| Basic Information | |
|---|---|
| Family ID | F019199 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 231 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LLAEGETTHIVTDSAMKIAALPEKYLSAFRAAVGR |
| Number of Associated Samples | 202 |
| Number of Associated Scaffolds | 231 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.45 % |
| % of genes near scaffold ends (potentially truncated) | 95.24 % |
| % of genes from short scaffolds (< 2000 bps) | 88.74 % |
| Associated GOLD sequencing projects | 193 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.476 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.390 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.048 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.784 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.05% β-sheet: 0.00% Coil/Unstructured: 80.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 231 Family Scaffolds |
|---|---|---|
| PF00221 | Lyase_aromatic | 83.55 |
| PF03795 | YCII | 7.79 |
| PF01894 | UPF0047 | 0.87 |
| PF01796 | OB_aCoA_assoc | 0.43 |
| PF01381 | HTH_3 | 0.43 |
| PF14559 | TPR_19 | 0.43 |
| PF13649 | Methyltransf_25 | 0.43 |
| PF00378 | ECH_1 | 0.43 |
| PF00691 | OmpA | 0.43 |
| PF12762 | DDE_Tnp_IS1595 | 0.43 |
| PF01039 | Carboxyl_trans | 0.43 |
| PF00381 | PTS-HPr | 0.43 |
| PF01209 | Ubie_methyltran | 0.43 |
| PF13476 | AAA_23 | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 231 Family Scaffolds |
|---|---|---|---|
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 83.55 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 7.79 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.87 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.43 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.43 |
| COG1545 | Uncharacterized OB-fold protein, contains Zn-ribbon domain | General function prediction only [R] | 0.43 |
| COG1925 | HPr or related phosphotransfer protein | Signal transduction mechanisms [T] | 0.43 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.43 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.43 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.48 % |
| Unclassified | root | N/A | 9.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001546|JGI12659J15293_10056160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 890 | Open in IMG/M |
| 3300002912|JGI25386J43895_10140898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 599 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10308101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 644 | Open in IMG/M |
| 3300004091|Ga0062387_100353923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 970 | Open in IMG/M |
| 3300004092|Ga0062389_101549170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 846 | Open in IMG/M |
| 3300004633|Ga0066395_10834536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 555 | Open in IMG/M |
| 3300004635|Ga0062388_102772781 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005178|Ga0066688_10560608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 734 | Open in IMG/M |
| 3300005332|Ga0066388_106611795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 584 | Open in IMG/M |
| 3300005445|Ga0070708_101302270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 679 | Open in IMG/M |
| 3300005534|Ga0070735_10135803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1530 | Open in IMG/M |
| 3300005538|Ga0070731_10781062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 634 | Open in IMG/M |
| 3300005555|Ga0066692_10732176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 611 | Open in IMG/M |
| 3300005556|Ga0066707_10090740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1861 | Open in IMG/M |
| 3300005563|Ga0068855_102597320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 502 | Open in IMG/M |
| 3300005574|Ga0066694_10220697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 899 | Open in IMG/M |
| 3300005586|Ga0066691_10392725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 824 | Open in IMG/M |
| 3300005591|Ga0070761_10154600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1345 | Open in IMG/M |
| 3300005712|Ga0070764_10502796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 729 | Open in IMG/M |
| 3300005892|Ga0075275_1103352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 502 | Open in IMG/M |
| 3300005895|Ga0075277_1091768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 510 | Open in IMG/M |
