGLVAVAIAVVVLLLGVYIPLSPVAQERDA |
Ga0066672_102077553 | 3300005167 | Soil | MANPFRDMSVIMQGLVAAAIAVILVLVGIYLPFSPVAQERDQVDQAVKERSQL |
Ga0066683_102603191 | 3300005172 | Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYLPGSPIAREREEVDQAVQKRTK |
Ga0066684_109413652 | 3300005179 | Soil | MANPLRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIAHER |
Ga0066685_100706564 | 3300005180 | Soil | MANPLQDMSVFMQFLVAVAVAVVLILVGVFLPFSPVAQEREAVD |
Ga0066685_105456841 | 3300005180 | Soil | MANPFRDMSVIMHALVAAAVAVVLVLVGVYVPGSPIARERDEVD |
Ga0070714_1014298951 | 3300005435 | Agricultural Soil | MANPLRDMSVIMQCLLAVAITVVLVVVGVYLPFSPIAQERDEVD |
Ga0070708_1010095081 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MANPLRDMSVIMQGLVAAAIAVVLVLLGIYLPFSPVAQEKDQYDKAVQQRTQ |
Ga0066689_102232771 | 3300005447 | Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDE |
Ga0070730_100523591 | 3300005537 | Surface Soil | MANPFRDMSMIMQALLALAITAVLVVVGIFVPGSPVA |
Ga0066697_100964521 | 3300005540 | Soil | MANPLRDMSVFMQALVAVAVAVVLMVAGVYTPGSPIAREREELAAAVDRR |
Ga0070732_107126001 | 3300005542 | Surface Soil | MASLRDLSVFLQALVALAIAVVLAAVGIFMPGSPVARAKEE |
Ga0066702_105958671 | 3300005575 | Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERDEVDKAVRQR |
Ga0066706_104715683 | 3300005598 | Soil | MASLRDLSVFMQALVALTVAVALIALGIFVPGSPIAREKDEYDQAVVKR |
Ga0070740_103102582 | 3300005607 | Surface Soil | MANPFRDMSVIMQGLVAAAIAVILVLVGIYVPISPVAQERDQVD |
Ga0066905_1013616442 | 3300005713 | Tropical Forest Soil | MANPLRDMSVIMQGLVAAAIAVVLVLLGIYLPFSPV |
Ga0066903_1080130492 | 3300005764 | Tropical Forest Soil | VANPLRDMSVIMQGLVAAALAIVLAVLGVYLPFSPV |
Ga0068863_1002179951 | 3300005841 | Switchgrass Rhizosphere | MANPLRDMSVIMQGLVAAAIAVVLVLLGIYLPFSPVAQEKDQYDKA |
Ga0068858_1014546102 | 3300005842 | Switchgrass Rhizosphere | MANPFQNMSVIMQGLLALAIAVLLVLAGVYVPVSPVAQERDE |
Ga0070766_102023793 | 3300005921 | Soil | MANPLRDMSVIMQGLLAVAITVVLVVVGVYVPLSPVAQERDEVD |
Ga0080026_101782962 | 3300005952 | Permafrost Soil | MANPLRDMSVIMQGLLAVAITVVLVVVGVYVPLSPVAQERDEVDKAVRQR |
Ga0075028_1005969701 | 3300006050 | Watersheds | MANPFRDMSVIMQGLLALAIAVVLVLVGLYVPFSPVAQERADYDKA |
Ga0070715_109944661 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MANPFQNMSVIMQGLLALAIAVVLVLAGVYVPVSPVAQERDEFDKAV |
Ga0075021_102057703 | 3300006354 | Watersheds | MANPFQSMSVIMQGLLALAIAVVLVLAGVYVPVSPVAQERDEFDKAVRQRA |
Ga0066659_102363413 | 3300006797 | Soil | MASLRDLSVFMQALVALTVAVALIALGIFVPGSPIAR |
Ga0079220_106092412 | 3300006806 | Agricultural Soil | MANPFRDMSVIMQGLVALAIAVILVLAGLYVPGSPVAQERADYDAAVQA |
Ga0079220_107759972 | 3300006806 | Agricultural Soil | MANPLRDMSVFMQALVAVAVAVVLMVAGVYTPGSPIAREREEL |
Ga0079220_108035422 | 3300006806 | Agricultural Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARDRSCRYQAAR* |
