| Basic Information | |
|---|---|
| Family ID | F019213 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 231 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCSKGM |
| Number of Associated Samples | 146 |
| Number of Associated Scaffolds | 231 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 61.30 % |
| % of genes near scaffold ends (potentially truncated) | 44.59 % |
| % of genes from short scaffolds (< 2000 bps) | 93.94 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.801 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.822 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.139 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.186 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.77% β-sheet: 7.79% Coil/Unstructured: 58.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 231 Family Scaffolds |
|---|---|---|
| PF05721 | PhyH | 3.90 |
| PF07813 | LTXXQ | 2.60 |
| PF05425 | CopD | 1.73 |
| PF11752 | DUF3309 | 1.73 |
| PF00072 | Response_reg | 0.87 |
| PF03734 | YkuD | 0.87 |
| PF01370 | Epimerase | 0.43 |
| PF11236 | DUF3037 | 0.43 |
| PF14248 | DUF4345 | 0.43 |
| PF12704 | MacB_PCD | 0.43 |
| PF05099 | TerB | 0.43 |
| PF04214 | DUF411 | 0.43 |
| PF12849 | PBP_like_2 | 0.43 |
| PF00239 | Resolvase | 0.43 |
| PF01381 | HTH_3 | 0.43 |
| PF03354 | TerL_ATPase | 0.43 |
| PF00589 | Phage_integrase | 0.43 |
| PF05656 | DUF805 | 0.43 |
| PF13360 | PQQ_2 | 0.43 |
| PF02586 | SRAP | 0.43 |
| PF04226 | Transgly_assoc | 0.43 |
| PF00027 | cNMP_binding | 0.43 |
| PF05239 | PRC | 0.43 |
| PF13356 | Arm-DNA-bind_3 | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 231 Family Scaffolds |
|---|---|---|---|
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 10.39 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.90 |
| COG1276 | Putative copper export protein | Inorganic ion transport and metabolism [P] | 1.73 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.43 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.43 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.43 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.43 |
| COG3019 | Uncharacterized metal-binding protein, DUF411 family | Function unknown [S] | 0.43 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 0.43 |
| COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 0.43 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.80 % |
| All Organisms | root | All Organisms | 34.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908044|A5_c1_ConsensusfromContig38229 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 2228664021|ICCgaii200_c0448795 | Not Available | 520 | Open in IMG/M |
| 2228664021|ICCgaii200_c0724655 | Not Available | 809 | Open in IMG/M |
| 3300000886|AL3A1W_1030699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 886 | Open in IMG/M |
| 3300000891|JGI10214J12806_10303472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1393 | Open in IMG/M |
| 3300000891|JGI10214J12806_10362604 | All Organisms → cellular organisms → Bacteria | 3623 | Open in IMG/M |
| 3300004114|Ga0062593_100139884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1811 | Open in IMG/M |
| 3300004114|Ga0062593_100480704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1144 | Open in IMG/M |
| 3300004114|Ga0062593_101859184 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300004114|Ga0062593_102596714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 575 | Open in IMG/M |
| 3300004157|Ga0062590_100600001 | Not Available | 967 | Open in IMG/M |
| 3300004157|Ga0062590_100878527 | Not Available | 836 | Open in IMG/M |
| 3300004463|Ga0063356_100325914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1923 | Open in IMG/M |
| 3300004463|Ga0063356_101929834 | Not Available | 891 | Open in IMG/M |
| 3300004463|Ga0063356_103405852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 685 | Open in IMG/M |
| 3300004463|Ga0063356_104963584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 572 | Open in IMG/M |
| 3300004480|Ga0062592_101247123 | Not Available | 698 | Open in IMG/M |
| 3300004798|Ga0058859_11651243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 655 | Open in IMG/M |
| 3300004800|Ga0058861_10002312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 601 | Open in IMG/M |
| 3300004800|Ga0058861_11541552 | Not Available | 554 | Open in IMG/M |
| 3300004801|Ga0058860_12137057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 801 | Open in IMG/M |
| 3300005093|Ga0062594_100044934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2199 | Open in IMG/M |
| 3300005093|Ga0062594_102991626 | Not Available | 527 | Open in IMG/M |
| 3300005169|Ga0066810_10076950 | Not Available | 701 | Open in IMG/M |
| 3300005330|Ga0070690_101557354 | Not Available | 535 | Open in IMG/M |
| 3300005332|Ga0066388_100961265 | Not Available | 1424 | Open in IMG/M |
| 3300005332|Ga0066388_101237288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1280 | Open in IMG/M |
| 3300005332|Ga0066388_101942764 | Not Available | 1052 | Open in IMG/M |
| 3300005332|Ga0066388_106973035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 568 | Open in IMG/M |
| 3300005332|Ga0066388_107118221 | Not Available | 562 | Open in IMG/M |
| 3300005347|Ga0070668_100254511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1459 | Open in IMG/M |
| 3300005347|Ga0070668_100564641 | Not Available | 992 | Open in IMG/M |
| 3300005347|Ga0070668_100981144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
| 3300005347|Ga0070668_101731219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 574 | Open in IMG/M |
| 3300005367|Ga0070667_100223783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1675 | Open in IMG/M |
| 3300005367|Ga0070667_100845319 | Not Available | 851 | Open in IMG/M |
| 3300005439|Ga0070711_100167449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1672 | Open in IMG/M |
| 3300005441|Ga0070700_101005331 | Not Available | 686 | Open in IMG/M |
| 3300005444|Ga0070694_100447823 | Not Available | 1019 | Open in IMG/M |
