NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019199

Metagenome / Metatranscriptome Family F019199

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019199
Family Type Metagenome / Metatranscriptome
Number of Sequences 231
Average Sequence Length 41 residues
Representative Sequence LLAEGETTHIVTDSAMKIAALPEKYLSAFRAAVGR
Number of Associated Samples 202
Number of Associated Scaffolds 231

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.45 %
% of genes near scaffold ends (potentially truncated) 95.24 %
% of genes from short scaffolds (< 2000 bps) 88.74 %
Associated GOLD sequencing projects 193
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.476 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(10.390 % of family members)
Environment Ontology (ENVO) Unclassified
(19.048 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.784 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.05%    β-sheet: 0.00%    Coil/Unstructured: 80.95%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 231 Family Scaffolds
PF00221Lyase_aromatic 83.55
PF03795YCII 7.79
PF01894UPF0047 0.87
PF01796OB_aCoA_assoc 0.43
PF01381HTH_3 0.43
PF14559TPR_19 0.43
PF13649Methyltransf_25 0.43
PF00378ECH_1 0.43
PF00691OmpA 0.43
PF12762DDE_Tnp_IS1595 0.43
PF01039Carboxyl_trans 0.43
PF00381PTS-HPr 0.43
PF01209Ubie_methyltran 0.43
PF13476AAA_23 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 231 Family Scaffolds
COG2986Histidine ammonia-lyaseAmino acid transport and metabolism [E] 83.55
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 7.79
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.87
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.43
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.43
COG1545Uncharacterized OB-fold protein, contains Zn-ribbon domainGeneral function prediction only [R] 0.43
COG1925HPr or related phosphotransfer proteinSignal transduction mechanisms [T] 0.43
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.43
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.43
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.48 %
UnclassifiedrootN/A9.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001546|JGI12659J15293_10056160All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae890Open in IMG/M
3300002912|JGI25386J43895_10140898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis599Open in IMG/M
3300003505|JGIcombinedJ51221_10308101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis644Open in IMG/M
3300004091|Ga0062387_100353923All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter970Open in IMG/M
3300004092|Ga0062389_101549170All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter846Open in IMG/M
3300004633|Ga0066395_10834536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter555Open in IMG/M
3300004635|Ga0062388_102772781All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005178|Ga0066688_10560608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter734Open in IMG/M
3300005332|Ga0066388_106611795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter584Open in IMG/M
3300005445|Ga0070708_101302270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter679Open in IMG/M
3300005534|Ga0070735_10135803All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1530Open in IMG/M
3300005538|Ga0070731_10781062All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter634Open in IMG/M
3300005555|Ga0066692_10732176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter611Open in IMG/M
3300005556|Ga0066707_10090740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1861Open in IMG/M
3300005563|Ga0068855_102597320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter502Open in IMG/M
3300005574|Ga0066694_10220697All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae899Open in IMG/M
3300005586|Ga0066691_10392725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae824Open in IMG/M
3300005591|Ga0070761_10154600All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1345Open in IMG/M
3300005712|Ga0070764_10502796All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter729Open in IMG/M
3300005892|Ga0075275_1103352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae502Open in IMG/M
3300005895|Ga0075277_1091768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae510Open in IMG/M
3300005902|Ga0075273_10094922All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005921|Ga0070766_10611309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter733Open in IMG/M
3300005994|Ga0066789_10239694All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae761Open in IMG/M
3300005995|Ga0066790_10074635All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1460Open in IMG/M
3300005995|Ga0066790_10528833All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter504Open in IMG/M
3300006028|Ga0070717_11411418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae632Open in IMG/M
3300006031|Ga0066651_10578426All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300006052|Ga0075029_100081726All Organisms → cellular organisms → Bacteria1914Open in IMG/M
3300006173|Ga0070716_100815774All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300006174|Ga0075014_100457660All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae707Open in IMG/M
3300006174|Ga0075014_100922945All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300006358|Ga0068871_101071171All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300006797|Ga0066659_11215436All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300006800|Ga0066660_11639246All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300006872|Ga0101947_1034531All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300006903|Ga0075426_11028580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae623Open in IMG/M