Ga0075426_111641681 | 3300006903 | Populus Rhizosphere | MANPFRDMSVVMQALVALAIAVILVSVGLYLPFSPVAQKRAEYD |
Ga0066710_1008039711 | 3300009012 | Grasslands Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYLPGSPIAREREE |
Ga0099829_102610663 | 3300009038 | Vadose Zone Soil | MANPLRDMSLIMQVLLALAITVVLVAVGVYVPGSPVAQERDEVDKAVRERA |
Ga0099829_106407721 | 3300009038 | Vadose Zone Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDAAVQKRAK |
Ga0099829_106757772 | 3300009038 | Vadose Zone Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDSAVQARA |
Ga0099830_113407592 | 3300009088 | Vadose Zone Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERDEVDKAV |
Ga0099827_110555391 | 3300009090 | Vadose Zone Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDQVDEAVQKRAK |
Ga0105241_117037002 | 3300009174 | Corn Rhizosphere | MANPFQNMSVIMQGLLALAIAVLLVLAGVYVPVSPVAQ |
Ga0116108_10148751 | 3300009519 | Peatland | MSVIMQGLVALAIAVILVLAGLYVPGSPVAQERADYDKAVQARQKLNQ |
Ga0105249_116889271 | 3300009553 | Switchgrass Rhizosphere | MANPFQNMSVIMQGLLALAIAVLLVLAGVYVPVSPVAQERDEFDKAV |
Ga0126374_105531471 | 3300009792 | Tropical Forest Soil | MAGLRDMSVIMQVLVALAILVVVLLVGIYTPFSPVAQE |
Ga0116219_104508791 | 3300009824 | Peatlands Soil | MSVIMQGLVALAIAVILVLAGLYVPGSPVAQERADYDKAVQARQKL |
Ga0126380_109212032 | 3300010043 | Tropical Forest Soil | MANPFRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQERDQVDKAVAQ |
Ga0126380_111527371 | 3300010043 | Tropical Forest Soil | MANPFRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQERDQ |
Ga0126380_120297732 | 3300010043 | Tropical Forest Soil | MSVIMQCLLAVAITVVLVVVGVYLPFSPIAQERDEV |
Ga0126382_105200604 | 3300010047 | Tropical Forest Soil | MANPLRDMSVFMQALVAVAVAVVLMVAGVYTPGSPIGREREELAAAVD |
Ga0134088_105819301 | 3300010304 | Grasslands Soil | MANPLQDMSVFMQFLVAVAVAVVLILVGVFLPFSPVAQEREAVDKAVQE |
Ga0134064_100279173 | 3300010325 | Grasslands Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDSAVQ |
Ga0134111_100590643 | 3300010329 | Grasslands Soil | MANPLQDMSVFMQFLVAVAVAVVLILVGVFLPFSPVAQEREAVDK |
Ga0126372_109402493 | 3300010360 | Tropical Forest Soil | MANPLRDMSVIMQGLVAAAIAVVLVLLGIYLPFSPVAQEKDQYDKAVQQ |
Ga0126377_124012812 | 3300010362 | Tropical Forest Soil | MANPLRDMSVIMQGLVAAALAIVLVLLGVYLPFSPVAQEKDQLDK |
Ga0126379_107451621 | 3300010366 | Tropical Forest Soil | MANPLRDMSVIMQGLLALAITVVLVVVGVYLPLSPVAQERDEV |
Ga0126379_108393701 | 3300010366 | Tropical Forest Soil | MANPLRDMSVIMQGLVAAALAIVLAVLGVYLPFSPVAQEKEQLDKAVQQRS |
Ga0126379_122232901 | 3300010366 | Tropical Forest Soil | MASLKDLSVFMQALVAVFVAVVLAAVGIFVPGSPVARAKEEYDA |
Ga0126381_1026998601 | 3300010376 | Tropical Forest Soil | MANPFRDMSVVMQGLVALAIAVVLVLAGLYVPGSPVAQARADYDQAVVD |