| 3300005445|Ga0070708_101002322 | Not Available | 783 | Open in IMG/M |
| 3300005457|Ga0070662_100123755 | Not Available | 1985 | Open in IMG/M |
| 3300005457|Ga0070662_100697776 | Not Available | 858 | Open in IMG/M |
| 3300005459|Ga0068867_101077608 | Not Available | 732 | Open in IMG/M |
| 3300005459|Ga0068867_101521117 | Not Available | 624 | Open in IMG/M |
| 3300005539|Ga0068853_100620060 | Not Available | 1028 | Open in IMG/M |
| 3300005546|Ga0070696_100265901 | Not Available | 1302 | Open in IMG/M |
| 3300005549|Ga0070704_101826509 | Not Available | 563 | Open in IMG/M |
| 3300005615|Ga0070702_101098747 | Not Available | 635 | Open in IMG/M |
| 3300005713|Ga0066905_100335984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1201 | Open in IMG/M |
| 3300005713|Ga0066905_101235265 | Not Available | 669 | Open in IMG/M |
| 3300005713|Ga0066905_101880206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 553 | Open in IMG/M |
| 3300005719|Ga0068861_100118032 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
| 3300005719|Ga0068861_100391451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1231 | Open in IMG/M |
| 3300005719|Ga0068861_101473745 | Not Available | 667 | Open in IMG/M |
| 3300005719|Ga0068861_101716726 | Not Available | 621 | Open in IMG/M |
| 3300005764|Ga0066903_101640751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1221 | Open in IMG/M |
| 3300005764|Ga0066903_102247206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
| 3300005834|Ga0068851_10926640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 547 | Open in IMG/M |
| 3300005841|Ga0068863_101504893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 682 | Open in IMG/M |
| 3300005843|Ga0068860_102052875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. 99 | 593 | Open in IMG/M |
| 3300006047|Ga0075024_100495069 | Not Available | 640 | Open in IMG/M |
| 3300006049|Ga0075417_10686795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Rhodoblastus acidophilus | 525 | Open in IMG/M |
| 3300006172|Ga0075018_10841999 | Not Available | 506 | Open in IMG/M |
| 3300006845|Ga0075421_100128850 | All Organisms → cellular organisms → Bacteria | 3174 | Open in IMG/M |
| 3300006852|Ga0075433_11309550 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006852|Ga0075433_11399981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Rhodoblastus acidophilus | 605 | Open in IMG/M |
| 3300006854|Ga0075425_100279232 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300006854|Ga0075425_100403155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1575 | Open in IMG/M |
| 3300006854|Ga0075425_101066873 | Not Available | 921 | Open in IMG/M |
| 3300006871|Ga0075434_100229075 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300006871|Ga0075434_101443976 | Not Available | 698 | Open in IMG/M |
| 3300006904|Ga0075424_101895772 | Not Available | 630 | Open in IMG/M |
| 3300009053|Ga0105095_10341751 | Not Available | 824 | Open in IMG/M |
| 3300009092|Ga0105250_10398688 | Not Available | 610 | Open in IMG/M |
| 3300009094|Ga0111539_10634229 | Not Available | 1244 | Open in IMG/M |
| 3300009094|Ga0111539_10829643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1076 | Open in IMG/M |
| 3300009094|Ga0111539_11600466 | Not Available | 755 | Open in IMG/M |
| 3300009094|Ga0111539_11613307 | Not Available | 752 | Open in IMG/M |
| 3300009098|Ga0105245_10422913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1336 | Open in IMG/M |
| 3300009101|Ga0105247_10041138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2827 | Open in IMG/M |
| 3300009147|Ga0114129_12675510 | Not Available | 595 | Open in IMG/M |
| 3300009147|Ga0114129_13439611 | Not Available | 508 | Open in IMG/M |
| 3300009156|Ga0111538_13302479 | Not Available | 561 | Open in IMG/M |
| 3300009162|Ga0075423_10068764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3673 | Open in IMG/M |
| 3300009553|Ga0105249_12666122 | Not Available | 572 | Open in IMG/M |
| 3300009553|Ga0105249_12817126 | Not Available | 558 | Open in IMG/M |
| 3300009553|Ga0105249_13350299 | Not Available | 516 | Open in IMG/M |
| 3300009792|Ga0126374_11705725 | Not Available | 524 | Open in IMG/M |
| 3300009792|Ga0126374_11762328 | Not Available | 517 | Open in IMG/M |
| 3300010029|Ga0105074_1116253 | Not Available | 516 | Open in IMG/M |
| 3300010039|Ga0126309_10403745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 818 | Open in IMG/M |
| 3300010043|Ga0126380_10145524 | Not Available | 1509 | Open in IMG/M |
| 3300010043|Ga0126380_10305223 | Not Available | 1135 | Open in IMG/M |
| 3300010047|Ga0126382_10732581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 834 | Open in IMG/M |
| 3300010047|Ga0126382_11942404 | Not Available | 558 | Open in IMG/M |
| 3300010154|Ga0127503_10596015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1093 | Open in IMG/M |
| 3300010154|Ga0127503_10753248 | Not Available | 738 | Open in IMG/M |
| 3300010154|Ga0127503_11108702 | Not Available | 983 | Open in IMG/M |
| 3300010154|Ga0127503_11229220 | Not Available | 560 | Open in IMG/M |
| 3300010362|Ga0126377_11138064 | Not Available | 850 | Open in IMG/M |
| 3300010362|Ga0126377_11154726 | Not Available | 844 | Open in IMG/M |
| 3300010371|Ga0134125_12425852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 570 | Open in IMG/M |
| 3300010371|Ga0134125_12598277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 550 | Open in IMG/M |
| 3300010373|Ga0134128_10657893 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300010396|Ga0134126_10999677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 937 | Open in IMG/M |
| 3300010396|Ga0134126_12296647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300012010|Ga0120118_1018593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1908 | Open in IMG/M |
| 3300012212|Ga0150985_103278458 | Not Available | 707 | Open in IMG/M |
| 3300012469|Ga0150984_112207042 | Not Available | 619 | Open in IMG/M |
| 3300012496|Ga0157353_1048882 | Not Available | 509 | Open in IMG/M |