3300009088|Ga0099830_10548919All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300009088|Ga0099830_11553021All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300009523|Ga0116221_1312316All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300009645|Ga0116106_1041716All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300009683|Ga0116224_10017050All Organisms → cellular organisms → Bacteria3592Open in IMG/M
3300009764|Ga0116134_1139127All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300009824|Ga0116219_10302488All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300009839|Ga0116223_10038142All Organisms → cellular organisms → Bacteria3214Open in IMG/M
3300009839|Ga0116223_10552734All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300010321|Ga0134067_10053845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1302Open in IMG/M
3300010359|Ga0126376_11846692All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300010360|Ga0126372_10279471Not Available1453Open in IMG/M
3300010361|Ga0126378_13259728All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300010376|Ga0126381_103837557All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300010387|Ga0136821_1192938All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300010876|Ga0126361_11036753All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300011270|Ga0137391_10775305All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300012096|Ga0137389_10159837Not Available1851Open in IMG/M
3300012189|Ga0137388_11511754All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300012200|Ga0137382_10195637All Organisms → cellular organisms → Bacteria → Acidobacteria1387Open in IMG/M
3300012200|Ga0137382_10642432All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis759Open in IMG/M
3300012202|Ga0137363_11823932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis501Open in IMG/M
3300012203|Ga0137399_11311995All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300012205|Ga0137362_11446759All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300012205|Ga0137362_11503993All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300012207|Ga0137381_10218090Not Available1655Open in IMG/M
3300012209|Ga0137379_10175461All Organisms → cellular organisms → Bacteria → Acidobacteria2055Open in IMG/M
3300012209|Ga0137379_11669128All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300012210|Ga0137378_10176248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1987Open in IMG/M
3300012361|Ga0137360_11182429All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300012582|Ga0137358_10919618All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300012683|Ga0137398_10151618All Organisms → cellular organisms → Bacteria → Acidobacteria1504Open in IMG/M
3300012923|Ga0137359_11161629All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis659Open in IMG/M
3300012924|Ga0137413_11186258All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300012925|Ga0137419_10899520All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300012971|Ga0126369_13231779All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300012987|Ga0164307_11255353All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis617Open in IMG/M
3300014153|Ga0181527_1045812All Organisms → cellular organisms → Bacteria2399Open in IMG/M
3300014158|Ga0181521_10370412All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300014159|Ga0181530_10562010All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300014168|Ga0181534_10245700All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300014169|Ga0181531_11087908All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300014494|Ga0182017_10540913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae712Open in IMG/M
3300014638|Ga0181536_10371205All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300015241|Ga0137418_10077539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3017Open in IMG/M
3300015241|Ga0137418_11114579All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300015357|Ga0134072_10039293Not Available1273Open in IMG/M
3300016422|Ga0182039_11311754All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300017823|Ga0187818_10089048All Organisms → cellular organisms → Bacteria1333Open in IMG/M
3300017823|Ga0187818_10260391All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300017933|Ga0187801_10485286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis521Open in IMG/M
3300017947|Ga0187785_10485804All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300017961|Ga0187778_10775790All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300017974|Ga0187777_10952431All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300017975|Ga0187782_11380121All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300018007|Ga0187805_10401618All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300018018|Ga0187886_1289796All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis612Open in IMG/M
3300018024|Ga0187881_10305266All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300018035|Ga0187875_10345420All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300018043|Ga0187887_10067547All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2172Open in IMG/M
3300018043|Ga0187887_10621067All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300018047|Ga0187859_10138226All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300018058|Ga0187766_10332340All Organisms → cellular organisms → Bacteria → Proteobacteria991Open in IMG/M