Ga0134126_104172241 | 3300010396 | Terrestrial Soil | MANPFRDMSVFMQGLVAVAIAVVVLLLGVYIPVSPVAQERDAVEKAVQQRTTLNQ |
Ga0138579_12446692 | 3300011090 | Peatlands Soil | MSVIMQGLVALAIAVILVLAGLYVPGSPVAQERADYDK |
Ga0150983_108411242 | 3300011120 | Forest Soil | MSVIMQGLLAVAITVVLVVVGVYIPLSPVAQERDEVDKAVRQRAQL |
Ga0150983_115536902 | 3300011120 | Forest Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERDEVD |
Ga0137391_102278633 | 3300011270 | Vadose Zone Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERDEVDKAVRLRAQL |
Ga0137391_104830781 | 3300011270 | Vadose Zone Soil | MANPFRDMSVIMQGLLALAITVVLVVVGVYVPGSPVAQERDEVDKAVRLRAQL |
Ga0137391_108010012 | 3300011270 | Vadose Zone Soil | MSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDAAV |
Ga0137393_110123031 | 3300011271 | Vadose Zone Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDQAVQQRTK |
Ga0137363_118067891 | 3300012202 | Vadose Zone Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDRAVQQRTK |
Ga0137362_106801613 | 3300012205 | Vadose Zone Soil | MANPLRDMSVIMQGLLAVAITVVLVVVGVYVPLSPVAQERD |
Ga0137362_107487963 | 3300012205 | Vadose Zone Soil | MANPLRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQE |
Ga0137380_109333881 | 3300012206 | Vadose Zone Soil | MANPLRDMSVIMQGLVAAAIAVVLVLVGIYMPFSPV |
Ga0137372_100348375 | 3300012350 | Vadose Zone Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYLPVSPIARERDE |
Ga0137385_114648012 | 3300012359 | Vadose Zone Soil | MANPLRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQEKDQVDK |
Ga0150984_1037330632 | 3300012469 | Avena Fatua Rhizosphere | MANPFRDMSVIMQGLLALAITVVLVVAGVYIPGSPVAQERDEVDKAAR |
Ga0137397_107557172 | 3300012685 | Vadose Zone Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDRAVQQR |
Ga0137396_109003552 | 3300012918 | Vadose Zone Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDSAVQKRT |
Ga0137359_108916011 | 3300012923 | Vadose Zone Soil | MANPLRDMSVIMQGLVAAAIAVVLVLLGIYLPFSPVAQ |
Ga0137416_101483781 | 3300012927 | Vadose Zone Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERD |
Ga0137404_116039532 | 3300012929 | Vadose Zone Soil | MANPLRDMSLIMQVLLALAITLVLVVAGMYVPGSPVAQERD |
Ga0137407_113594872 | 3300012930 | Vadose Zone Soil | MANPLRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQEKQQVDKAIATR |
Ga0137410_110057171 | 3300012944 | Vadose Zone Soil | MANPFRDMSVIMQGLVALAIAVILVLAGLYVPGSPVAQERAD |
Ga0134075_100130025 | 3300014154 | Grasslands Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDSAVQKKTK |
Ga0137405_14291165 | 3300015053 | Vadose Zone Soil | MSVFMQGLVAVAIAVVVLLLGVYIPLSPVAQERDSVERPSCSARL* |
Ga0137420_10487671 | 3300015054 | Vadose Zone Soil | MANPLRDMSVIMQGLVAAAIAVVLVLLGIYLPFSPVAQEKDQVDKAILQKASL |