| 3300005902|Ga0075273_10094922 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005921|Ga0070766_10611309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 733 | Open in IMG/M |
| 3300005994|Ga0066789_10239694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 761 | Open in IMG/M |
| 3300005995|Ga0066790_10074635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1460 | Open in IMG/M |
| 3300005995|Ga0066790_10528833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 504 | Open in IMG/M |
| 3300006028|Ga0070717_11411418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 632 | Open in IMG/M |
| 3300006031|Ga0066651_10578426 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006052|Ga0075029_100081726 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300006173|Ga0070716_100815774 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006174|Ga0075014_100457660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 707 | Open in IMG/M |
| 3300006174|Ga0075014_100922945 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300006358|Ga0068871_101071171 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300006797|Ga0066659_11215436 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300006800|Ga0066660_11639246 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006872|Ga0101947_1034531 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300006903|Ga0075426_11028580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 623 | Open in IMG/M |
| 3300009088|Ga0099830_10548919 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300009088|Ga0099830_11553021 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300009523|Ga0116221_1312316 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300009645|Ga0116106_1041716 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300009683|Ga0116224_10017050 | All Organisms → cellular organisms → Bacteria | 3592 | Open in IMG/M |
| 3300009764|Ga0116134_1139127 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300009824|Ga0116219_10302488 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300009839|Ga0116223_10038142 | All Organisms → cellular organisms → Bacteria | 3214 | Open in IMG/M |
| 3300009839|Ga0116223_10552734 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010321|Ga0134067_10053845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1302 | Open in IMG/M |
| 3300010359|Ga0126376_11846692 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300010360|Ga0126372_10279471 | Not Available | 1453 | Open in IMG/M |
| 3300010361|Ga0126378_13259728 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010376|Ga0126381_103837557 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010387|Ga0136821_1192938 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300010876|Ga0126361_11036753 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300011270|Ga0137391_10775305 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300012096|Ga0137389_10159837 | Not Available | 1851 | Open in IMG/M |
| 3300012189|Ga0137388_11511754 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012200|Ga0137382_10195637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300012200|Ga0137382_10642432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 759 | Open in IMG/M |
| 3300012202|Ga0137363_11823932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 501 | Open in IMG/M |
| 3300012203|Ga0137399_11311995 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012205|Ga0137362_11446759 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012205|Ga0137362_11503993 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012207|Ga0137381_10218090 | Not Available | 1655 | Open in IMG/M |
| 3300012209|Ga0137379_10175461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2055 | Open in IMG/M |
| 3300012209|Ga0137379_11669128 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012210|Ga0137378_10176248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1987 | Open in IMG/M |
| 3300012361|Ga0137360_11182429 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300012582|Ga0137358_10919618 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012683|Ga0137398_10151618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1504 | Open in IMG/M |
| 3300012923|Ga0137359_11161629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 659 | Open in IMG/M |
| 3300012924|Ga0137413_11186258 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012925|Ga0137419_10899520 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300012971|Ga0126369_13231779 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012987|Ga0164307_11255353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 617 | Open in IMG/M |