3300018088|Ga0187771_10161852All Organisms → cellular organisms → Bacteria1844Open in IMG/M
3300018090|Ga0187770_10636155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis849Open in IMG/M
3300018482|Ga0066669_10353964All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300019785|Ga0182022_1014974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1333Open in IMG/M
3300019885|Ga0193747_1083320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis785Open in IMG/M
3300020579|Ga0210407_10134759All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1896Open in IMG/M
3300020579|Ga0210407_10780409All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis738Open in IMG/M
3300020581|Ga0210399_10028774All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4434Open in IMG/M
3300020582|Ga0210395_10123184All Organisms → cellular organisms → Bacteria → Acidobacteria1926Open in IMG/M
3300020582|Ga0210395_10794985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis705Open in IMG/M
3300020583|Ga0210401_10102071All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2694Open in IMG/M
3300021170|Ga0210400_10826637All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300021171|Ga0210405_10368463All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300021180|Ga0210396_11725252All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300021401|Ga0210393_11288725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis586Open in IMG/M
3300021405|Ga0210387_10345499All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300021407|Ga0210383_11204853All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300021407|Ga0210383_11283219All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300021432|Ga0210384_10289127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1476Open in IMG/M
3300021478|Ga0210402_10351223All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1368Open in IMG/M
3300021559|Ga0210409_10773524All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300022531|Ga0242660_1216789All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300022557|Ga0212123_10183190Not Available1573Open in IMG/M
3300022733|Ga0224562_1010298All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae740Open in IMG/M
3300023019|Ga0224560_107410All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300023101|Ga0224557_1150820All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300024295|Ga0224556_1002358All Organisms → cellular organisms → Bacteria5372Open in IMG/M
3300025414|Ga0208935_1048657All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300025475|Ga0208478_1024877All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1227Open in IMG/M
3300025480|Ga0208688_1034151All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300025527|Ga0208714_1112173All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300025612|Ga0208691_1032391All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1208Open in IMG/M
3300025931|Ga0207644_10415375All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1102Open in IMG/M
3300025939|Ga0207665_11168056All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis614Open in IMG/M
3300026025|Ga0208778_1013853All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300026281|Ga0209863_10128561All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis743Open in IMG/M
3300026294|Ga0209839_10064029Not Available1303Open in IMG/M
3300026318|Ga0209471_1239863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis636Open in IMG/M
3300026322|Ga0209687_1126349All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300026325|Ga0209152_10489031Not Available505Open in IMG/M
3300026335|Ga0209804_1075152All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1592Open in IMG/M
3300026542|Ga0209805_1267689All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis659Open in IMG/M
3300026551|Ga0209648_10215128All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1453Open in IMG/M
3300026928|Ga0207779_1033991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis600Open in IMG/M
3300027045|Ga0207726_1014792All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1269Open in IMG/M
3300027073|Ga0208366_1022049All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis701Open in IMG/M
3300027497|Ga0208199_1084603All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300027737|Ga0209038_10064738All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300027745|Ga0209908_10122521Not Available663Open in IMG/M
3300027825|Ga0209039_10137852All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300027825|Ga0209039_10285594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis652Open in IMG/M
3300027846|Ga0209180_10056631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2173Open in IMG/M
3300027853|Ga0209274_10161515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1132Open in IMG/M
3300027853|Ga0209274_10329009All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300027853|Ga0209274_10430799All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300027854|Ga0209517_10114173All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1790Open in IMG/M
3300027855|Ga0209693_10385482All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis678Open in IMG/M
3300027902|Ga0209048_10118737All Organisms → cellular organisms → Bacteria → Acidobacteria2010Open in IMG/M