Ga0137420_11038032 | 3300015054 | Vadose Zone Soil | MANPLRDMSVIMQGLVAAAIAVVLVLLGIYLPFSPVAQEKDQVDKAILQK |
Ga0137420_12519251 | 3300015054 | Vadose Zone Soil | MANPFRDMSVIMQGLVAIATAFIIMLAGFYVPGSPVAQEHADYDAAVQKR |
Ga0134073_100285831 | 3300015356 | Grasslands Soil | MANPLRDMSVFMQALVAVAVAVVLMVAGVYTPGSPI |
Ga0134085_102439661 | 3300015359 | Grasslands Soil | MASLRDLSVFMQALVAATVAIVLTAVGIFVPGSPIAREKDEYDA |
Ga0182032_105392203 | 3300016357 | Soil | MANPFRDMSVIMQGLVALAIAVILVLAGLYVPFSPVAHERADYYKAV |
Ga0182040_105431623 | 3300016387 | Soil | MANPFRDMSVIMQGLVALAIAVILVLAGLYVPFSPVA |
Ga0182040_119577982 | 3300016387 | Soil | MASLRDMSVFMQALVALAVAVVLTALGIFVPGSPVARERDEVD |
Ga0182039_119122771 | 3300016422 | Soil | MANPLRDMSVIMQGLVAAAIAVVLVLFGIYLPFSPVAQEKDQYDKAVKQ |
Ga0182038_110067792 | 3300016445 | Soil | MANPFRDMSVVMQALVALAIAVILVLVGLYLPFSPVAQKRAEYDQAV |
Ga0187825_101726212 | 3300017930 | Freshwater Sediment | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDA |
Ga0187821_102699931 | 3300017936 | Freshwater Sediment | MANPFRDMSVFMQGLVAVAIAVVVLLLGVYIPLSP |
Ga0187817_104165931 | 3300017955 | Freshwater Sediment | MANPFRDMSVIMQGLVALAIAVILVFAVLYVPFSPVAQ |
Ga0187776_113949082 | 3300017966 | Tropical Peatland | MANPFRDMSVIMQALVAAAIAVVLVLVGVYVPGSPIARERD |
Ga0187816_105486521 | 3300017995 | Freshwater Sediment | MANPFRDMSVIMQGLVALAIAVILVLAGLYAPVSPV |
Ga0187767_101059872 | 3300017999 | Tropical Peatland | MANPFRDMSVIMQGLVALAIAFLLVMAGLFVPFSPV |
Ga0187810_104202172 | 3300018012 | Freshwater Sediment | MANPFRDMSVIMQGLVALAIAVILVLVGLYLPFSPVAQERSAYD |
Ga0187859_102070263 | 3300018047 | Peatland | MANPLRDMSVIMQGLLAVAITVVLVVVGVYVPLSPVAQERDEVDKAVRQRSELN |
Ga0187771_111837642 | 3300018088 | Tropical Peatland | MANPFRDMSVIMQGLVALAIAVILVLAGLYAPVSPVAAERADYD |
Ga0187774_107373161 | 3300018089 | Tropical Peatland | MANPFRDMSVIMQGLVALAIAVILVLVGLYVPFSPVAQERSAYDEAVQKR |
Ga0066655_101492853 | 3300018431 | Grasslands Soil | MANPLRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQEKDQVDKAVQQR |
Ga0066662_106591691 | 3300018468 | Grasslands Soil | MAMANPLRDMSVVMQMLLALAITVVLVVAGVYVPGSPVAQERDEV |
Ga0182025_10355711 | 3300019786 | Permafrost | MANPLRDMSVIMQALVAAALAVVIVLIGVYLPFSPVAQERSSVDRAVEQRNVDR |
Ga0193722_10816511 | 3300019877 | Soil | MANPLRDMSVIMQGLVAAAIAVVLVLVGIYLPFSP |
Ga0179592_100097331 | 3300020199 | Vadose Zone Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERDEVDKA |
Ga0210407_107790562 | 3300020579 | Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERDEVDKAVRERAQ |
Ga0210403_102098013 | 3300020580 | Soil | MANPFRDMSVFMQGLVAVAIAFVVVLLGVYIPLSPVAQ |
Ga0215015_102440302 | 3300021046 | Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARE |
Ga0215015_109292832 | 3300021046 | Soil | MANPFRDMSVIMQGLVAAAVAVVLVLVGVYVPFSPVAQERDAVDK |