| 3300012507|Ga0157342_1060327 | Not Available | 555 | Open in IMG/M |
| 3300012909|Ga0157290_10137638 | Not Available | 768 | Open in IMG/M |
| 3300012911|Ga0157301_10309347 | Not Available | 580 | Open in IMG/M |
| 3300012951|Ga0164300_10037788 | Not Available | 1827 | Open in IMG/M |
| 3300012951|Ga0164300_10119380 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300012951|Ga0164300_10157760 | Not Available | 1070 | Open in IMG/M |
| 3300012955|Ga0164298_10111928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1466 | Open in IMG/M |
| 3300012958|Ga0164299_10237161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1081 | Open in IMG/M |
| 3300012958|Ga0164299_10569223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 768 | Open in IMG/M |
| 3300012958|Ga0164299_11341641 | Not Available | 549 | Open in IMG/M |
| 3300012961|Ga0164302_10608777 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300012961|Ga0164302_11428533 | Not Available | 566 | Open in IMG/M |
| 3300012961|Ga0164302_11754606 | Not Available | 522 | Open in IMG/M |
| 3300012984|Ga0164309_10256556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1236 | Open in IMG/M |
| 3300012985|Ga0164308_11129968 | Not Available | 703 | Open in IMG/M |
| 3300012986|Ga0164304_10026500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2898 | Open in IMG/M |
| 3300012986|Ga0164304_10794126 | Not Available | 730 | Open in IMG/M |
| 3300012988|Ga0164306_11165777 | Not Available | 644 | Open in IMG/M |
| 3300012989|Ga0164305_11098536 | Not Available | 683 | Open in IMG/M |
| 3300013297|Ga0157378_10440165 | Not Available | 1292 | Open in IMG/M |
| 3300013297|Ga0157378_10603521 | Not Available | 1109 | Open in IMG/M |
| 3300013297|Ga0157378_11500352 | Not Available | 719 | Open in IMG/M |
| 3300013306|Ga0163162_10891984 | Not Available | 1003 | Open in IMG/M |
| 3300013306|Ga0163162_11338976 | Not Available | 814 | Open in IMG/M |
| 3300013306|Ga0163162_11804274 | Not Available | 699 | Open in IMG/M |
| 3300013306|Ga0163162_11820444 | Not Available | 696 | Open in IMG/M |
| 3300013306|Ga0163162_11950344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 672 | Open in IMG/M |
| 3300014968|Ga0157379_10936998 | Not Available | 823 | Open in IMG/M |
| 3300015371|Ga0132258_10575839 | Not Available | 2825 | Open in IMG/M |
| 3300015371|Ga0132258_10747916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2463 | Open in IMG/M |
| 3300015373|Ga0132257_100406684 | Not Available | 1655 | Open in IMG/M |
| 3300015373|Ga0132257_104141595 | Not Available | 527 | Open in IMG/M |
| 3300015374|Ga0132255_100270654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2434 | Open in IMG/M |
| 3300015374|Ga0132255_100386005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2036 | Open in IMG/M |
| 3300015374|Ga0132255_101736717 | Not Available | 947 | Open in IMG/M |
| 3300015374|Ga0132255_103535924 | Not Available | 665 | Open in IMG/M |
| 3300016270|Ga0182036_11651741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 540 | Open in IMG/M |
| 3300016319|Ga0182033_10436719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1114 | Open in IMG/M |
| 3300016341|Ga0182035_11827021 | Not Available | 550 | Open in IMG/M |
| 3300016371|Ga0182034_11339077 | Not Available | 625 | Open in IMG/M |
| 3300017792|Ga0163161_11944802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300017823|Ga0187818_10035867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2130 | Open in IMG/M |
| 3300017934|Ga0187803_10265288 | Not Available | 682 | Open in IMG/M |
| 3300018032|Ga0187788_10093922 | Not Available | 1077 | Open in IMG/M |
| 3300018469|Ga0190270_11638362 | Not Available | 696 | Open in IMG/M |
| 3300018476|Ga0190274_11419796 | Not Available | 784 | Open in IMG/M |
| 3300018481|Ga0190271_10484260 | Not Available | 1346 | Open in IMG/M |
| 3300019356|Ga0173481_10420787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 659 | Open in IMG/M |
| 3300020069|Ga0197907_10630445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 885 | Open in IMG/M |
| 3300020069|Ga0197907_10640876 | Not Available | 537 | Open in IMG/M |
| 3300020070|Ga0206356_11308229 | Not Available | 611 | Open in IMG/M |
| 3300020070|Ga0206356_11395814 | Not Available | 831 | Open in IMG/M |
| 3300020076|Ga0206355_1350286 | Not Available | 620 | Open in IMG/M |
| 3300020077|Ga0206351_10151862 | Not Available | 651 | Open in IMG/M |
| 3300020078|Ga0206352_10719916 | Not Available | 570 | Open in IMG/M |
| 3300020579|Ga0210407_10442514 | Not Available | 1017 | Open in IMG/M |
| 3300020579|Ga0210407_11313833 | Not Available | 540 | Open in IMG/M |
| 3300022467|Ga0224712_10256922 | Not Available | 808 | Open in IMG/M |
| 3300022726|Ga0242654_10124853 | Not Available | 835 | Open in IMG/M |
| 3300022915|Ga0247790_10072036 | Not Available | 821 | Open in IMG/M |
| 3300023066|Ga0247793_1020931 | Not Available | 947 | Open in IMG/M |
| 3300025313|Ga0209431_10861857 | Not Available | 653 | Open in IMG/M |
| 3300025900|Ga0207710_10103924 | Not Available | 1343 | Open in IMG/M |
| 3300025900|Ga0207710_10732337 | Not Available | 519 | Open in IMG/M |
| 3300025914|Ga0207671_10942697 | Not Available | 681 | Open in IMG/M |
| 3300025915|Ga0207693_10325144 | Not Available | 1204 | Open in IMG/M |
| 3300025918|Ga0207662_10272684 | Not Available | 1117 | Open in IMG/M |
| 3300025923|Ga0207681_11546258 | Not Available | 556 | Open in IMG/M |
| 3300025938|Ga0207704_10732517 | Not Available | 821 | Open in IMG/M |
| 3300025972|Ga0207668_11879894 | Not Available | 540 | Open in IMG/M |
| 3300026075|Ga0207708_10161711 | Not Available | 1769 | Open in IMG/M |
| 3300026075|Ga0207708_11884042 | Not Available | 524 | Open in IMG/M |
| 3300026088|Ga0207641_10207258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1811 | Open in IMG/M |
| 3300026088|Ga0207641_11656994 | Not Available | 642 | Open in IMG/M |
| 3300026089|Ga0207648_11131495 | Not Available | 734 | Open in IMG/M |
| 3300026981|Ga0207822_1020948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 710 | Open in IMG/M |