3300027905|Ga0209415_10876378All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300028747|Ga0302219_10335629All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300028792|Ga0307504_10357339All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300028798|Ga0302222_10139117All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300029907|Ga0311329_10089588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2567Open in IMG/M
3300029913|Ga0311362_11189115All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300029922|Ga0311363_10045851All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6898Open in IMG/M
3300029923|Ga0311347_10875401All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300029944|Ga0311352_10160898All Organisms → cellular organisms → Bacteria1937Open in IMG/M
3300029945|Ga0311330_10356588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1232Open in IMG/M
3300029951|Ga0311371_11568608All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300029954|Ga0311331_10596249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1048Open in IMG/M
3300029993|Ga0302304_10083413All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300029995|Ga0302210_10045001Not Available1285Open in IMG/M
3300029999|Ga0311339_10474560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1280Open in IMG/M
3300029999|Ga0311339_10759331All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300030007|Ga0311338_10950267All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300030041|Ga0302274_10447520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis566Open in IMG/M
3300030042|Ga0302300_1038968All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1602Open in IMG/M
3300030043|Ga0302306_10023333All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2549Open in IMG/M
3300030057|Ga0302176_10441033All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300030399|Ga0311353_10371632All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300030494|Ga0310037_10279939All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300030509|Ga0302183_10304134All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300030519|Ga0302193_10634626All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300030524|Ga0311357_10481567All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300030659|Ga0316363_10052518All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1940Open in IMG/M
3300030659|Ga0316363_10253969All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300030737|Ga0302310_10123360Not Available1580Open in IMG/M
3300030943|Ga0311366_11732413All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300031057|Ga0170834_105648717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis513Open in IMG/M
3300031122|Ga0170822_11891174All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis623Open in IMG/M
3300031231|Ga0170824_122294102All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300031446|Ga0170820_17539881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis554Open in IMG/M
3300031521|Ga0311364_10399149All Organisms → cellular organisms → Bacteria → Acidobacteria1395Open in IMG/M
3300031708|Ga0310686_119320610All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis512Open in IMG/M
3300031718|Ga0307474_10657256All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300031718|Ga0307474_11419663All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300031720|Ga0307469_10882284All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300031754|Ga0307475_10590953All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis889Open in IMG/M
3300031823|Ga0307478_10643479All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300031954|Ga0306926_10733629All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1196Open in IMG/M
3300031954|Ga0306926_11129494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis925Open in IMG/M
3300031962|Ga0307479_10625523All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300031996|Ga0308176_10416068All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1345Open in IMG/M
3300032174|Ga0307470_10260613All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1151Open in IMG/M
3300032174|Ga0307470_11891521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis507Open in IMG/M
3300032180|Ga0307471_100502790All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300032805|Ga0335078_10391728All Organisms → cellular organisms → Bacteria1827Open in IMG/M
3300032828|Ga0335080_10200479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2195Open in IMG/M
3300032828|Ga0335080_11208202All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300032892|Ga0335081_10869318All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300032892|Ga0335081_12332023All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300032893|Ga0335069_10461172All Organisms → cellular organisms → Bacteria → Acidobacteria1480Open in IMG/M
3300032897|Ga0335071_10174813All Organisms → cellular organisms → Bacteria2100Open in IMG/M
3300032897|Ga0335071_10450771Not Available1239Open in IMG/M
3300032898|Ga0335072_10341189Not Available1647Open in IMG/M
3300032898|Ga0335072_10812316All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300032955|Ga0335076_10308603All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium ADurb.Bin1471470Open in IMG/M
3300033134|Ga0335073_11477512All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300033158|Ga0335077_10834753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis935Open in IMG/M
3300033158|Ga0335077_11306565All Organisms → cellular organisms → Bacteria → Acidobacteria704Open in IMG/M