Ga0210406_101801031 | 3300021168 | Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVA |
Ga0210408_106306362 | 3300021178 | Soil | MANPFRDMSVIMQGLVALAIAVILVLAGLYVPGSPVAQERSD |
Ga0210396_117175491 | 3300021180 | Soil | MANPLRDMSVIMQGLLAVAITVVLVVVGVYVPLSPVAQERDEVDKAVRQ |
Ga0210393_103101881 | 3300021401 | Soil | MANPFRDMSVFMQGLVAVAIAVVVLLLGVYIPLSPVAQE |
Ga0210397_101080821 | 3300021403 | Soil | MANPFRDMSVIMQALVAVAIAVILVLVGLYVPLSPVAQE |
Ga0210397_105131413 | 3300021403 | Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSP |
Ga0210389_106582251 | 3300021404 | Soil | MANPLRDMSVILQCLLAVVITLVLVVVGVFLPFSPIAQERDEVDKAVR |
Ga0210387_114598142 | 3300021405 | Soil | MANPFRDLPVFMQGLLAVAIAFILVLAGLYVPGSPVAQERADLDAAVQK |
Ga0210386_114752962 | 3300021406 | Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERDEVDK |
Ga0210394_104543561 | 3300021420 | Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDQV |
Ga0210394_110876742 | 3300021420 | Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDQA |
Ga0210402_112320061 | 3300021478 | Soil | MANPFRDMSVVMQALVALAIAVILVLVGLYLPFSP |
Ga0210410_112473052 | 3300021479 | Soil | MANPFRDMSVIMQGLVALAIAVILVLAGLYVPGSPVAQE |
Ga0242642_10609752 | 3300022504 | Soil | MANPFQSMSVIMQGLLALAIAVVLVLAGVYVPVSPVAQERDEF |
Ga0242647_10032241 | 3300022505 | Soil | MANPFRDMSVFMQGLVAVAIAVVVLLLGVYIPLSPVAQERD |
Ga0242649_10374022 | 3300022509 | Soil | MANPFRDMSVFMQGLVAVAIAVVVLLLGVYIPLSPVAQERDAVD |
Ga0242655_101737221 | 3300022532 | Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQER |
Ga0242662_101494812 | 3300022533 | Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIA |
Ga0247669_10540371 | 3300024182 | Soil | MANPFRDMSVFMQGLVAVAIAVVILLLGVYIPLSPVAQE |
Ga0247664_10513471 | 3300024232 | Soil | MANPLRDMSVIMQGLVAAAIAVVLVLLGIYLPFSPVAQEKEQ |
Ga0179589_100147574 | 3300024288 | Vadose Zone Soil | MANPLRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQEKEQ |
Ga0207700_116406081 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MANPLRDMSLIMQVLLALAITVVLVVAGVYVPGSPVAQER |
Ga0207703_113836392 | 3300026035 | Switchgrass Rhizosphere | MANPFQNMSVIMQGLLALAIAVLLVLAGVYVPVSPVAQERDEF |
Ga0209839_101928122 | 3300026294 | Soil | MANPFRDLSVVMQVLVAVAIAFVLVLAGVYLPFSPVAKERDAVDKA |
Ga0209265_11477421 | 3300026308 | Soil | MANPLRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIAHERDDV |
Ga0209686_11633041 | 3300026315 | Soil | MANPFRDMSVIMQGLVAAAIAVIVVLVGLFLPFSPVEQERDQVDQ |
Ga0209473_12829282 | 3300026330 | Soil | MANPLRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARE |
Ga0209473_12893191 | 3300026330 | Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDQAVQ |
Ga0257155_10444612 | 3300026481 | Soil | MANPLRDMSLIMQVLLALAITVVLVVAGVYVPLSPVAQERDEVDKAVRQRAQ |