| 3300014153|Ga0181527_1045812 | All Organisms → cellular organisms → Bacteria | 2399 | Open in IMG/M |
| 3300014158|Ga0181521_10370412 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300014159|Ga0181530_10562010 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300014168|Ga0181534_10245700 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300014169|Ga0181531_11087908 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300014494|Ga0182017_10540913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 712 | Open in IMG/M |
| 3300014638|Ga0181536_10371205 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300015241|Ga0137418_10077539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3017 | Open in IMG/M |
| 3300015241|Ga0137418_11114579 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300015357|Ga0134072_10039293 | Not Available | 1273 | Open in IMG/M |
| 3300016422|Ga0182039_11311754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300017823|Ga0187818_10089048 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300017823|Ga0187818_10260391 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300017933|Ga0187801_10485286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 521 | Open in IMG/M |
| 3300017947|Ga0187785_10485804 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300017961|Ga0187778_10775790 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300017974|Ga0187777_10952431 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300017975|Ga0187782_11380121 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300018007|Ga0187805_10401618 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300018018|Ga0187886_1289796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 612 | Open in IMG/M |
| 3300018024|Ga0187881_10305266 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300018035|Ga0187875_10345420 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300018043|Ga0187887_10067547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2172 | Open in IMG/M |
| 3300018043|Ga0187887_10621067 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300018047|Ga0187859_10138226 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300018058|Ga0187766_10332340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 991 | Open in IMG/M |
| 3300018088|Ga0187771_10161852 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300018090|Ga0187770_10636155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 849 | Open in IMG/M |
| 3300018482|Ga0066669_10353964 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300019785|Ga0182022_1014974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1333 | Open in IMG/M |
| 3300019885|Ga0193747_1083320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 785 | Open in IMG/M |
| 3300020579|Ga0210407_10134759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1896 | Open in IMG/M |
| 3300020579|Ga0210407_10780409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 738 | Open in IMG/M |
| 3300020581|Ga0210399_10028774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4434 | Open in IMG/M |
| 3300020582|Ga0210395_10123184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1926 | Open in IMG/M |
| 3300020582|Ga0210395_10794985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 705 | Open in IMG/M |
| 3300020583|Ga0210401_10102071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2694 | Open in IMG/M |
| 3300021170|Ga0210400_10826637 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300021171|Ga0210405_10368463 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300021180|Ga0210396_11725252 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300021401|Ga0210393_11288725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 586 | Open in IMG/M |
| 3300021405|Ga0210387_10345499 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300021407|Ga0210383_11204853 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300021407|Ga0210383_11283219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300021432|Ga0210384_10289127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1476 | Open in IMG/M |
| 3300021478|Ga0210402_10351223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1368 | Open in IMG/M |