3300034199|Ga0370514_190825All Organisms → cellular organisms → Bacteria533Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.36%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.06%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.06%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.90%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.90%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.03%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.03%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.60%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.60%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.16%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.16%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.73%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.73%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.73%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.73%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.73%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.30%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.30%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.87%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.87%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.87%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.87%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.43%
SedimentEnvironmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment0.43%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.43%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.43%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.43%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.43%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.43%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.43%
Drinking Water PipesEngineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes0.43%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.43%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001546Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1EnvironmentalOpen in IMG/M
3300002912Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cmEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005892Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305EnvironmentalOpen in IMG/M
3300005895Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101EnvironmentalOpen in IMG/M
3300005902Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006872Biofilm microbial communities from drinking water pipes in SingaporeEngineeredOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010387Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 k-mer 51EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022733Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3EnvironmentalOpen in IMG/M
3300023019Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025475Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026025Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026928Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes)EnvironmentalOpen in IMG/M
3300027045Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes)EnvironmentalOpen in IMG/M
3300027073Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029919Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029995Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030042Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12659J15293_1005616023300001546Forest SoilLLAEGETTHIVTDSSMKVAALPEKYLTAFRAAITK*
JGI25386J43895_1014089823300002912Grasslands SoilLVRADDGELLAEGETTHIVTDEDMTTKPLPEKYLSVFRGAAARNTSI*
JGIcombinedJ51221_1030810123300003505Forest SoilPNTGAVLAEGETTHIVTNSEMKVSALPDKYLSVFRAATGNNR*
JGIcombinedJ51221_1039431213300003505Forest SoilFGYELRHADTGRLLAEGETTHIVAGSKMEPRALPAKYLKVFRAALGR*
Ga0062387_10035392323300004091Bog Forest SoilLRANDGTLLAEGETTHLVTDSQMKIAPIPEKYLKVFREAMGK*
Ga0062389_10154917023300004092Bog Forest SoilRRAEDGTVLAEGETTHIVTDADMKIAALPEKYLKAFRSALGRQDGKLS*
Ga0066395_1083453613300004633Tropical Forest SoilIVFNYELARAETGALLAEGETTHVVTNTKMKAAALPDKYLNLFREAVDKRTSIRERS*
Ga0062388_10277278113300004635Bog Forest SoilKAETDELLAEGETTHIVADSRMNPRALPEKYMKVFRAAIG*
Ga0066688_1056060813300005178SoilVRVSDGVLLAEGETTHIVTDAELKTRTMPEKHMALFREASGKTG*
Ga0066388_10661179523300005332Tropical Forest SoilYELVRLEDGTLLAEGETTHIVTDAQMKMTAIPDKYLRVFRAAAGK*
Ga0070708_10130227023300005445Corn, Switchgrass And Miscanthus RhizosphereADDGELLAEGETTHIVTDEDMTAKPLPEKYLSVFRGAAARNTSI*
Ga0070735_1013580313300005534Surface SoilELLRADHGTLLAEGETTHIVTDSNMKIAALPEKYLQVFRAAVGK*
Ga0070731_1078106223300005538Surface SoilSYELVRASTSDLMAEGETTHIVTNSKMKVSALPDKYLSAFREAVGR*
Ga0066692_1073217623300005555SoilELVRVSDGVLLAEGETTHIVTDAELKTRTMPEKHMALFREASGKTG*
Ga0066707_1009074033300005556SoilGDGTLLAEGETTHIVTDAAMKMTPLPEKYTKAFRAAVGR*
Ga0066707_1082929513300005556SoilLLAEGETTHLVTDAEMKVRAIPEKYMRAFQEAVGKSS*
Ga0068855_10259732023300005563Corn RhizosphereLLAEGETTHIVTDAEMKITTIPEKYLTIFRGAISR*
Ga0066694_1022069723300005574SoilTLLAEGETTHIVTDPQMKIAVLPDKYLNAFRAALRE*
Ga0066691_1039272513300005586SoilGTLLAEGETTHIVTDAQMKIAVLPDKYLNAFRAALQK*
Ga0070761_1015460013300005591SoilDGALLAEGETTHIVTDGNMKIAALPEKYLTVFRAAVGKQNGKPS*
Ga0070764_1050279613300005712SoilRAEGGELLAEGETAHVVTDSEMRVAPLPEKYLKAFRKALGRSHL*
Ga0075275_110335223300005892Rice Paddy SoilLLAEGDTMHIVTDAGMNKRALPEKYRTAFDAAVERGC*
Ga0075277_109176813300005895Rice Paddy SoilAMRADDGALLADGETTHIVTDAQMKKRDLPPKYAARFRAAVVAATD*
Ga0075273_1009492223300005902Rice Paddy SoilLLAEGETTHIVVGEDMQRKPLPEKYLVPFREAVGR*
Ga0070766_1061130923300005921SoilELARPNTGAVLAEGETTHIVTNSEMKVSALPDKYLSVFRAATGNKR*
Ga0066789_1023969423300005994SoilNSKMLLAEGETTHIVTDSKMKVAALPEKYLTAFRAAMAQ*
Ga0066790_1007463523300005995SoilVLAEGETTHIVTDAEMKVTAIPEKYLKVFREATGRL*