Ga0257158_11190491 | 3300026515 | Soil | MANPLRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQEKEQVDK |
Ga0209378_11729912 | 3300026528 | Soil | MANPLQDMSVFMQFLVAVAVAVVLILVGVFLPFSPVAQERE |
Ga0209807_13549702 | 3300026530 | Soil | MANPFQNMSVIMQGLLALAIAVVLVLAGVYVPVSPVAQ |
Ga0209805_13444361 | 3300026542 | Soil | MASLRDMSVFMQALVAVAVAVVLTALGVFVPGSPIARERDEV |
Ga0209161_102239071 | 3300026548 | Soil | MASLRDLSVFMQALVALTVAVALIALGIFVPGSPIAREKDEYDQAVVKRT |
Ga0209161_105102171 | 3300026548 | Soil | MANPLRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQEKDQVDKAVQQRAQ |
Ga0209648_103942163 | 3300026551 | Grasslands Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERDEVDKAVRERAQL |
Ga0209648_106857391 | 3300026551 | Grasslands Soil | MANPFRDMSVIMQALVAAAVAVVLVLIGVYVPGSPIARERAE |
Ga0179587_100144851 | 3300026557 | Vadose Zone Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERDEVDKAVR |
Ga0179587_101114401 | 3300026557 | Vadose Zone Soil | MANPFRDMSVVIQVLVGVAIAFVLVLAGIYLPFSPVAKERDAV |
Ga0179587_105793221 | 3300026557 | Vadose Zone Soil | MANPFRDMSMIMQALLALAITAVLVVVGIFVPGSPVAQERDEFDKAVR |
Ga0208730_10050923 | 3300027047 | Forest Soil | MANPFRDMSVIMQGLVALAIAVILVLAGLYVPGSPVAQERT |
Ga0208099_10196931 | 3300027096 | Forest Soil | MANPFRDMSVFMQGLVAVAIAVVVLLLGVYIPLSPVAQERDAVDKAV |
Ga0208241_10303581 | 3300027297 | Forest Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDQAVQKRTK |
Ga0209529_10105701 | 3300027334 | Forest Soil | MANPLRDMSVIMQCLLAVAITVVLVVVGVYLPFSPIAQERDEVDKAVRQRS |
Ga0209418_10160121 | 3300027371 | Forest Soil | MANPLRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQEKDQVDKAVA |
Ga0209179_10275813 | 3300027512 | Vadose Zone Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERDEVDKAVRLRA |
Ga0208984_10475331 | 3300027546 | Forest Soil | MTNPLRDMSVIVQALVAAALAVVIVLIGVYLPFSPV |
Ga0209735_10524103 | 3300027562 | Forest Soil | MENPLRDMSVIVQALVAAALAVVIVLIGVYLPFSPV |
Ga0209220_10169414 | 3300027587 | Forest Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEV |
Ga0209076_11162552 | 3300027643 | Vadose Zone Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSP |
Ga0209588_11871321 | 3300027671 | Vadose Zone Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQE |
Ga0209446_11471422 | 3300027698 | Bog Forest Soil | MANPFRDMSVVMQALIAAAIAVVLVLVGFYVPLSPIAQ |
Ga0209447_100046662 | 3300027701 | Bog Forest Soil | MANPLRDMSVIMQGLLAVAITVVLVVVGVINTACR |
Ga0209447_100586071 | 3300027701 | Bog Forest Soil | MANPFRDMSVVMQVLVAVAIAVILVLAGVYLPFSPIARERDEFD |
Ga0209139_102186992 | 3300027795 | Bog Forest Soil | MANPFRDMSVIMQALVAVAIALVLVMVGLYVPFSPVAQERGDYDKAV |
Ga0209656_100225324 | 3300027812 | Bog Forest Soil | MANPFRDMSVIMQGLVALAIAVILVLVGVFVPGSPVAQERA |
Ga0209811_101050331 | 3300027821 | Surface Soil | MANPFRDMSVFMQGLVAVAIAVVMLLLGVYIPLSPVAQ |