| 3300021559|Ga0210409_10773524 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300022531|Ga0242660_1216789 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300022557|Ga0212123_10183190 | Not Available | 1573 | Open in IMG/M |
| 3300022733|Ga0224562_1010298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 740 | Open in IMG/M |
| 3300023019|Ga0224560_107410 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300023101|Ga0224557_1150820 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300024295|Ga0224556_1002358 | All Organisms → cellular organisms → Bacteria | 5372 | Open in IMG/M |
| 3300025414|Ga0208935_1048657 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300025475|Ga0208478_1024877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1227 | Open in IMG/M |
| 3300025480|Ga0208688_1034151 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300025527|Ga0208714_1112173 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300025612|Ga0208691_1032391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1208 | Open in IMG/M |
| 3300025931|Ga0207644_10415375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1102 | Open in IMG/M |
| 3300025939|Ga0207665_11168056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 614 | Open in IMG/M |
| 3300026025|Ga0208778_1013853 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300026281|Ga0209863_10128561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 743 | Open in IMG/M |
| 3300026294|Ga0209839_10064029 | Not Available | 1303 | Open in IMG/M |
| 3300026318|Ga0209471_1239863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 636 | Open in IMG/M |
| 3300026322|Ga0209687_1126349 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300026325|Ga0209152_10489031 | Not Available | 505 | Open in IMG/M |
| 3300026335|Ga0209804_1075152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1592 | Open in IMG/M |
| 3300026542|Ga0209805_1267689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 659 | Open in IMG/M |
| 3300026551|Ga0209648_10215128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1453 | Open in IMG/M |
| 3300026928|Ga0207779_1033991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 600 | Open in IMG/M |
| 3300027045|Ga0207726_1014792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1269 | Open in IMG/M |
| 3300027073|Ga0208366_1022049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 701 | Open in IMG/M |
| 3300027497|Ga0208199_1084603 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300027737|Ga0209038_10064738 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300027745|Ga0209908_10122521 | Not Available | 663 | Open in IMG/M |
| 3300027825|Ga0209039_10137852 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300027825|Ga0209039_10285594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 652 | Open in IMG/M |
| 3300027846|Ga0209180_10056631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2173 | Open in IMG/M |
| 3300027853|Ga0209274_10161515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1132 | Open in IMG/M |
| 3300027853|Ga0209274_10329009 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300027853|Ga0209274_10430799 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300027854|Ga0209517_10114173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1790 | Open in IMG/M |
| 3300027855|Ga0209693_10385482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 678 | Open in IMG/M |
| 3300027902|Ga0209048_10118737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2010 | Open in IMG/M |
| 3300027905|Ga0209415_10876378 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300028747|Ga0302219_10335629 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300028792|Ga0307504_10357339 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300028798|Ga0302222_10139117 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300029907|Ga0311329_10089588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2567 | Open in IMG/M |
| 3300029913|Ga0311362_11189115 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300029922|Ga0311363_10045851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6898 | Open in IMG/M |
| 3300029923|Ga0311347_10875401 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300029944|Ga0311352_10160898 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300029945|Ga0311330_10356588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1232 | Open in IMG/M |
| 3300029951|Ga0311371_11568608 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300029954|Ga0311331_10596249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1048 | Open in IMG/M |