| 3300027680|Ga0207826_1058979 | Not Available | 1060 | Open in IMG/M |
| 3300027717|Ga0209998_10049733 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300027717|Ga0209998_10062643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 878 | Open in IMG/M |
| 3300027876|Ga0209974_10067136 | Not Available | 1220 | Open in IMG/M |
| 3300028381|Ga0268264_11299335 | Not Available | 738 | Open in IMG/M |
| 3300028889|Ga0247827_10752443 | Not Available | 641 | Open in IMG/M |
| 3300031091|Ga0308201_10259811 | Not Available | 602 | Open in IMG/M |
| 3300031170|Ga0307498_10098736 | Not Available | 895 | Open in IMG/M |
| 3300031170|Ga0307498_10397734 | Not Available | 541 | Open in IMG/M |
| 3300031231|Ga0170824_108430292 | Not Available | 523 | Open in IMG/M |
| 3300031231|Ga0170824_116446681 | Not Available | 501 | Open in IMG/M |
| 3300031231|Ga0170824_116809512 | Not Available | 756 | Open in IMG/M |
| 3300031446|Ga0170820_10010933 | Not Available | 687 | Open in IMG/M |
| 3300031446|Ga0170820_10693318 | Not Available | 517 | Open in IMG/M |
| 3300031446|Ga0170820_12940229 | Not Available | 560 | Open in IMG/M |
| 3300031474|Ga0170818_104222782 | Not Available | 834 | Open in IMG/M |
| 3300031547|Ga0310887_10179124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1136 | Open in IMG/M |
| 3300031562|Ga0310886_10565712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300031720|Ga0307469_10350924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1239 | Open in IMG/M |
| 3300031740|Ga0307468_100306929 | Not Available | 1156 | Open in IMG/M |
| 3300031740|Ga0307468_102340278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300031744|Ga0306918_11157583 | Not Available | 598 | Open in IMG/M |
| 3300031820|Ga0307473_11239832 | Not Available | 556 | Open in IMG/M |
| 3300031858|Ga0310892_11300956 | Not Available | 520 | Open in IMG/M |
| 3300031940|Ga0310901_10368451 | Not Available | 619 | Open in IMG/M |
| 3300031946|Ga0310910_10819922 | Not Available | 732 | Open in IMG/M |
| 3300031949|Ga0214473_10815391 | Not Available | 1004 | Open in IMG/M |
| 3300031949|Ga0214473_11920211 | Not Available | 580 | Open in IMG/M |
| 3300031954|Ga0306926_12374217 | Not Available | 585 | Open in IMG/M |
| 3300032013|Ga0310906_10355114 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300032076|Ga0306924_11558972 | Not Available | 698 | Open in IMG/M |
| 3300032174|Ga0307470_11032332 | Not Available | 656 | Open in IMG/M |
| 3300032174|Ga0307470_11568013 | Not Available | 550 | Open in IMG/M |
| 3300032179|Ga0310889_10078921 | Not Available | 1357 | Open in IMG/M |
| 3300032180|Ga0307471_100543030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1316 | Open in IMG/M |
| 3300032180|Ga0307471_102229615 | Not Available | 690 | Open in IMG/M |
| 3300032205|Ga0307472_100129699 | Not Available | 1801 | Open in IMG/M |
| 3300032205|Ga0307472_100948603 | Not Available | 801 | Open in IMG/M |
| 3300032205|Ga0307472_102255328 | Not Available | 550 | Open in IMG/M |
| 3300032261|Ga0306920_102828661 | Not Available | 660 | Open in IMG/M |
| 3300033289|Ga0310914_10821330 | Not Available | 828 | Open in IMG/M |
| 3300033551|Ga0247830_10044647 | All Organisms → cellular organisms → Bacteria | 2869 | Open in IMG/M |
| 3300033551|Ga0247830_10501352 | Not Available | 955 | Open in IMG/M |
| 3300033551|Ga0247830_11420579 | Not Available | 555 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.03% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.16% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.73% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.30% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.43% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.43% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.43% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.43% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.43% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026981 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 67 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_c1_00274390 | 2124908044 | Soil | MKALVSILAMTLAVGFATAPAFAATTKPPKTQADCEKAGMKWDATTKKCSKGM |
| ICCgaii200_04487951 | 2228664021 | Soil | VKSLVSILTLGFLFAFSAPAFAGKTYTTEAACEKAHMKWDANSKTC |
| ICCgaii200_07246552 | 2228664021 | Soil | MMKTLVSMVTLGLIVSFSAPAFAGTKVPTTQAECTKAGMHWDTSAKKCSKGM |
| AL3A1W_10306991 | 3300000886 | Permafrost | MKGLVSILALSLVVAFTAPAFAGAGTPPETKADCEKAGMKWNDT |
| JGI10214J12806_103034721 | 3300000891 | Soil | DLHLQICICRFASEETPMRTLLSIIVFSLIFAVAAPAFAGGTPKTKADCEKAHMKWDATAKKCS* |
| JGI10214J12806_103626048 | 3300000891 | Soil | MKALVSILALSLVVAFSAPAFAGAPKTEAACKKAGMQWDATTKKCTKGM* |
| Ga0062593_1001398844 | 3300004114 | Soil | MKTLVSMLALGLVVAFSAPAFAGTPKTQAECTKAGMHWDASTKKCTKGM* |
| Ga0062593_1004807042 | 3300004114 | Soil | MKTLVSMLALGLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM* |
| Ga0062593_1018591842 | 3300004114 | Soil | LACRVSVSEERSMKALVSILALSLVVAFSAPAFAGAPKTEAACKKAGMQWDATTKKCTKGM* |
| Ga0062593_1025967141 | 3300004114 | Soil | MKALVSILALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0062590_1006000012 | 3300004157 | Soil | MKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKVGMHWDTSAKKCSKGM* |
| Ga0062590_1008785272 | 3300004157 | Soil | MRTLLSIVAFSLIVAVAAPAFAGAPKTQAACEKAGMKWDATAKKCSKGM* |
| Ga0063356_1003259144 | 3300004463 | Arabidopsis Thaliana Rhizosphere | SILALSLVMAFGVAPAFAAPKTQAACEKAKMHWDTTTNKCT* |
| Ga0063356_1019298342 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKALVSILALGLIVAFSAPAFAGAPKTQAACEKAKMHWDATTKKCS* |
| Ga0063356_1034058522 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKALVSMLALSLVVAFTVPAFAGAPKTEAACKKAGMQWDATAKKCAKGM* |
| Ga0063356_1049635841 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKALASLIALSLVMAFTAPAFAGAPKTQAACEKAKMHWDAAAKKCS* |
| Ga0062592_1012471232 | 3300004480 | Soil | MKALVSILALSLVVAFSAPAFAGAPKTEAACKKAGMQWDATT |
| Ga0058859_116512431 | 3300004798 | Host-Associated | KQIMKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0058861_100023121 | 3300004800 | Host-Associated | AMEETAMKTLVSMLALGLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM* |