Ga0209811_102062801 | 3300027821 | Surface Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPV |
Ga0209180_101629951 | 3300027846 | Vadose Zone Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQ |
Ga0209701_102242023 | 3300027862 | Vadose Zone Soil | MANPFRDMSVIMQALVAAAVAVVLVLIGVYVPGSPIARERDEVDT |
Ga0209701_104369072 | 3300027862 | Vadose Zone Soil | MANPLRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEV |
Ga0209167_101871481 | 3300027867 | Surface Soil | MANPFRDMSVIMQALVAAAVAVVLVLLGVYLPVSPVARERDEV |
Ga0209590_107853742 | 3300027882 | Vadose Zone Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERD |
Ga0209590_110107301 | 3300027882 | Vadose Zone Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDQVDEAVQK |
Ga0209068_101653211 | 3300027894 | Watersheds | MANPFQSMSVIMQGLLALAIAVVLVLAGVYVPVSPVAQERDEFDKAVRQRAQ |
Ga0209488_104031953 | 3300027903 | Vadose Zone Soil | MANPFRDMSVIMQGLVALAIAVILVLAGLYVPGSPVAQER |
Ga0302232_106581412 | 3300028789 | Palsa | MPNPFRDMSVIMQCLLAVMITVILVVAGIYVPISPVAQER |
Ga0265338_109968662 | 3300028800 | Rhizosphere | MANPLRDMSVIMQCLLAVAITVVLVVVGVYLPFSPI |
Ga0311340_103522871 | 3300029943 | Palsa | MANPFRDMSVFIQILVGVAVAIVLLLVGLFVPISPVAAVRAQ |
Ga0302310_100064731 | 3300030737 | Palsa | MANPFRDMSVVMQVLVGVAIAVILVLLGVYVPLSPVAQARMDVDKAVQERTKLT |
Ga0265460_115004731 | 3300030740 | Soil | MANPFRDMSVFMQGLVAVAIAVVVLLLGVYIPVSPVAQERDAV |
Ga0075388_110781672 | 3300030848 | Soil | MANPFRDMSVVMQALVALAIAVILVLVGLYLPFSPV |
Ga0138296_16967762 | 3300030923 | Soil | MANPFRDMSVVIQVLVGVAIAFVLVLAGIYLPFSPVAKERDAVDKE |
Ga0170834_1017868401 | 3300031057 | Forest Soil | MANPFRDMSMIMQALLALAITAVLVVVGIFVPGSPVAQE |
Ga0170822_157047672 | 3300031122 | Forest Soil | MANPFRDMSVFMQGLVAVAIAVVVLLLGVYIPLSPVAQ |
Ga0318573_106302121 | 3300031564 | Soil | MANPLRDMSVIMQGLVAAAIAVVLVLFGIYLPFSPVAQEKDQYD |
Ga0307476_100267545 | 3300031715 | Hardwood Forest Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYIPGSPIARERDEVDAAV |
Ga0307476_101158451 | 3300031715 | Hardwood Forest Soil | MANPLRDMSVIMQGLLAVAITVVLVVVGVYVPLSPVAQ |
Ga0307474_113756972 | 3300031718 | Hardwood Forest Soil | MENPLRDMSVIMQGLLAVAITVVLVVVGVYVPLSPVAQERDEVDKAVRQRSELN |
Ga0307469_108405332 | 3300031720 | Hardwood Forest Soil | MANPFRDMSVIMQGLLALAIAMILLLAGLYVPGSPVAQERA |
Ga0307469_109155291 | 3300031720 | Hardwood Forest Soil | MANPLRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQEKD |
Ga0318502_109516262 | 3300031747 | Soil | MANPLRDMSVIMQGLVAAAIAVVLVLLGIYLPFSPVAQEKDQYDRAVKDRTQ |
Ga0307475_103872653 | 3300031754 | Hardwood Forest Soil | MENPLRDMSVIMQGLLAVAITVVLVVVGVYVPLSPVAQERDEVDKAV |
Ga0307475_111048121 | 3300031754 | Hardwood Forest Soil | MASLRDMSVIMQALVAAAVAIVLMVVGVYVPGSPIARE |