| 3300029993|Ga0302304_10083413 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300029995|Ga0302210_10045001 | Not Available | 1285 | Open in IMG/M |
| 3300029999|Ga0311339_10474560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1280 | Open in IMG/M |
| 3300029999|Ga0311339_10759331 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300030007|Ga0311338_10950267 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300030041|Ga0302274_10447520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 566 | Open in IMG/M |
| 3300030042|Ga0302300_1038968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1602 | Open in IMG/M |
| 3300030043|Ga0302306_10023333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2549 | Open in IMG/M |
| 3300030057|Ga0302176_10441033 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300030399|Ga0311353_10371632 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300030494|Ga0310037_10279939 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300030509|Ga0302183_10304134 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300030519|Ga0302193_10634626 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300030524|Ga0311357_10481567 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300030659|Ga0316363_10052518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1940 | Open in IMG/M |
| 3300030659|Ga0316363_10253969 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300030737|Ga0302310_10123360 | Not Available | 1580 | Open in IMG/M |
| 3300030943|Ga0311366_11732413 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031057|Ga0170834_105648717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 513 | Open in IMG/M |
| 3300031122|Ga0170822_11891174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 623 | Open in IMG/M |
| 3300031231|Ga0170824_122294102 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300031446|Ga0170820_17539881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 554 | Open in IMG/M |
| 3300031521|Ga0311364_10399149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
| 3300031708|Ga0310686_119320610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 512 | Open in IMG/M |
| 3300031718|Ga0307474_10657256 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300031718|Ga0307474_11419663 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031720|Ga0307469_10882284 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300031754|Ga0307475_10590953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 889 | Open in IMG/M |
| 3300031823|Ga0307478_10643479 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300031954|Ga0306926_10733629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1196 | Open in IMG/M |
| 3300031954|Ga0306926_11129494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 925 | Open in IMG/M |
| 3300031962|Ga0307479_10625523 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300031996|Ga0308176_10416068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1345 | Open in IMG/M |
| 3300032174|Ga0307470_10260613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1151 | Open in IMG/M |
| 3300032174|Ga0307470_11891521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 507 | Open in IMG/M |
| 3300032180|Ga0307471_100502790 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300032805|Ga0335078_10391728 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300032828|Ga0335080_10200479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2195 | Open in IMG/M |
| 3300032828|Ga0335080_11208202 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300032892|Ga0335081_10869318 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300032892|Ga0335081_12332023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300032893|Ga0335069_10461172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1480 | Open in IMG/M |
| 3300032897|Ga0335071_10174813 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 3300032897|Ga0335071_10450771 | Not Available | 1239 | Open in IMG/M |
| 3300032898|Ga0335072_10341189 | Not Available | 1647 | Open in IMG/M |
| 3300032898|Ga0335072_10812316 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300032955|Ga0335076_10308603 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium ADurb.Bin147 | 1470 | Open in IMG/M |
| 3300033134|Ga0335073_11477512 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300033158|Ga0335077_10834753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 935 | Open in IMG/M |