| Ga0058861_115415522 | 3300004800 | Host-Associated | MKTLVSVLALGLVVAFSAPAFAGATPKTQAECTKAGLHWDAAAKKCSKGM* |
| Ga0058860_121370572 | 3300004801 | Host-Associated | VSMLALGLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM* |
| Ga0062594_1000449342 | 3300005093 | Soil | MKALVSIIAFSLIVAVAAPAFAGTTPKTEAACKKAGMNWDATAKKCSKGM* |
| Ga0062594_1029916261 | 3300005093 | Soil | MKTLVSVLALSPMVGFSAPAFAGAMPKTQAECTKAGMHWDSSAKKCSKGM* |
| Ga0066810_100769502 | 3300005169 | Soil | MRTLLSIIALSLIVAVAAPAFAGGTPKTMAACEKAHMKWDATAKKCS* |
| Ga0070690_1015573542 | 3300005330 | Switchgrass Rhizosphere | MKALISTLALGLVVAFTVPAFAGAPKTEAACKKAGMQWDATAKKCSKGM* |
| Ga0066388_1009612651 | 3300005332 | Tropical Forest Soil | MKAIVSVLALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCTK |
| Ga0066388_1012372882 | 3300005332 | Tropical Forest Soil | MKVLVSILALGLVVAFSAPAFAGAPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0066388_1019427642 | 3300005332 | Tropical Forest Soil | MKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDAAAKKCTKGM* |
| Ga0066388_1069730351 | 3300005332 | Tropical Forest Soil | MKAFVSILALSLVMAFTAPAFAGTPKTEAACKKAGMQWDATAKKCSKGI* |
| Ga0066388_1071182212 | 3300005332 | Tropical Forest Soil | MKALVSILALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCTK |
| Ga0070668_1002545114 | 3300005347 | Switchgrass Rhizosphere | MKTLISMLALALVMAFSAPAFAAPKTQAACEKAGMHWDQTAKKCSKGM* |
| Ga0070668_1005646412 | 3300005347 | Switchgrass Rhizosphere | MKTLVSIIAFSLIVAVAAPAFAGAPKTEAACKKAGMQWDATAKKCSKGM* |
| Ga0070668_1009811442 | 3300005347 | Switchgrass Rhizosphere | MKTLVSMLALALVMAFSAPAFAAPKTQAACEKAGMYWDQTSKKCSKGM* |
| Ga0070668_1017312191 | 3300005347 | Switchgrass Rhizosphere | MRTLLSIVAFSLIVAVAAPAFAGAPKTQAACEKAGMKWDATAKKCS |
| Ga0070667_1002237831 | 3300005367 | Switchgrass Rhizosphere | MKTLVSMLALALVVAFSAPAFAAPKTQAACEKAGMHWDQTAKKCSKGM* |
| Ga0070667_1008453191 | 3300005367 | Switchgrass Rhizosphere | MKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0070711_1001674492 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALVSVMAFSLIVAFAAPAFAGGTPKTQAACEKAGMKWDATAKKCSKGM* |
| Ga0070700_1010053312 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDVPATPALEETTMKTLVSVLALGLVVAFSAPAFAGATPKTQAACTKAGLHWDAAAKKCSKGM* |
| Ga0070694_1004478231 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | WTTLTGGKTMKTLVSMLALALVVAFSAPAFAAPKTQAACEKAGMHWDQTAKKCSKGM* |
| Ga0070708_1010023223 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SILALSLVVAFTAPAFAAATPKTEAACKKAGMQWDATAKKCSKGM* |
| Ga0070662_1001237554 | 3300005457 | Corn Rhizosphere | MKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSAKKCSKGM* |
| Ga0070662_1006977761 | 3300005457 | Corn Rhizosphere | MKTLVSMLALALVMAFSAPAFAAPKTQAACEKAGMHWDQTAKKCSKGM* |
| Ga0068867_1010776082 | 3300005459 | Miscanthus Rhizosphere | FTLSLMIAVAAPAFAGTTPKTQAACEKHHMKWDATTKTCAKGM* |
| Ga0068867_1015211172 | 3300005459 | Miscanthus Rhizosphere | SMLALALVMAFSAPAFAAPKTQAACEKAGMHWDQTAKKCSKGM* |
| Ga0068853_1006200602 | 3300005539 | Corn Rhizosphere | MKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSAKKCS |
| Ga0070696_1002659013 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTVISIFTLSLMIAVAAPAFAGTTPKTQAACEKHHMKWDATTKTCAKGM* |
| Ga0070704_1018265092 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCTKG |
| Ga0070702_1010987471 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | IFTLSLMIAVAAPAFAGTTPKTQAACEKHHMKWDATTKTCAKGM* |
| Ga0066905_1003359842 | 3300005713 | Tropical Forest Soil | MKAIVSILALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0066905_1012352652 | 3300005713 | Tropical Forest Soil | SEETIMKALVSILALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0066905_1018802061 | 3300005713 | Tropical Forest Soil | MKALVSILALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKC |
| Ga0068861_1001180321 | 3300005719 | Switchgrass Rhizosphere | MKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTS |
| Ga0068861_1003914512 | 3300005719 | Switchgrass Rhizosphere | MKTLVSMLALGLVVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM* |
| Ga0068861_1014737452 | 3300005719 | Switchgrass Rhizosphere | IAFSLIVAVAAPAFAGTPKNEAACKKAGMQWDATAKKCSKGM* |
| Ga0068861_1017167262 | 3300005719 | Switchgrass Rhizosphere | MKALASILALALVVAFSATAFAGAPKTQAACEKAKLHWDASAKKCS* |
| Ga0066903_1016407511 | 3300005764 | Tropical Forest Soil | LVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDAAAKKCTKGM* |
| Ga0066903_1022472062 | 3300005764 | Tropical Forest Soil | MKVILSVLALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCSKGM* |
| Ga0068851_109266401 | 3300005834 | Corn Rhizosphere | RKQIMKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0068863_1015048931 | 3300005841 | Switchgrass Rhizosphere | LVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0068860_1020528751 | 3300005843 | Switchgrass Rhizosphere | MKTLVSILALGLVVAFSAPAFAGAPKTQAECTKAGMHWDASAKKCT |
| Ga0075024_1004950692 | 3300006047 | Watersheds | TMKTLVSMLALALVMAFSAPAFAAPKTQAACEKAGMHWDQTAKKCSKGM* |
| Ga0075417_106867952 | 3300006049 | Populus Rhizosphere | LALSLVVAFSAPAFAGAPKTEAACKKAGMQWDATTKKCTKGM* |
| Ga0075018_108419992 | 3300006172 | Watersheds | MKASVSILAFSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0075421_1001288503 | 3300006845 | Populus Rhizosphere | MMKTLVSMVTLGLIVSFSAPAFAGTKVPTTQAECTKAGMHWDTSAKKCSKGM* |
| Ga0075433_113095503 | 3300006852 | Populus Rhizosphere | MKAFVSILALSLVMAFGVAPAFAAPPKTQAACEKAKMHWDTTTNKCTK* |
| Ga0075433_113999812 | 3300006852 | Populus Rhizosphere | LVSILALSLVVAFSAPAFAGAPKTEAACKKAGMQWDATTKKCTKGM* |
| Ga0075425_1002792324 | 3300006854 | Populus Rhizosphere | MRTLLSIIAFSLIVAVAAPAFAGAPKTQAACEKAGMKWDATAKKCSKGM* |
| Ga0075425_1004031554 | 3300006854 | Populus Rhizosphere | ALSLVVAFSAPAFAGAPKTEAACKKAGMQWDATTKKCTKGM* |
| Ga0075425_1010668732 | 3300006854 | Populus Rhizosphere | MRTLLSIVAFSLIVAVAAPAFAGAPKTQAACEKAGMKWDATAKK |
| Ga0075434_1002290751 | 3300006871 | Populus Rhizosphere | GVTFLVRTPNGGASEETPMKTLLSIIAFSLIVAVAAPAFAGGSPKTQAACEKAHMKWDATAKKCS* |