Ga0066790_1052883313300005995SoilAEGETTHIVADAKMTPRALPEKYLKAFRAAVGNRSA*
Ga0070717_1141141813300006028Corn, Switchgrass And Miscanthus RhizosphereRADTGALLAEGETTHIVTDSQMKVATLPEKYLGVFRAAVKK*
Ga0066651_1057842623300006031SoilLRRVEDGALLAEGETTHIVTNADMKVTAIPDTYMKAFRAAVGKQDGKLI*
Ga0075029_10008172613300006052WatershedsELLAEGETTHIVADAQMKPRALPEKYLKVFREAVSGH*
Ga0070716_10081577413300006173Corn, Switchgrass And Miscanthus RhizosphereSDGTLLAEGETTHIVTDAEMKITTIPEKYLTIFRGAISR*
Ga0075014_10045766013300006174WatershedsFSYELLRTEGGALLAEGETTHIVTDLKMKVAALPEKYLEVFRAAVGK*
Ga0075014_10092294523300006174WatershedsALLAEGETMHIVANSKMKPRALPGKYMKIFRNAVGTVA*
Ga0068871_10107117123300006358Miscanthus RhizosphereGYELLRAGDGTLLAEGETTHIVIDKQMKIAAIAGKYLDVFRKAAGR*
Ga0066659_1121543623300006797SoilAVLAEGETIHIVTDSEMKKRELPEKYQAMFRSAVGKANK*
Ga0066660_1163924623300006800SoilEVLLAEGETTHVVTDASMKKRAIPEKYAKAFREAMHKS*
Ga0101947_103453113300006872Drinking Water PipesLLAEGETTHIVADSRMKPRALPEKYMKVFREAIRKPNI*
Ga0075426_1102858013300006903Populus RhizosphereLLAEGETTHIVTDSAMKIAALPEKYLSAFRAAVGR*
Ga0099830_1054891923300009088Vadose Zone SoilLLAEGETTHIVTDSNMKVAALPAKYLKVFREAVGKSSQ*
Ga0099830_1155302113300009088Vadose Zone SoilAEGETTHIVADSKMEPRVLPEKYMSVFRAAVGNRSA*
Ga0116221_131231613300009523Peatlands SoilEGETTHIVTDADMKIAVLPEKYLKVFRAAVGKLEPNH*
Ga0116106_104171633300009645PeatlandELLAEGETTHIVANSRMKPRALPGKYMNVFRAAIGR*
Ga0116224_1001705013300009683Peatlands SoilTLLAEGETTHIVTDADMKAAVLPEKYLKVFRAVVGKL*
Ga0116101_111636113300009759PeatlandIRFGYELRLEETGELLAEGETTHIVADSRMKPRALPKKYMTVFRTALGKRGGV*
Ga0116134_113912713300009764PeatlandLLAEGETTHIVANAKMKPRALPQKYMRVFRAAVAK*
Ga0116219_1030248813300009824Peatlands SoilETTHIVTNADMKITALPEKYLNVFRAAVGKRNGKLS*
Ga0116223_1003814253300009839Peatlands SoilAETGELLAEGETTHIVADSSMRPRALPEKYMKVFRAAVGR*
Ga0116223_1055273413300009839Peatlands SoilTLLAEGESTHLVTDSKMKLAALPEKYLTAFRASMGK*
Ga0134067_1005384513300010321Grasslands SoilGALLAEGETTHIGTDGKMKVAPLPDKYLTVFRAAVKK*
Ga0126376_1184669223300010359Tropical Forest SoilDTGALLAEGETTHVVTNSDMKVASLPKKYLSVFRCAAGK*
Ga0126372_1027947113300010360Tropical Forest SoilTGALLAEGETTHVVTNTKMKAAALPDKYLNLFREAVDKRTSIRERS*
Ga0126378_1325972813300010361Tropical Forest SoilNYELARADSGTLLAEGETTHIVTDSKMKVAALPDKYLTVFRAAVGK*
Ga0126381_10383755723300010376Tropical Forest SoilVVLAEGETVHIVTDSSMKVSSLPRKYLKVFQGAAGR*
Ga0136821_119293833300010387SedimentYELLRAGDGTLLAEGETTHIVTDREMKIVAIPEKYVAIFRAAAGR*
Ga0126361_1103675313300010876Boreal Forest SoilGYELRRAEDGALLAEGETTHIVTDASMKVAALPDKYMKALREAVGKTSI*
Ga0137391_1077530513300011270Vadose Zone SoilDLLAEGETTHIVANSKMKPRALPEKYLRAFRAAVGNRSA*
Ga0137389_1015983723300012096Vadose Zone SoilLLAEGETTHIVTDEDMTTKPLPEKYLSVFRGAAARNTSI*
Ga0137388_1151175423300012189Vadose Zone SoilEGETTHIVTDERMKIPTIPDRYMKVFREAVGKLPSAR*
Ga0137382_1019563723300012200Vadose Zone SoilAEGETTHIVADSKMMPRALPEKYMKVFRAAVGGP*
Ga0137382_1064243213300012200Vadose Zone SoilSYELERANTGTVLAEGETTHIVTNSEMKVSVLPDKYLSVFRAATGK*
Ga0137363_1182393223300012202Vadose Zone SoilGELLAEGETTHIVTDEDMTTKPLPEKYLSVFRGAAARNTSI*
Ga0137399_1131199513300012203Vadose Zone SoilLLAEGETTHIVADSQMKPRALPEKYMNVFRAAMTKQ*
Ga0137362_1144675923300012205Vadose Zone SoilVLAEGETTHIVTDAAMKVRTIPEKYLKVFREAAGRTS*
Ga0137362_1150399323300012205Vadose Zone SoilDLLAEGETTHIVADSKMMPRALPEKYMQVFRAAVGSP*
Ga0137381_1021809023300012207Vadose Zone SoilAEGETTHIVTDEDMTAKPLPEKYLSVFRGAAARNTSI*
Ga0137379_1017546113300012209Vadose Zone SoilLLAEGETTHIVADKQMKPRALPEKYMNVFRAAAAKQ*
Ga0137379_1166912823300012209Vadose Zone SoilLLAEGETTHIVTDSKMIVSALPEKYLTAFREAMAK*
Ga0137378_1017624833300012210Vadose Zone SoilDSEALLAEGETTHIVNDSSMQVAALPEKYLTAFRAAAGK*
Ga0137360_1118242923300012361Vadose Zone SoilADSGELLAEGETTHIVADSQMKPRALPEKYMKAFSEAVGK*
Ga0137358_1091961813300012582Vadose Zone SoilTGDLLAEGETTHIVADSKMMPRALPEKYMKVFRAAVGSP*
Ga0137398_1015161813300012683Vadose Zone SoilGVVLAQGETTHIVTDAAMKVRAIPEKYMRLFREAAGRTS*
Ga0137359_1116162913300012923Vadose Zone SoilRSVESGDLLAEGETTHIVADSKMMPRALPEKYMKVFRAAVGSP*
Ga0137413_1118625813300012924Vadose Zone SoilLLAEGETTHIVTDADMKIAVLPEKYLTVFRAAVGKQDGKHS*
Ga0137419_1089952013300012925Vadose Zone SoilRLSDGALMAEGETTHIVTDAQIKTAVLPDKYLNAFRAALRK*
Ga0126369_1323177913300012971Tropical Forest SoilLAEGETTHIVADAKMQKTTLPEKYLTVFREAVGR*
Ga0164307_1125535313300012987SoilRAHDGALLAEGETTHIVTDAKMKVAPLPDKYLSVFRAAVKK*
Ga0181527_104581233300014153BogRRVGTDELLAEGETTHIVADSTMKPRALAAKYMKVFRAAVAAPEGA*
Ga0181521_1037041213300014158BogTGELLAEGETTHIVADSSMRPRALPEKYMKVFRAAMGR*
Ga0181530_1056201013300014159BogTGELLAEGETTHIVADSSMRPRALPEKYMKVFRAAMGDRKVGR*
Ga0181534_1024570013300014168BogAETGALLAEGETTHVVTDSNMKVSTLPEKYLRVFRAAIGK*
Ga0181531_1108790823300014169BogVLLAEGETTHIVTDAAMKIAELPEKYLKVFREAVGKSKPNR*
Ga0182017_1054091323300014494FenRFGYELRRAETGERLAEGETTHIVANAKMKTRPLPEKYLNVFRAAVGSP*
Ga0181536_1037120533300014638BogGELLAEGETTHIVADAQMKTRILPEKYLRVFRAAIGR*
Ga0137418_1007753943300015241Vadose Zone SoilIEDGSLLAEGETTHIVADAQMRKTVLPEKYRKAFQDATGR*
Ga0137418_1111457923300015241Vadose Zone SoilVRLSDGALMAEGETTHIVTDAQRKTAVLPDKYLNAFRAALRK*
Ga0134072_1003929323300015357Grasslands SoilLLLAEGETTHIVTDAQMKTRTIPEKYVGAFREAANKSV*
Ga0182039_1131175423300016422SoilLLAEGETTHIVTNREMKIRALPEKYLSAFRAAMGK
Ga0187818_1008904823300017823Freshwater SedimentELLAEGETTHIVANAKMKPRALPGKYMKVFRTAVGKPTIEN
Ga0187818_1026039113300017823Freshwater SedimentTLLAEGETTHVVTDAKMKVTTLPEKYLRVFRAAAGK
Ga0187801_1048528623300017933Freshwater SedimentGVLLAEGETMHVVANAQMKATPLPEKYLNALRQALRR
Ga0187785_1048580423300017947Tropical PeatlandLAEGETTHIVADAQMKPRALPEKYMKVFRDATRKVDG
Ga0187778_1077579013300017961Tropical PeatlandLLADGETTHIVTDSNMKIATLPAKYLTAFTAAMGR