Ga0307475_115013522 | 3300031754 | Hardwood Forest Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIARERDEVDEAVQK |
Ga0307475_115241941 | 3300031754 | Hardwood Forest Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERDEVDKAVRERA |
Ga0307473_113075821 | 3300031820 | Hardwood Forest Soil | MANPLRDMSVIMQGLVAAAIAVVLVLLGIYLPFSPVAQEKDQYDKAV |
Ga0307478_102436593 | 3300031823 | Hardwood Forest Soil | MANPFRDMSVFMQGLVAVAIAVVVLLLGVYIPLSPVAQER |
Ga0307478_106123403 | 3300031823 | Hardwood Forest Soil | MANPFRDMSVIMQALVAAAVAVVLVLVGVYVPGSPIAREKD |
Ga0307478_114462182 | 3300031823 | Hardwood Forest Soil | MANPLRDMSVIMQCLLAVAITVVLVVVGVYLPFSPIA |
Ga0318527_104587331 | 3300031859 | Soil | MSVIMQGLVALAIAVILVLAGLYVPGSPVAKERADYD |
Ga0306925_114742891 | 3300031890 | Soil | MANPFRDMSVIMQGLVALAIAVILVLAGLYVPFSP |
Ga0306923_109119763 | 3300031910 | Soil | MANPFRDMSVIMQGLVALAIAVILVLAGLYVPFSPVAQER |
Ga0306921_102675394 | 3300031912 | Soil | MANPFRDMSVIMQGLAAVALAFVLVLAGLYVPFSPVAQERSAADQ |
Ga0310912_111540941 | 3300031941 | Soil | MANPLRDMSVIMQGLVAAAIAVVLVLLGIYLPFSP |
Ga0310910_115169271 | 3300031946 | Soil | MANPFRDMSVIMQGLAAVALAFVLVLAGLYVPFSPVA |
Ga0306926_113010952 | 3300031954 | Soil | MANPFRDMSVIMQGLVAVALAFVVVLVGLYVPFSPVAQERTAADQAVQ |
Ga0318530_102191321 | 3300031959 | Soil | MANPLRDMSVIMQGLVAAALAIVLAVLGVYLPFSPVAQEKEQLDK |
Ga0307479_102244743 | 3300031962 | Hardwood Forest Soil | MANPLRDMSLIMQVLLALAITVVLVVVGVYVPGSPVAQERDQVDKAVR |
Ga0307479_114610482 | 3300031962 | Hardwood Forest Soil | MANPFRDMSVFMQGLVAVAIAVVVLLLGVYIPLSPVAQERDAVDKAVQ |
Ga0310911_107529042 | 3300032035 | Soil | MANPLRDMSVIMQGLVAAAIAVVLVLFGIYLPFSPVAQ |
Ga0310911_108898272 | 3300032035 | Soil | MANPFRDMSVIMQGLVALAIAVILVLVGLYVPFSPVAQERSEYD |
Ga0318513_105594831 | 3300032065 | Soil | MANPLRDMSVIMQGLVAAAIAVVLVLLGIYLPFSPVAQEKDQYD |
Ga0318577_106268321 | 3300032091 | Soil | MANPFRDMSVIMQGLAAVALAFVLVLAGLYVPFSPVAQERS |
Ga0307471_1000042101 | 3300032180 | Hardwood Forest Soil | MANPFRDMSVIMQGLVALAIAVVLVLAGLYVPGSPVAQ |
Ga0307471_1029768011 | 3300032180 | Hardwood Forest Soil | MANPFRDMSVIMQALVAAAVAFALVLVGVFVPGSP |
Ga0307471_1035844782 | 3300032180 | Hardwood Forest Soil | MANPFRDMSLIMQALLALAITAVLVVVGIFVPGSPVAQ |
Ga0306920_1023088911 | 3300032261 | Soil | MANPLRDMSVFMQALVAVAVAVVLMVAGVYTPGSPIARERE |
Ga0306920_1023664322 | 3300032261 | Soil | MANPFRDMSVIMQGLVALAIAVILVLAGLYVPGSP |
Ga0335080_112550302 | 3300032828 | Soil | MANPFRDMSVFLQGLVAVAIAVVLVALGVFLPLSPVAQERDAFDKAVQDRTR |
Ga0335071_102475833 | 3300032897 | Soil | MANPFRDMSVIMQGLVALAIAVILVLVGLYAPFSPVAQERSDYD |
Ga0335084_116460172 | 3300033004 | Soil | MANPFRDMSVIMQGLVAAAIAVVLVLVGIYLPFSPVAQEKDQ |
Ga0326728_108583312 | 3300033402 | Peat Soil | MANPFRDMSVIMQGLVALAIAVILVLAGLYAPVSPVA |
⦗Top⦘ |