| Ga0075434_1003773981 | 3300006871 | Populus Rhizosphere | VAFSAPAFAGAPKTEAACKKAGMQWDATTKKCTKGM* |
| Ga0075434_1014439761 | 3300006871 | Populus Rhizosphere | MKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCT |
| Ga0075424_1018957721 | 3300006904 | Populus Rhizosphere | MKALVSILALSLVVTFTAPAFAGAPKTEAACKKAGMQWDATAKKCTKG |
| Ga0105095_103417512 | 3300009053 | Freshwater Sediment | MKTLVSMLALGLIVSFSAPAFAGSKVPTTQAECTKAGMHWDTSAKKCSKGM* |
| Ga0105250_103986881 | 3300009092 | Switchgrass Rhizosphere | MKTLVSMLALVLVMAFSAPAFAAPKTQAACEKAGMHWDQTAKKCSKGM* |
| Ga0111539_106342293 | 3300009094 | Populus Rhizosphere | MSILALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATTKKCTKGM* |
| Ga0111539_108296432 | 3300009094 | Populus Rhizosphere | MKALVSILALSLVVAFTAPAFAGAPKTEAACKKAGMQWD |
| Ga0111539_116004662 | 3300009094 | Populus Rhizosphere | MKTLVSMLALGLVVAFSAPAFAGTPKTQAECTKAGMHWDASSKKCTKGM* |
| Ga0111539_116133072 | 3300009094 | Populus Rhizosphere | SWTTLTGGNTMKTLVSMLALALVMAFSAPAFAAPNTQAACEKAGMHWDQTAKKCSKGM* |
| Ga0105245_104229132 | 3300009098 | Miscanthus Rhizosphere | MEETAMKTLVSMLALGLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM* |
| Ga0105247_100411382 | 3300009101 | Switchgrass Rhizosphere | MYMKALVSIIAFSLIVAVAAPAFAGTTPKTEAACKKAGMNWDATAKKCSKGM* |
| Ga0114129_126755101 | 3300009147 | Populus Rhizosphere | DSHLQIRICRFASEETPMRTLLSIIVFSLIFAVAAPAFAGGTPKTKADCEKAHMKWDATAKKCS* |
| Ga0114129_134396112 | 3300009147 | Populus Rhizosphere | MEKYSDETPMKTLLSIIAFSLIVAVAAPAFAGGTPKTQADCEKAHMKGDATAKKCS* |
| Ga0111538_133024791 | 3300009156 | Populus Rhizosphere | MRTLLSIIVFSLIFAVAAPAFAGGTPKTKADCEKAHMKWDATAKKCS* |
| Ga0075423_100687644 | 3300009162 | Populus Rhizosphere | MEEHLHLVFSLIFAVAAPAFAGGTPKTKADCEKAHMKWDATAKKCS* |
| Ga0105249_126661221 | 3300009553 | Switchgrass Rhizosphere | ALEETKMRTLVSILALGLVVAFCAPAFAGTNIPKTQAECTKAGMHWDASAKKCTKGM* |
| Ga0105249_128171261 | 3300009553 | Switchgrass Rhizosphere | VLGIVVQSASEEMYMKALVSIIAFSLIVAVAAPAFAGTIPKEAACKKAGMTWDATAKKCSKGM* |
| Ga0105249_133502992 | 3300009553 | Switchgrass Rhizosphere | MKVLVSVLALSLIVAFSAPAFAGTPKTQAACEKAGMKWDATAKKCSKGM* |
| Ga0126374_117057251 | 3300009792 | Tropical Forest Soil | MMKGLTSILALSLVVALSAPAFAAEPKTKAACEKAKMHWDDTAKKCSK* |
| Ga0126374_117623281 | 3300009792 | Tropical Forest Soil | MKAIVSILALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCTK |
| Ga0105074_11162531 | 3300010029 | Groundwater Sand | MQQIASEEAPMRTLLSIIAFSLIVAVAAPAFAGGTPKTQAACEKAHMKWDATAKKCS* |
| Ga0126309_104037452 | 3300010039 | Serpentine Soil | MKTLVSMLALGLLVAFAAPAFAGKTPTTEAACTKAHMKWDSAANKCEKGK* |
| Ga0126380_101455242 | 3300010043 | Tropical Forest Soil | MKTLVSMLALALVMAFSAPAFAAPKTQAACERAGMHWDQTAKKCSKGI* |
| Ga0126380_103052234 | 3300010043 | Tropical Forest Soil | MKALVSIIAFSLIVAVAAPAFAGTTPKTEAACKKAGMNWDATAKKCSKGI* |
| Ga0126382_107325811 | 3300010047 | Tropical Forest Soil | ETIMKALVSILALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0126382_119424041 | 3300010047 | Tropical Forest Soil | MKAIVSVLALSLVVAFTAPAFAGAPKTEAACKKAGMQW |
| Ga0127503_105960153 | 3300010154 | Soil | LALSLVVAFTAPAFAAGTPKNEAACKKAGMQWDATAKKCSKGM* |
| Ga0127503_107532482 | 3300010154 | Soil | MQIASEEHMRTLVSIIAFSLIVAVAAPAFAGAPKTEAACKKAGMQWDATAKKCSKGM* |
| Ga0127503_111087022 | 3300010154 | Soil | GVFLNRRRRSMKALVSILALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0127503_112292202 | 3300010154 | Soil | DFALEEAQMKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSAKKCSKGM* |
| Ga0126377_111380641 | 3300010362 | Tropical Forest Soil | MKAIVSVLALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0126377_111547261 | 3300010362 | Tropical Forest Soil | MKALVSILALGLIVAFNAPAFAGAPKTQAACEKAKMHWDATTKKCS* |
| Ga0134125_124258521 | 3300010371 | Terrestrial Soil | MKTLLSIIAFSLIVAVAAPAFAGGTPKTMAACEKAHMRWDATAKKCS* |
| Ga0134125_125982771 | 3300010371 | Terrestrial Soil | QIMKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0134128_106578933 | 3300010373 | Terrestrial Soil | MKTLLSIIAFSLIVAVAAPAFAGGTPKTMAACEKAHMKWDATAKKCS* |
| Ga0134126_109996772 | 3300010396 | Terrestrial Soil | MKALVSILALSLVVAFSAPAFAGAPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0134126_122966472 | 3300010396 | Terrestrial Soil | SMLALGLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM* |
| Ga0120118_10185934 | 3300012010 | Permafrost | MKALVSILAMTLAVGFATAPAFAATTKPPKTQADCEKAGMKWDATTKKCSKGM* |
| Ga0150985_1032784581 | 3300012212 | Avena Fatua Rhizosphere | MKTLFSMFALALVVAFSAPAVAGTHKTQAECTKAGMHWDASTKKCTKGM* |
| Ga0150984_1122070421 | 3300012469 | Avena Fatua Rhizosphere | MKALFSMLALALVVAFSAPAFAGTHKTQAECTKAGMHWDASTKKCTKGM* |
| Ga0157353_10488822 | 3300012496 | Unplanted Soil | MKALASILALALVVAFSATAFAGTPKTQAACEKAKLHWDASAKKCS* |
| Ga0157342_10603271 | 3300012507 | Arabidopsis Rhizosphere | LALVLVMAFSAPAFAAPKTQAACEKAGMHWDQTAKKCSKGM* |
| Ga0157290_101376382 | 3300012909 | Soil | MEETAMKTRVSMLALGLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM* |
| Ga0157301_103093472 | 3300012911 | Soil | VPEIGGDNQMKALVSILALSLVVAFSAPAFAGAPKTEAACKKAGMQWDATTKKCTKGM* |
| Ga0164300_100377882 | 3300012951 | Soil | MKALVSVMAFSMIVAFAAPAFAGGTPKTQAACEKAGMKWDATAKKCSKGM* |
| Ga0164300_101193802 | 3300012951 | Soil | MSPFKLKIHKKIELEETFMRTLLSIVAFSLIVAVTAPAFAGGTPKTMAACEKAHMKWDATAKKCS* |
| Ga0164300_101577602 | 3300012951 | Soil | MYMKALVSIIAFGLIVAVAAPAFAGTTPKTEAACKKAGMNWDATAKKCSKGM* |
| Ga0164298_101119284 | 3300012955 | Soil | MKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCSKGM* |
| Ga0164299_102371614 | 3300012958 | Soil | IVAVAAPAFAGTTPKTEAACKKAGMNWDATAKKCSKGM* |
| Ga0164299_105692231 | 3300012958 | Soil | MKALVSILALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAQKCTKGM* |
| Ga0164299_113416411 | 3300012958 | Soil | LVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0164302_106087772 | 3300012961 | Soil | IAFSLIVAVAAPAFAGGTPKTMAACEKAHMRWDATAKKCS* |
| Ga0164302_114285332 | 3300012961 | Soil | MKALVSILALSLVVAFSAPAFAGTPNTEAACKKAGMQWDATAKKCTKGM* |
| Ga0164302_117546061 | 3300012961 | Soil | MKALVSFLALSLIVAFSAPAFAGTPKTQAACEKAGMKWDATAKKCSKGM* |