Ga0187777_1095243113300017974Tropical PeatlandEGETTHIVSDAQMKPRALPPKYLSVFRAAAGNSDGG
Ga0187782_1138012123300017975Tropical PeatlandGYELRRAETGELVAQGETTHIVADAQMKPRALPEKYLKVFRAAAGKKAES
Ga0187868_101769313300018002PeatlandKVIRFGYELRSAETGELLAEGETTHIVANSRMKPRALPGKYMNVFRAAIGR
Ga0187805_1040161833300018007Freshwater SedimentAETGELLAEGETTHIVANSRMKPRALPGKYMKVFRAAIGR
Ga0187860_130116813300018014PeatlandIRFGYELRSAETGELLAEGETTHIVANSRMKPRALPGKYMNVFRAAIGR
Ga0187886_128979623300018018PeatlandETGELLAEGETTHIVANARMKTRALPEKYLRVFRAAIGR
Ga0187881_1030526613300018024PeatlandAEGETTHIVTDAAMKIAVLPEKYLKVFRAAVGKQDGKVS
Ga0187875_1034542013300018035PeatlandLAEGETTHIVANAQMKTRTLPEKYMRVFRAAVGKKNVEASS
Ga0187887_1006754733300018043PeatlandLAEGETTHIVANAQMKPRKLPEKYMKVFRTAAGARAPQPIL
Ga0187887_1062106713300018043PeatlandIFSYELNRVETGALLAEGETTHVVTDSNMKVSTLPGKYLSVFRAAVGK
Ga0187859_1013822613300018047PeatlandLLAEGETTHVVTDSKMKVAPLPEKYLKAFRKALGKHSM
Ga0187766_1033234013300018058Tropical PeatlandLLAEGETTHIVADTHMKPRRLPEKYMKVFREAVGN
Ga0187771_1016185243300018088Tropical PeatlandYELLQADSRRLLAEGETTHIVTDLNMKVATLPEKYLQAFRSAM
Ga0187770_1063615523300018090Tropical PeatlandYELLQADNGTLLAEGETTHIVTDLNMQVAGLPDKYLKAFRAAMGK
Ga0066669_1035396413300018482Grasslands SoilMLLAEGETTHIVTDSQMKVRDIPEKYMKVFQEAVKHRL
Ga0187852_130517613300019082PeatlandREKVIRFGYELRSAETGELLAEGETTHIVANSRMKPRALPGKYMNVFRAAIGR
Ga0182022_101497423300019785FenGYELQRAETGELLAEGETTHIVADAQMKTRILPEKYLRVFRAAVGSP
Ga0193747_108332013300019885SoilVLLAEGETTHIVTDAEMKTRPIPEKYVKAFRDAAGRTF
Ga0210407_1013475933300020579SoilTTHIVTDADMKIAALPDKYLKAFRSAVGKQDGKLS
Ga0210407_1078040923300020579SoilGYELRRAEDGALLAEGETTHIVTDADMKIAPLPEKYLKVFRAAIGKRNGNSS
Ga0210399_1002877473300020581SoilYELARANTGTVLAEGETTHIVTNSEMKVSALPDKYLSVFRAATGK
Ga0210395_1012318413300020582SoilYTLRRVDNDTLLAEGETTHIVTDADMKIAVLPDKYLKAFRAAVGKQDGKLA
Ga0210395_1079498523300020582SoilESVIKFSYELARPNTGAVLAEGETTHIVTNSEMKVSALPDKYLSVFRAATGNNR
Ga0210401_1010207133300020583SoilAEDGALLAEGETTHIVTDADMKIAPLPEKYLKVFRAAIGKRNGNSS
Ga0210400_1082663713300021170SoilDVLLAEGETTHIVTDAEMKIAVLPEKYLTAFRAAVGKQNGKPS
Ga0210405_1036846323300021171SoilLAEGETTHIVTDAEMKIAELPEKYLKAFRAALGKQNGKRS
Ga0210396_1172525223300021180SoilGETTHIVTDAEMKIAVLPEKYLTAFRAAVGKQNGKPS
Ga0210393_1128872513300021401SoilLRRATDGALLAEGETTHIVTDSEMKVAALPEKYLTVFRAAVGKRNRKST
Ga0210387_1034549913300021405SoilLLAEGETTHIVADAQMRKTALPEKYLQAFREAAGK
Ga0210383_1120485313300021407SoilRADDRTLLAEGETTHIVTDADMKIAMLPEKYLKVFRAAVGKL
Ga0210383_1128321913300021407SoilRNVATGALLAEGETTHIAANAKMKPRALPEKYMHVFRAAVKEE
Ga0210384_1028912723300021432SoilDGALLAEGETTHIVTDAQMRIAVLPDKYLNAFRAALRK
Ga0210402_1035122323300021478SoilELARAEGGALLAEGETTHVVTDATMKAAALPEKYLKAFRKAMGKHPT
Ga0210409_1077352413300021559SoilLAEGETTHIVADSRMRPRVLPEKYMKVFRAAVGSP
Ga0242660_121678913300022531SoilNALVAEGETTHIVTDSQMKVAALPEKYLTAFRAATGK
Ga0212123_1018319023300022557Iron-Sulfur Acid SpringDALLAEGETTHIVTDKDMNISALPEQYLTVFRAAVAKQDGKLS
Ga0224562_101029823300022733SoilELVRAEGGELLAEGETAHVVTDSEMRVAPLPEKYFKAFRKALGRSHL
Ga0224560_10741023300023019SoilTTHIVTDEQMKIAVLPEKYLKIFRAAVGKRNGNPS
Ga0224557_115082033300023101SoilEKREVLAEGETIHIVADSQMKPRKLPEKYMKVFRAAVGS
Ga0224556_100235853300024295SoilLMSAEGRQLLAEGETTHIVANAQMKPRRLPEKYMKVFRAAVSN
Ga0208935_104865713300025414PeatlandVEGDVLLAEGETTHIVTDAAMKIAELPEKYFRVFRAAVGKQDAKP
Ga0208478_102487713300025475Arctic Peat SoilAETAELLAEGETTHIIADAKMKPRALPEKYMTVFRAAVGNRSA
Ga0208688_103415113300025480PeatlandLRSAGTGKLLAEGETTHIVANSTMKPRALPEKYMQVFRAALGR
Ga0208714_111217323300025527Arctic Peat SoilTGKLLAEGETTHIVADAKMTPRALPEKYLKAFRAAVGNRSA
Ga0208691_103239113300025612PeatlandGALLAEGETTHIVTDAELKVAALPEKYLKVFRAAVGKRDRNNS
Ga0207644_1041537523300025931Switchgrass RhizosphereSDGTLLAEGETTHIVTDAEMKITTIPEKYLTIFRGAISR
Ga0207665_1116805623300025939Corn, Switchgrass And Miscanthus RhizosphereARANTGTVLAEGETTHIVTNSEMKVSALPDKYLSVFRAATGK
Ga0208778_101385323300026025Rice Paddy SoilTGALLAEGETTHIVTDSKMKVAALPDKYLDVFRAAVKK
Ga0209863_1012856113300026281Prmafrost SoilSDGVLLAEGETTHIVTDAEMKVRAIPEKFMKVFREAAGKV
Ga0209839_1006402923300026294SoilVLAEGETTHIVTDAEMKVTAIPEKYLKVFREATGRL
Ga0209471_123986323300026318SoilLVREEGGALLAEGETTHIVTDSKFKIAALPEKYLKVFREAVGK
Ga0209687_112634923300026322SoilLLAEGETTHIVTNAKMEIAALPDKYMKVFLSAIGRDVI
Ga0209152_1048903133300026325SoilRADSGALLAEGETTHIVTDSNMKVAALPEKYLKVFRDAVGKRSP
Ga0209804_107515213300026335SoilESVIRFSYELERANTGTVLAEGETTHIVTNSEMKVSVLPDKYLSVFRAATGK
Ga0209805_126768913300026542SoilGDGLLLADGETTHIVTNAKMEIAALPDKYMKVFLSAIGRDVI
Ga0209648_1021512823300026551Grasslands SoilLRRAETGELLAEGETTHIVANSKMKPRALPEKYLSAFRAAVGRP
Ga0207779_103399113300026928Tropical Forest SoilRAENGALLAEGETTHIVTDRSMKVAALPEKYLQAFRSAAGK
Ga0207726_101479223300027045Tropical Forest SoilELVRAENGALLAEGETTHIVTDRSMKVAALPEKYLQAFRSAAGK
Ga0208366_102204923300027073Forest SoilLARAEDGQLLAEGETTHIVTDEQMKMVPLPGKYLNVFRAAVGR
Ga0208199_108460333300027497Peatlands SoilAETGELLAEGETTHIVADSSMRPRALPEKYMKVFRAAVGR
Ga0209038_1006473823300027737Bog Forest SoilETTHIVTDADMKIAVLPEKYLKVFRAAVGKLQPDH
Ga0209908_1012252123300027745Thawing PermafrostTTHIVTDRDMKIAVLPERYLKAFRAAIGKRDGKNS
Ga0209039_1013785213300027825Bog Forest SoilLAEGETTHIVADAQMKPRALPEKYMKVFRAAAGTKTP
Ga0209039_1028559423300027825Bog Forest SoilRAENGELLAEGETTHIVANAQMKPRALPEKYLKVFRAAVGGP
Ga0209180_1005663133300027846Vadose Zone SoilGYELRRAETGDLLAEGETTHIVANSKMKPRALPEKYLKAFRAAAGNRSA
Ga0209274_1016151523300027853SoilEGETTHIVTDANMKIAALPEKYMKAFRAALGKQDGKLS
Ga0209274_1032900923300027853SoilESGALLAEGETTHIVADSTMKPRALPAKYMRVFRAAVSRP
Ga0209274_1043079923300027853SoilEGETTHIVTGPDMKVTALPAKYLKVFRAAIGKRNGNSS
Ga0209517_1011417323300027854Peatlands SoilVRESVVIFSYELVRADDRTLVAEGSTTHVVTDSTMKVAALPEKYLTAFRTAMGK