| 3300033158|Ga0335077_11306565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300034199|Ga0370514_190825 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.36% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.06% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.06% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.90% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.60% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.16% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.73% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.73% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.87% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.87% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.87% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.43% |
| Sediment | Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment | 0.43% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.43% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.43% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.43% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Drinking Water Pipes | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes | 0.43% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005892 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006872 | Biofilm microbial communities from drinking water pipes in Singapore | Engineered | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010387 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 k-mer 51 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026025 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029995 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12659J15293_100561602 | 3300001546 | Forest Soil | LLAEGETTHIVTDSSMKVAALPEKYLTAFRAAITK* |
| JGI25386J43895_101408982 | 3300002912 | Grasslands Soil | LVRADDGELLAEGETTHIVTDEDMTTKPLPEKYLSVFRGAAARNTSI* |
| JGIcombinedJ51221_103081012 | 3300003505 | Forest Soil | PNTGAVLAEGETTHIVTNSEMKVSALPDKYLSVFRAATGNNR* |
| JGIcombinedJ51221_103943121 | 3300003505 | Forest Soil | FGYELRHADTGRLLAEGETTHIVAGSKMEPRALPAKYLKVFRAALGR* |
| Ga0062387_1003539232 | 3300004091 | Bog Forest Soil | LRANDGTLLAEGETTHLVTDSQMKIAPIPEKYLKVFREAMGK* |
| Ga0062389_1015491702 | 3300004092 | Bog Forest Soil | RRAEDGTVLAEGETTHIVTDADMKIAALPEKYLKAFRSALGRQDGKLS* |
| Ga0066395_108345361 | 3300004633 | Tropical Forest Soil | IVFNYELARAETGALLAEGETTHVVTNTKMKAAALPDKYLNLFREAVDKRTSIRERS* |
| Ga0062388_1027727811 | 3300004635 | Bog Forest Soil | KAETDELLAEGETTHIVADSRMNPRALPEKYMKVFRAAIG* |
| Ga0066688_105606081 | 3300005178 | Soil | VRVSDGVLLAEGETTHIVTDAELKTRTMPEKHMALFREASGKTG* |
| Ga0066388_1066117952 | 3300005332 | Tropical Forest Soil | YELVRLEDGTLLAEGETTHIVTDAQMKMTAIPDKYLRVFRAAAGK* |
| Ga0070708_1013022702 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ADDGELLAEGETTHIVTDEDMTAKPLPEKYLSVFRGAAARNTSI* |
| Ga0070735_101358031 | 3300005534 | Surface Soil | ELLRADHGTLLAEGETTHIVTDSNMKIAALPEKYLQVFRAAVGK* |
| Ga0070731_107810622 | 3300005538 | Surface Soil | SYELVRASTSDLMAEGETTHIVTNSKMKVSALPDKYLSAFREAVGR* |
| Ga0066692_107321762 | 3300005555 | Soil | ELVRVSDGVLLAEGETTHIVTDAELKTRTMPEKHMALFREASGKTG* |
| Ga0066707_100907403 | 3300005556 | Soil | GDGTLLAEGETTHIVTDAAMKMTPLPEKYTKAFRAAVGR* |
| Ga0066707_108292951 | 3300005556 | Soil | LLAEGETTHLVTDAEMKVRAIPEKYMRAFQEAVGKSS* |
| Ga0068855_1025973202 | 3300005563 | Corn Rhizosphere | LLAEGETTHIVTDAEMKITTIPEKYLTIFRGAISR* |
| Ga0066694_102206972 | 3300005574 | Soil | TLLAEGETTHIVTDPQMKIAVLPDKYLNAFRAALRE* |
| Ga0066691_103927251 | 3300005586 | Soil | GTLLAEGETTHIVTDAQMKIAVLPDKYLNAFRAALQK* |
| Ga0070761_101546001 | 3300005591 | Soil | DGALLAEGETTHIVTDGNMKIAALPEKYLTVFRAAVGKQNGKPS* |
| Ga0070764_105027961 | 3300005712 | Soil | RAEGGELLAEGETAHVVTDSEMRVAPLPEKYLKAFRKALGRSHL* |
| Ga0075275_11033522 | 3300005892 | Rice Paddy Soil | LLAEGDTMHIVTDAGMNKRALPEKYRTAFDAAVERGC* |
| Ga0075277_10917681 | 3300005895 | Rice Paddy Soil | AMRADDGALLADGETTHIVTDAQMKKRDLPPKYAARFRAAVVAATD* |
| Ga0075273_100949222 | 3300005902 | Rice Paddy Soil | LLAEGETTHIVVGEDMQRKPLPEKYLVPFREAVGR* |
| Ga0070766_106113092 | 3300005921 | Soil | ELARPNTGAVLAEGETTHIVTNSEMKVSALPDKYLSVFRAATGNKR* |
| Ga0066789_102396942 | 3300005994 | Soil | NSKMLLAEGETTHIVTDSKMKVAALPEKYLTAFRAAMAQ* |
| Ga0066790_100746352 | 3300005995 | Soil | VLAEGETTHIVTDAEMKVTAIPEKYLKVFREATGRL* |
| Ga0066790_105288331 | 3300005995 | Soil | AEGETTHIVADAKMTPRALPEKYLKAFRAAVGNRSA* |
| Ga0070717_114114181 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RADTGALLAEGETTHIVTDSQMKVATLPEKYLGVFRAAVKK* |