| Ga0164309_102565563 | 3300012984 | Soil | MKTLVSVLALSLIVAFSAPAFAGTPKTQAACEKAGMKWDATAKKCSKGM* |
| Ga0164308_111299682 | 3300012985 | Soil | MKALVSVMAFSLIVAFAAPAFAGGTPKTQAACEKAGMKWDATAKKCS |
| Ga0164304_100265007 | 3300012986 | Soil | LVSIIAFGLIVAVAAPAFAGTTPKTEAACKKAGMNWDATAKKCSKGM* |
| Ga0164304_107941262 | 3300012986 | Soil | LVSIIAFGLIVAVAAPAFAGTTPKTEAACKKAGMNWDATANSKGM* |
| Ga0164306_111657771 | 3300012988 | Soil | MKTLASILALSLVVAFTAPAFAAAGTPKTEAACKKAG |
| Ga0164305_110985361 | 3300012989 | Soil | MKALASILALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0157378_104401653 | 3300013297 | Miscanthus Rhizosphere | SILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCTKGM* |
| Ga0157378_106035211 | 3300013297 | Miscanthus Rhizosphere | MQIGGMSMKTVISIFTLSLMIAVAAPAFAGTTPKTQAACEKHHMKWDATTKTCAKGM* |
| Ga0157378_115003522 | 3300013297 | Miscanthus Rhizosphere | MKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKC |
| Ga0163162_108919842 | 3300013306 | Switchgrass Rhizosphere | MRTLVSIIAFSLIVAVAAPAFAGAPKTEAACKKAGMQWDATAKKCSKGM* |
| Ga0163162_113389762 | 3300013306 | Switchgrass Rhizosphere | MKTLVSMLALGRVVAFSAPAFAGTPKTQAECTKAGMHWDASTKKCTKGM* |
| Ga0163162_118042741 | 3300013306 | Switchgrass Rhizosphere | MSMKTVISIFTLSLMIAVAAPAFAGTTPKTQAACEKHHMKWDATTKTCAKGM* |
| Ga0163162_118204441 | 3300013306 | Switchgrass Rhizosphere | MKTLVSIIAFSLIVAVAAPAFAGTPKNEAACKKAGMQWDATAKKCSKGM* |
| Ga0163162_119503441 | 3300013306 | Switchgrass Rhizosphere | KIASEETPMKTLLSIIAFSLIVAVAAPAFAGGTPKTMAACEKAHMRWDATAKKCS* |
| Ga0157379_109369981 | 3300014968 | Switchgrass Rhizosphere | MKTVISIFTLSLMIAVAAPAFAGATPKTQAACEKHHMKWDATTKTCAKGM* |
| Ga0132258_105758394 | 3300015371 | Arabidopsis Rhizosphere | MKTLVSIIALSLIVAVAAPAFAGTTPKTEAACKKAGMNWDATAKKCSKGM* |
| Ga0132258_107479161 | 3300015371 | Arabidopsis Rhizosphere | MKALVSIIAFSLIVAVAAPAFAGTTPKTEAACKKAGMNWDPTAKK |
| Ga0132257_1004066841 | 3300015373 | Arabidopsis Rhizosphere | LRCNCIGGNRIMKALVSILALSLVVVFSAPAFAGAPKTQAACEKAKMHWDATAKKCS* |
| Ga0132257_1041415951 | 3300015373 | Arabidopsis Rhizosphere | TSMKTLVSLITLSLVVAFTAPAFAGAPKHQAACDKAKMHWDAATKKCA* |
| Ga0132255_1002706542 | 3300015374 | Arabidopsis Rhizosphere | MKAFASILALALVVAFSATAFAGAPKTQAACEKAKLHWDAATKKCS* |
| Ga0132255_1003860051 | 3300015374 | Arabidopsis Rhizosphere | QSASEEIYMKALVSIIAFSLIVAVAAPAFAGTTPKTEAACKKAGMNWDATAKKCSKGM* |
| Ga0132255_1017367172 | 3300015374 | Arabidopsis Rhizosphere | MKALVSILALSLVVAFTVPAFAGAPKTEAACKKAGMQWDATAKKCSKGM* |
| Ga0132255_1035359241 | 3300015374 | Arabidopsis Rhizosphere | EETIMKALVSILALSLVVAFTVPAFAGAPKTEAACKKAGMQWDATAKKCAKGM* |
| Ga0182036_116517411 | 3300016270 | Soil | AKVLVSILALSLVVAFSAPAFAAPKTEAACKKHGMQWDATTKKCTKGM |
| Ga0182033_104367192 | 3300016319 | Soil | MKALVSILALSLVVAFSAPAFAAPKTEAACKKHGMQWDATTKKCTKSM |
| Ga0182035_118270212 | 3300016341 | Soil | MEALVSILALSLVVAFTAPAFAGAPKTEAACKKAGKMWD |
| Ga0182034_113390773 | 3300016371 | Soil | LSLVVAFTAPAFAGAPKTEAACKKAGKVWDAATKKCS |
| Ga0163161_119448021 | 3300017792 | Switchgrass Rhizosphere | GNKMKTLVSVLALSLMVGFSAPAFAGATPKTQAECTKAGMHWDSSAKKCSKGM |
| Ga0187818_100358673 | 3300017823 | Freshwater Sediment | VKTLVSIIAFSLVVAVTAPALAGTPKTQAACEKAGMKWDATAKKCSKGM |
| Ga0187803_102652881 | 3300017934 | Freshwater Sediment | VKTLVSIIAFSLVVAVTAPAFAGTPKTQAACEKAGIKWDATAKKCSKGM |
| Ga0187788_100939222 | 3300018032 | Tropical Peatland | MKTLVSMLALALAMAFSAPAFAAPKTQAACEKAGMHWDQTAKKCSKGM |
| Ga0190270_116383621 | 3300018469 | Soil | KTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSAKKCSKGM |
| Ga0190274_114197962 | 3300018476 | Soil | MMKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSAKKCSKGM |
| Ga0190271_104842604 | 3300018481 | Soil | MMKTLVSMVTLGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSA |
| Ga0173481_104207872 | 3300019356 | Soil | MKALVALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATTKKCTKGM |
| Ga0197907_106304452 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | AMEETAMKTLVSMLALGLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM |
| Ga0197907_106408761 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | DFALEEAQMKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSAKKCSKGM |
| Ga0206356_113082292 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | NFALEEAQMKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSAKKCSKGM |
| Ga0206356_113958142 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | GLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM |
| Ga0206355_13502861 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | NFALEEAQMKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKVGMHWDTSAKKCSKGM |
| Ga0206351_101518622 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | ALEEAQMKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKVGMHWDTSAKKCSKGM |
| Ga0206352_107199161 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | FALEEAQMKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSAKKCSKGM |
| Ga0210407_104425141 | 3300020579 | Soil | MKALVSILALSLVVAFTAPAFAGTPKNEAACKKAGMQWDATAKKCSKGM |
| Ga0210407_113138331 | 3300020579 | Soil | RYLMKALVSVMAFSLIVAFAAPAFAGGTPKTQAACEKAGMKWDATAKKCSKGM |
| Ga0224712_102569223 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | ALEEAQMKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSAKKCSKGM |
| Ga0242654_101248531 | 3300022726 | Soil | MKALVSVMAFSLIVAFAAPAFAGGTPKTQAACEKAGMKWDATAKKCSKGM |
| Ga0247790_100720361 | 3300022915 | Soil | PRCFRIRSNFALEEAQMKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKVGMHWDTSAKKCSKGM |
| Ga0247793_10209312 | 3300023066 | Soil | MKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSAKKCSKGM |
| Ga0209431_108618571 | 3300025313 | Soil | MMKTLVSMVTLCLIVSFSAPAFAGTKVPTTQAECTKAGMHWDNSAKKCSKGM |
| Ga0207710_101039242 | 3300025900 | Switchgrass Rhizosphere | MKALVSIIAFSLIVAVAAPAFAGTTPKTEAACKKAGMNWDATAKKCSKGM |
| Ga0207710_107323371 | 3300025900 | Switchgrass Rhizosphere | MKTVISIFTLSLMIAVAAPAFAGTTPKTQAACEKHHMKWDATTKTCAKGM |
| Ga0207671_109426971 | 3300025914 | Corn Rhizosphere | MKTLVSMLALALVMAFSAPAFAAPKTQAACEKAGMHWDQTAKKCSKGM |