Ga0209693_1038548223300027855SoilAQDGSLLAEGETTHIVTDAAMKIAALPEKYLKVFRSALGKQDGKLS
Ga0209048_1011873723300027902Freshwater Lake SedimentAVTGELLAEGETTHIVANSKMKPRALPEKYMKVFRAAVGEKK
Ga0209415_1087637823300027905Peatlands SoilEDSTLLAEGETTHIVTDAEMKIASLPEKYLKAFRAALGKQDGKLS
Ga0302219_1033562913300028747PalsaALLAEGETTHIVTDRDMKIAALPKKYLKAFRAAIGKGDGKNS
Ga0307504_1035733913300028792SoilLAEGETTHIVADKQMKARALPEKYMKVFRAAVAKP
Ga0302222_1013911713300028798PalsaLAEGETTHIVTDRDMKIAVLPERYLKTFRAAIGKRDGKNS
Ga0311329_1008958833300029907BogGTLLAEGETTHIVTDAEMKIAVLPEKYLKVFRSVAGKEDGKLS
Ga0311362_1118911523300029913BogELLAEGETTHIVADAQMKPRALPEKYLRVFRAAVGSP
Ga0311326_1052841323300029917BogVIHFGYELRAEKTGELLAEGETTHIVATSKIKPRTLPPKYMQAFRSALHNLGTRD
Ga0302141_119772513300029919BogEKTGELLAEGETTHIVATSKIKPRTLPPKYMQAFRSALHNLGTRD
Ga0311363_1004585193300029922FenRAEDGTLLAEGETTHIVTDAGMKIAVLPEKYLKVFRAAVGKQDGKIS
Ga0311347_1087540113300029923FenLLAEGETTHIVADSQMKPRSLPEKYMKAFRAAVAKSE
Ga0311352_1016089833300029944PalsaYELLAEGETIHIVADSKMKPRALPEKYRKIFRAAVGR
Ga0311330_1035658813300029945BogDGTLLAEGETTHIVTDAAMKIAVLPEKYLKVFRAAVGKQDGKVS
Ga0311371_1156860823300029951PalsaNAQTGELLAEGETTHIVADANMTPRALPAKYLKVFRAAVGGP
Ga0311346_1014633133300029952BogVRPKIIHFGYELRADKTGELLAEGETTHIVASSKMKPRVLPHKYMQAFRSALDKLTARD
Ga0311331_1059624923300029954BogVVHFSYELRRVGDGALLAEGETTHIVTDAELKVAALPEKYLKVFRAAVGKRDRNNS
Ga0302304_1008341323300029993PalsaVVHFGYELRRAQDGAVLAEGETIHIVTGADMKTAVLPEKYLKVFRAAVGKPGGKVS
Ga0302210_1004500113300029995FenDRKLLAEGETTHIVASSQMKPRKLPEKYMMVFRAATGQPSDEH
Ga0311339_1047456013300029999PalsaAEDGKLLAEGETTHIVTGRDLKIAVFPEKYLKAFRAAVGKQDRKLS
Ga0311339_1075933133300029999PalsaAETYELLAEGETIHIVADSKMKPRALPEKYRKIFRAAVGR
Ga0311338_1095026723300030007PalsaLVRANDAALLAEGETTHIVTDAQMKVAALPDRYVKAFREALAE
Ga0302274_1044752013300030041BogYELRRAEDGTLLAEGETTHIVTDAGMKIAVLPEKYLKVFRAAVGKQDGKIS
Ga0302300_103896823300030042PalsaGETTHIVTDGAMKIAELPEKYLSVFRAAVGKQGRKP
Ga0302306_1002333333300030043PalsaHFGYELRRAQDGAVLAEGETIHIVTGADMKTAVLPEKYLKVFRAAVGKPGGKVS
Ga0302176_1044103323300030057PalsaEGETTHIVTDSDMKVAALPQKYLQAFRAAVGKRNRKST
Ga0311353_1037163213300030399PalsaGELLAEGETAHVVTDSKMKVAPLPERYLKAFRKALGKHST
Ga0310037_1027993933300030494Peatlands SoilTGELLAEGETTHIVADSSMRPRALPEKYMKVFRAAVGR
Ga0302183_1030413433300030509PalsaLLAEGETIHIVADSKMKPRALPEKYRKIFRAAVGR
Ga0302193_1063462623300030519BogGTLLAEGETTHIVTDAGMKIAVLPEKYLKVFRAAVGKQDGKIS
Ga0311357_1048156713300030524PalsaGYELRRAQDGAVLAEGETIHIVTGADMKTAVLPEKYLKVFRAAVGKPGGKVS
Ga0316363_1005251813300030659Peatlands SoilTLLAEGETTHIVTDLNMKVAALPEKYLKAFRNAMGK
Ga0316363_1025396923300030659Peatlands SoilTLLAEGESTHLVTDSKMKLAALPEKYLTAFRASMGK
Ga0302310_1012336013300030737PalsaLAEGETIHIVTGADMKTAVLPEKYLKVFRAAVGKPGGKVS
Ga0311366_1173241323300030943FenSAETAELLAEGETTHIIADAKMKPRALPEKYMTVFRAAVGNRSA
Ga0170834_10564871713300031057Forest SoilDGVLLAEGETTHLVTDANMNKTPIPEKYASAFREAMQRS
Ga0170822_1189117423300031122Forest SoilGVLLAEGETTHLVTDANMNKRPIPEKYASAFREAMQTS
Ga0170824_12229410223300031231Forest SoilLLAEGETTHIVTDSNMKVAALPEKYLIAFREAIAK
Ga0170820_1753988113300031446Forest SoilLVRAGDGKLLAEGETTHVVTNSEMKVSPLPEKYLQAFRAALGK
Ga0311364_1039914923300031521FenGTGELLAEGETTHIVADSQMKPRSLPEKYMKAFRAAVAKSE
Ga0310686_11932061023300031708SoilRRAEDGTVLAEGETTHIVTDSDMKIAALPERYLTVFRAAVGKPDRKHS
Ga0307474_1065725623300031718Hardwood Forest SoilLVRADSRALVAEGETTHIVTDSKMKVAALPEKYLTAFRAAMAK
Ga0307474_1141966313300031718Hardwood Forest SoilVAEGETTHIVTDSKMKVAALPEKYLTAFRAATGKQ
Ga0307469_1088228413300031720Hardwood Forest SoilETGELLAEGETTHIVADSKMKPRALPEKYIKVFRAAVGSP
Ga0307475_1059095313300031754Hardwood Forest SoilVADRVLLAEGETTHIVTDADMKIAVLPEKYLSVFRSAVGKQNGKHS
Ga0307478_1064347913300031823Hardwood Forest SoilTGTVLAEGETTHIVTNSDMKVSALPDKYLSVFRAATGK
Ga0306926_1073362913300031954SoilALLAEGETTHIVADAEMRKAALPERYMKVFREAAAR
Ga0306926_1112949423300031954SoilELARADTGVLLAEGETTHVVTNSKMKIASLPKKYLAVFRVAAGK
Ga0307479_1062552313300031962Hardwood Forest SoilETTHIVTDADMKIAPLPEKYLKVFRAAVGKRNGKLS
Ga0308176_1041606813300031996SoilELLAEGETTHIVTNSKMKTKALPEKYLNAFRMCVGA
Ga0307470_1026061323300032174Hardwood Forest SoilFSYELARANTGTLLAEGETTHIVTNSEMKVSTLPPKYLNVFRAAAGK
Ga0307470_1189152123300032174Hardwood Forest SoilLRRVADGVLLAEGETTHIVTDADMKIAVLPEKYLSVFRSAVGKQNGKHS
Ga0307471_10050279023300032180Hardwood Forest SoilELLAEGETTHIVTDEEMRAKPLPEKYLNVFRGAAARNTSV
Ga0307471_10144844923300032180Hardwood Forest SoilRFGYELRSAETGELLAEGETTHIVADSKMKPRALPEKYIKVFRAAVGSP
Ga0335078_1039172813300032805SoilGAESLLAEGETTHIVTDAQMRPRPLPEKYLKVFRAAMEKERA
Ga0335080_1020047913300032828SoilSEGGALLAEGETTHIVTNTEMKVAALPEKYLRAFRAAVGK
Ga0335080_1120820223300032828SoilASDRTLLAEGETTHIVTDSTFSRRTLPEKYLSVFRVAVGS
Ga0335081_1086931823300032892SoilTRAGNGTLLAEGETTHIVTDANMKIAALPEKYLTAFRVAMGK
Ga0335081_1233202323300032892SoilDGTVLAEGETAHLVTDAQMKVRTLPEKYLRALAEAAGGA
Ga0335069_1046117223300032893SoilRAQTGELLAEGETMHIVANAEMKPRALPAKYLKVFRAAVAKPD
Ga0335071_1017481323300032897SoilLLAEGETTHIVVGEDMQKKALPEKYLGPFKAAVGR
Ga0335071_1045077123300032897SoilFGYELSRAEDGKLLAEGHTTHIVTDSNMKVSTLPEKYLKAFRSAVGK
Ga0335072_1034118923300032898SoilALLAEGETTHIVTDSNMKVAALPEKYLAAFRAATRKQSPATGVS
Ga0335072_1081231613300032898SoilRADGKLLAEGETTHIVTDANMKVSFLPDKYLTAFRAAIRK
Ga0335076_1030860323300032955SoilTGALLAEGETTHIVTDSNMKIAALPPKYLTAFRTAKGK
Ga0335073_1147751213300033134SoilYELLAADSRQVLAEGETTHIVANSRMKPRRLPEKYLKVFQSAVGA
Ga0335077_1083475323300033158SoilTVVVFGYELLEAQSGKLLAEGETTHVVTDLNMKVAALPEKYLSAFRAAMGKQ
Ga0335077_1130656513300033158SoilDADGALLAEGETAHLVTDAQMKVRTLPEKYVRALAEAAGGA
Ga0370514_190825_1_1233300034199Untreated Peat SoilAETGALLAEGETTHVVTDSDMKVSTLPEKYLRVFRAAIGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.