| Ga0066651_105784262 | 3300006031 | Soil | LRRVEDGALLAEGETTHIVTNADMKVTAIPDTYMKAFRAAVGKQDGKLI* |
| Ga0075029_1000817261 | 3300006052 | Watersheds | ELLAEGETTHIVADAQMKPRALPEKYLKVFREAVSGH* |
| Ga0070716_1008157741 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SDGTLLAEGETTHIVTDAEMKITTIPEKYLTIFRGAISR* |
| Ga0075014_1004576601 | 3300006174 | Watersheds | FSYELLRTEGGALLAEGETTHIVTDLKMKVAALPEKYLEVFRAAVGK* |
| Ga0075014_1009229452 | 3300006174 | Watersheds | ALLAEGETMHIVANSKMKPRALPGKYMKIFRNAVGTVA* |
| Ga0068871_1010711712 | 3300006358 | Miscanthus Rhizosphere | GYELLRAGDGTLLAEGETTHIVIDKQMKIAAIAGKYLDVFRKAAGR* |
| Ga0066659_112154362 | 3300006797 | Soil | AVLAEGETIHIVTDSEMKKRELPEKYQAMFRSAVGKANK* |
| Ga0066660_116392462 | 3300006800 | Soil | EVLLAEGETTHVVTDASMKKRAIPEKYAKAFREAMHKS* |
| Ga0101947_10345311 | 3300006872 | Drinking Water Pipes | LLAEGETTHIVADSRMKPRALPEKYMKVFREAIRKPNI* |
| Ga0075426_110285801 | 3300006903 | Populus Rhizosphere | LLAEGETTHIVTDSAMKIAALPEKYLSAFRAAVGR* |
| Ga0099830_105489192 | 3300009088 | Vadose Zone Soil | LLAEGETTHIVTDSNMKVAALPAKYLKVFREAVGKSSQ* |
| Ga0099830_115530211 | 3300009088 | Vadose Zone Soil | AEGETTHIVADSKMEPRVLPEKYMSVFRAAVGNRSA* |
| Ga0116221_13123161 | 3300009523 | Peatlands Soil | EGETTHIVTDADMKIAVLPEKYLKVFRAAVGKLEPNH* |
| Ga0116106_10417163 | 3300009645 | Peatland | ELLAEGETTHIVANSRMKPRALPGKYMNVFRAAIGR* |
| Ga0116224_100170501 | 3300009683 | Peatlands Soil | TLLAEGETTHIVTDADMKAAVLPEKYLKVFRAVVGKL* |
| Ga0116101_11163611 | 3300009759 | Peatland | IRFGYELRLEETGELLAEGETTHIVADSRMKPRALPKKYMTVFRTALGKRGGV* |
| Ga0116134_11391271 | 3300009764 | Peatland | LLAEGETTHIVANAKMKPRALPQKYMRVFRAAVAK* |
| Ga0116219_103024881 | 3300009824 | Peatlands Soil | ETTHIVTNADMKITALPEKYLNVFRAAVGKRNGKLS* |
| Ga0116223_100381425 | 3300009839 | Peatlands Soil | AETGELLAEGETTHIVADSSMRPRALPEKYMKVFRAAVGR* |
| Ga0116223_105527341 | 3300009839 | Peatlands Soil | TLLAEGESTHLVTDSKMKLAALPEKYLTAFRASMGK* |
| Ga0134067_100538451 | 3300010321 | Grasslands Soil | GALLAEGETTHIGTDGKMKVAPLPDKYLTVFRAAVKK* |
| Ga0126376_118466922 | 3300010359 | Tropical Forest Soil | DTGALLAEGETTHVVTNSDMKVASLPKKYLSVFRCAAGK* |
| Ga0126372_102794711 | 3300010360 | Tropical Forest Soil | TGALLAEGETTHVVTNTKMKAAALPDKYLNLFREAVDKRTSIRERS* |
| Ga0126378_132597281 | 3300010361 | Tropical Forest Soil | NYELARADSGTLLAEGETTHIVTDSKMKVAALPDKYLTVFRAAVGK* |
| Ga0126381_1038375572 | 3300010376 | Tropical Forest Soil | VVLAEGETVHIVTDSSMKVSSLPRKYLKVFQGAAGR* |
| Ga0136821_11929383 | 3300010387 | Sediment | YELLRAGDGTLLAEGETTHIVTDREMKIVAIPEKYVAIFRAAAGR* |
| Ga0126361_110367531 | 3300010876 | Boreal Forest Soil | GYELRRAEDGALLAEGETTHIVTDASMKVAALPDKYMKALREAVGKTSI* |
| Ga0137391_107753051 | 3300011270 | Vadose Zone Soil | DLLAEGETTHIVANSKMKPRALPEKYLRAFRAAVGNRSA* |
| Ga0137389_101598372 | 3300012096 | Vadose Zone Soil | LLAEGETTHIVTDEDMTTKPLPEKYLSVFRGAAARNTSI* |
| Ga0137388_115117542 | 3300012189 | Vadose Zone Soil | EGETTHIVTDERMKIPTIPDRYMKVFREAVGKLPSAR* |
| Ga0137382_101956372 | 3300012200 | Vadose Zone Soil | AEGETTHIVADSKMMPRALPEKYMKVFRAAVGGP* |
| Ga0137382_106424321 | 3300012200 | Vadose Zone Soil | SYELERANTGTVLAEGETTHIVTNSEMKVSVLPDKYLSVFRAATGK* |
| Ga0137363_118239322 | 3300012202 | Vadose Zone Soil | GELLAEGETTHIVTDEDMTTKPLPEKYLSVFRGAAARNTSI* |
| Ga0137399_113119951 | 3300012203 | Vadose Zone Soil | LLAEGETTHIVADSQMKPRALPEKYMNVFRAAMTKQ* |
| Ga0137362_114467592 | 3300012205 | Vadose Zone Soil | VLAEGETTHIVTDAAMKVRTIPEKYLKVFREAAGRTS* |
| Ga0137362_115039932 | 3300012205 | Vadose Zone Soil | DLLAEGETTHIVADSKMMPRALPEKYMQVFRAAVGSP* |
| Ga0137381_102180902 | 3300012207 | Vadose Zone Soil | AEGETTHIVTDEDMTAKPLPEKYLSVFRGAAARNTSI* |
| Ga0137379_101754611 | 3300012209 | Vadose Zone Soil | LLAEGETTHIVADKQMKPRALPEKYMNVFRAAAAKQ* |
| Ga0137379_116691282 | 3300012209 | Vadose Zone Soil | LLAEGETTHIVTDSKMIVSALPEKYLTAFREAMAK* |
| Ga0137378_101762483 | 3300012210 | Vadose Zone Soil | DSEALLAEGETTHIVNDSSMQVAALPEKYLTAFRAAAGK* |
| Ga0137360_111824292 | 3300012361 | Vadose Zone Soil | ADSGELLAEGETTHIVADSQMKPRALPEKYMKAFSEAVGK* |
| Ga0137358_109196181 | 3300012582 | Vadose Zone Soil | TGDLLAEGETTHIVADSKMMPRALPEKYMKVFRAAVGSP* |
| Ga0137398_101516181 | 3300012683 | Vadose Zone Soil | GVVLAQGETTHIVTDAAMKVRAIPEKYMRLFREAAGRTS* |
| Ga0137359_111616291 | 3300012923 | Vadose Zone Soil | RSVESGDLLAEGETTHIVADSKMMPRALPEKYMKVFRAAVGSP* |
| Ga0137413_111862581 | 3300012924 | Vadose Zone Soil | LLAEGETTHIVTDADMKIAVLPEKYLTVFRAAVGKQDGKHS* |