| Ga0207693_103251441 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALASILALSLVVAFTAPAFAAGTPKTEAACKKAGMQWD |
| Ga0207662_102726841 | 3300025918 | Switchgrass Rhizosphere | MKTLVSMLALALVVAFSAPAFAAPKTQAACEKAGMHWDQTAKKCSKGM |
| Ga0207681_115462581 | 3300025923 | Switchgrass Rhizosphere | MKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKK |
| Ga0207704_107325172 | 3300025938 | Miscanthus Rhizosphere | MKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCSKGM |
| Ga0207668_118798942 | 3300025972 | Switchgrass Rhizosphere | MKTLVSIIAFSLIVAVAAPAFAGAPKTEAACKKAGMQWDATAKKCSKGM |
| Ga0207708_101617113 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLVSMLALGLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM |
| Ga0207708_118840422 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALVSILALSLVVAFSAPAFAGAPKTEAACKKAGMQWDATAKKCSKGM |
| Ga0207641_102072585 | 3300026088 | Switchgrass Rhizosphere | LVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCTKGM |
| Ga0207641_116569942 | 3300026088 | Switchgrass Rhizosphere | MKTLVSMLALALVMAFSAPAFAAPKTQAACEKAGMHWDQTAKKC |
| Ga0207648_111314951 | 3300026089 | Miscanthus Rhizosphere | IFTLSLMIAVAAPAFAGTTPKTQAACEKHHMKWDATTKTCAKGM |
| Ga0207822_10209481 | 3300026981 | Tropical Forest Soil | LVSIVAFSLIVAVAAPAFAAGMPKTQAACEKAGMKWDATTKKCSKGM |
| Ga0207826_10589792 | 3300027680 | Tropical Forest Soil | MKTLVSIVAFSLIVAVAAPAFAAGMPKTQAACEKAGMKWDATTKKCSKGM |
| Ga0209998_100497332 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MKALVSILALSLVVAFSAPAFAGAPKTEAACKKAGMQWDATTKKCTKGM |
| Ga0209998_100626431 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MRTLLSIVAFSLIVAVAAPAFAGAPKTQAACEKAGMKWDATAKKCSKGM |
| Ga0209974_100671362 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MKALVSILALSLVVAFSAPAFAGAPKTEAACKKAGMQWDATAKKCTKGM |
| Ga0268264_112993352 | 3300028381 | Switchgrass Rhizosphere | MKTLVSMLALGLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCS |
| Ga0247827_107524432 | 3300028889 | Soil | MRTLVSMLALGLVIAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM |
| Ga0308201_102598111 | 3300031091 | Soil | QPCVGGNTMKTLVSMLALGLVVAFSAPAFAGAPKTQAECTKAGMHWDTSAKKCSKGM |
| Ga0307498_100987361 | 3300031170 | Soil | LEEIPVQSALEETSMKALVSILAFSLIFAVAAPAFAGATPKTQAACEKAHLKWDATAKKC |
| Ga0307498_103977341 | 3300031170 | Soil | MKALVSILALSLVVAFSAPAFAGTPKNEAACKKAGMQWDATAKKCSKGM |
| Ga0170824_1084302921 | 3300031231 | Forest Soil | MKALVSILALSLVVAFSAPAFAGTPKTEAACKKAGMQWDATAKKCTKGM |
| Ga0170824_1164466812 | 3300031231 | Forest Soil | ALVSVLALSLVVAFSVPAFAGTPKTEAACKKAGMNWDATAKKCSKGM |
| Ga0170824_1168095121 | 3300031231 | Forest Soil | IMKALVSILALSLVVAFTAPAFAGTPKNEAACKKAGMQWDANAKKCSKGM |
| Ga0170820_100109331 | 3300031446 | Forest Soil | NRRRPIMKTLASILALSLVVAFTAPAFAAGTPKNEAACKKAGMQWDATAKKCSKGM |
| Ga0170820_106933181 | 3300031446 | Forest Soil | MKALVSVLALSLVVAFSVPAFAGTPKTEAACKKAGMNWDATAKKCSKGM |
| Ga0170820_129402291 | 3300031446 | Forest Soil | MKTLVSVLALSLIVAFSAPAFAGTPKTQAACEKAGMKWDATAKKCSKGM |
| Ga0170818_1042227821 | 3300031474 | Forest Soil | LVSILALSLVVAFTAPAFAGAPKTEAACKKAGMQWDATAKKCTKGM |
| Ga0310887_101791241 | 3300031547 | Soil | MEETAMKTLVSMLALGLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM |
| Ga0310886_105657121 | 3300031562 | Soil | MKTLVSMLAVGLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM |
| Ga0307469_103509241 | 3300031720 | Hardwood Forest Soil | MKALASILALALVVAFSATAVAGAPKTQAACEKAKLHWDASAKKCS |
| Ga0307468_1003069292 | 3300031740 | Hardwood Forest Soil | MENASEEIPMKTLVSIIAFSLIVAVAAPAFAGGTPKTQAACEKAHMKWDATGKKCS |
| Ga0307468_1023402781 | 3300031740 | Hardwood Forest Soil | TSMKALASILALALVVAFSATAFAGAPKTQAACEKAKLHWDASAKKCS |
| Ga0306918_111575832 | 3300031744 | Soil | MKALVSILALSLVMAFTAPAFAGAPKTEAACKKAGKVWDAATKKCS |
| Ga0307473_112398322 | 3300031820 | Hardwood Forest Soil | MKTLVSIIAFSLIVAVAAPAFAGTPKNEAACKKAGMQWDATAKKCSKGM |
| Ga0310892_113009562 | 3300031858 | Soil | RCCRIRSNFALEETQMKTLVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSAKKCSKGM |
| Ga0310901_103684511 | 3300031940 | Soil | MKTLVSMLALALVMAFSAPAFAAPNTQAACEKAGMHWDQTAKKCSKGM |
| Ga0310910_108199221 | 3300031946 | Soil | LVSILALSLVMAFTAPAFAGAPKTEAACKKAGKMWDAATKKCS |
| Ga0214473_108153912 | 3300031949 | Soil | MMKTLVSMVTLGLIVSFSAPAFAGTKVPTTQAECTKAGMHWDNSAKKCSKGM |
| Ga0214473_119202111 | 3300031949 | Soil | MKTFVSMLALGLIVSFSAPAFAGTKVPTTQSECTKAGMHWDTSAKKCSKGM |
| Ga0306926_123742171 | 3300031954 | Soil | MKALVSILALSLVVAFTAPAFAGAPKTEAACKKAGKVW |
| Ga0310906_103551141 | 3300032013 | Soil | MKTLVSMLALGLVVAFSAPAFAGTPKTQAECTKAGMHWDASTKKCTKGM |
| Ga0306924_115589721 | 3300032076 | Soil | MKALVSILALSLVMAFTAPAFAGAPKTEAACKKAGKMWDAATK |
| Ga0307470_110323321 | 3300032174 | Hardwood Forest Soil | MKTLVSMLALALVMAFSAPAFAAPKTQAACEKAGMHWDQNAKKCSKGM |
| Ga0307470_115680131 | 3300032174 | Hardwood Forest Soil | KHLEETPMKTLLSIIAFSLIVAVAAPAFAGGTPKTQAACEKAHMKWDATAKKCS |
| Ga0310889_100789213 | 3300032179 | Soil | KTLVSMLAVGLLVAFSAPAFAGTKEPKTQAECTKAGMHWDTSAKKCSKGM |
| Ga0307471_1005430304 | 3300032180 | Hardwood Forest Soil | MKTLVSMLALALVMAFSAPAFAAPKTQAACEKAGMHWDQTSKKCSKGM |
| Ga0307471_1022296152 | 3300032180 | Hardwood Forest Soil | MKTLVSIIAFSLIVAVAAPAFAGTPKTEAACKKAGMQWDATAKKCSKGM |
| Ga0307472_1001296992 | 3300032205 | Hardwood Forest Soil | MSPFKLKIHKKIELEETFMRTLLSIVAFSLIVAVAAPAFAGGTAACEKVHMKWDATAKKC |
| Ga0307472_1009486032 | 3300032205 | Hardwood Forest Soil | EGWLALWSSGTGDVTASEEIRMKTLVSVLALSLIVAFSAPAFAGTPKTQAACEKAGMKWDATAKKRSKGM |
| Ga0307472_1022553282 | 3300032205 | Hardwood Forest Soil | KTLVSMLALALVMAFSAPAFAAPKTQAACEKAGMHWDQTSKKCSKGM |
| Ga0306920_1028286611 | 3300032261 | Soil | MKALVSILALSLVMAFTAPAFAGAPKTEAACKKAGKMWDAATKKCS |
| Ga0310914_108213302 | 3300033289 | Soil | MKALVSILALSLVVAFTAPAFAADVTAAKTKADCHKAGGMWDAK |
| Ga0247830_100446473 | 3300033551 | Soil | MKALASILALALVVAFSATAFAGAPKTQAACEKAKLHWDASAKKCS |
| Ga0247830_105013521 | 3300033551 | Soil | MRTLVSILALGLVVAFSAPAFAGTNVPKTQAECTKAGMHWDASAKKCTKGM |
| Ga0247830_114205791 | 3300033551 | Soil | MKTLVSMLALALVMAFSAPAFAAPKTQAACEKAGMHWDKTAKKCSKGM |
| ⦗Top⦘ |