| Ga0137419_108995201 | 3300012925 | Vadose Zone Soil | RLSDGALMAEGETTHIVTDAQIKTAVLPDKYLNAFRAALRK* |
| Ga0126369_132317791 | 3300012971 | Tropical Forest Soil | LAEGETTHIVADAKMQKTTLPEKYLTVFREAVGR* |
| Ga0164307_112553531 | 3300012987 | Soil | RAHDGALLAEGETTHIVTDAKMKVAPLPDKYLSVFRAAVKK* |
| Ga0181527_10458123 | 3300014153 | Bog | RRVGTDELLAEGETTHIVADSTMKPRALAAKYMKVFRAAVAAPEGA* |
| Ga0181521_103704121 | 3300014158 | Bog | TGELLAEGETTHIVADSSMRPRALPEKYMKVFRAAMGR* |
| Ga0181530_105620101 | 3300014159 | Bog | TGELLAEGETTHIVADSSMRPRALPEKYMKVFRAAMGDRKVGR* |
| Ga0181534_102457001 | 3300014168 | Bog | AETGALLAEGETTHVVTDSNMKVSTLPEKYLRVFRAAIGK* |
| Ga0181531_110879082 | 3300014169 | Bog | VLLAEGETTHIVTDAAMKIAELPEKYLKVFREAVGKSKPNR* |
| Ga0182017_105409132 | 3300014494 | Fen | RFGYELRRAETGERLAEGETTHIVANAKMKTRPLPEKYLNVFRAAVGSP* |
| Ga0181536_103712053 | 3300014638 | Bog | GELLAEGETTHIVADAQMKTRILPEKYLRVFRAAIGR* |
| Ga0137418_100775394 | 3300015241 | Vadose Zone Soil | IEDGSLLAEGETTHIVADAQMRKTVLPEKYRKAFQDATGR* |
| Ga0137418_111145792 | 3300015241 | Vadose Zone Soil | VRLSDGALMAEGETTHIVTDAQRKTAVLPDKYLNAFRAALRK* |
| Ga0134072_100392932 | 3300015357 | Grasslands Soil | LLLAEGETTHIVTDAQMKTRTIPEKYVGAFREAANKSV* |
| Ga0182039_113117542 | 3300016422 | Soil | LLAEGETTHIVTNREMKIRALPEKYLSAFRAAMGK |
| Ga0187818_100890482 | 3300017823 | Freshwater Sediment | ELLAEGETTHIVANAKMKPRALPGKYMKVFRTAVGKPTIEN |
| Ga0187818_102603911 | 3300017823 | Freshwater Sediment | TLLAEGETTHVVTDAKMKVTTLPEKYLRVFRAAAGK |
| Ga0187801_104852862 | 3300017933 | Freshwater Sediment | GVLLAEGETMHVVANAQMKATPLPEKYLNALRQALRR |
| Ga0187785_104858042 | 3300017947 | Tropical Peatland | LAEGETTHIVADAQMKPRALPEKYMKVFRDATRKVDG |
| Ga0187778_107757901 | 3300017961 | Tropical Peatland | LLADGETTHIVTDSNMKIATLPAKYLTAFTAAMGR |
| Ga0187777_109524311 | 3300017974 | Tropical Peatland | EGETTHIVSDAQMKPRALPPKYLSVFRAAAGNSDGG |
| Ga0187782_113801212 | 3300017975 | Tropical Peatland | GYELRRAETGELVAQGETTHIVADAQMKPRALPEKYLKVFRAAAGKKAES |
| Ga0187868_10176931 | 3300018002 | Peatland | KVIRFGYELRSAETGELLAEGETTHIVANSRMKPRALPGKYMNVFRAAIGR |
| Ga0187805_104016183 | 3300018007 | Freshwater Sediment | AETGELLAEGETTHIVANSRMKPRALPGKYMKVFRAAIGR |
| Ga0187860_13011681 | 3300018014 | Peatland | IRFGYELRSAETGELLAEGETTHIVANSRMKPRALPGKYMNVFRAAIGR |
| Ga0187886_12897962 | 3300018018 | Peatland | ETGELLAEGETTHIVANARMKTRALPEKYLRVFRAAIGR |
| Ga0187881_103052661 | 3300018024 | Peatland | AEGETTHIVTDAAMKIAVLPEKYLKVFRAAVGKQDGKVS |
| Ga0187875_103454201 | 3300018035 | Peatland | LAEGETTHIVANAQMKTRTLPEKYMRVFRAAVGKKNVEASS |
| Ga0187887_100675473 | 3300018043 | Peatland | LAEGETTHIVANAQMKPRKLPEKYMKVFRTAAGARAPQPIL |
| Ga0187887_106210671 | 3300018043 | Peatland | IFSYELNRVETGALLAEGETTHVVTDSNMKVSTLPGKYLSVFRAAVGK |
| Ga0187859_101382261 | 3300018047 | Peatland | LLAEGETTHVVTDSKMKVAPLPEKYLKAFRKALGKHSM |
| Ga0187766_103323401 | 3300018058 | Tropical Peatland | LLAEGETTHIVADTHMKPRRLPEKYMKVFREAVGN |
| Ga0187771_101618524 | 3300018088 | Tropical Peatland | YELLQADSRRLLAEGETTHIVTDLNMKVATLPEKYLQAFRSAM |
| Ga0187770_106361552 | 3300018090 | Tropical Peatland | YELLQADNGTLLAEGETTHIVTDLNMQVAGLPDKYLKAFRAAMGK |
| Ga0066669_103539641 | 3300018482 | Grasslands Soil | MLLAEGETTHIVTDSQMKVRDIPEKYMKVFQEAVKHRL |
| Ga0187852_13051761 | 3300019082 | Peatland | REKVIRFGYELRSAETGELLAEGETTHIVANSRMKPRALPGKYMNVFRAAIGR |
| Ga0182022_10149742 | 3300019785 | Fen | GYELQRAETGELLAEGETTHIVADAQMKTRILPEKYLRVFRAAVGSP |
| Ga0193747_10833201 | 3300019885 | Soil | VLLAEGETTHIVTDAEMKTRPIPEKYVKAFRDAAGRTF |
| Ga0210407_101347593 | 3300020579 | Soil | TTHIVTDADMKIAALPDKYLKAFRSAVGKQDGKLS |
| Ga0210407_107804092 | 3300020579 | Soil | GYELRRAEDGALLAEGETTHIVTDADMKIAPLPEKYLKVFRAAIGKRNGNSS |
| Ga0210399_100287747 | 3300020581 | Soil | YELARANTGTVLAEGETTHIVTNSEMKVSALPDKYLSVFRAATGK |
| Ga0210395_101231841 | 3300020582 | Soil | YTLRRVDNDTLLAEGETTHIVTDADMKIAVLPDKYLKAFRAAVGKQDGKLA |
| Ga0210395_107949852 | 3300020582 | Soil | ESVIKFSYELARPNTGAVLAEGETTHIVTNSEMKVSALPDKYLSVFRAATGNNR |
| Ga0210401_101020713 | 3300020583 | Soil | AEDGALLAEGETTHIVTDADMKIAPLPEKYLKVFRAAIGKRNGNSS |
| Ga0210400_108266371 | 3300021170 | Soil | DVLLAEGETTHIVTDAEMKIAVLPEKYLTAFRAAVGKQNGKPS |
| Ga0210405_103684632 | 3300021171 | Soil | LAEGETTHIVTDAEMKIAELPEKYLKAFRAALGKQNGKRS |
| Ga0210396_117252522 | 3300021180 | Soil | GETTHIVTDAEMKIAVLPEKYLTAFRAAVGKQNGKPS |
| Ga0210393_112887251 | 3300021401 | Soil | LRRATDGALLAEGETTHIVTDSEMKVAALPEKYLTVFRAAVGKRNRKST |
| Ga0210387_103454991 | 3300021405 | Soil | LLAEGETTHIVADAQMRKTALPEKYLQAFREAAGK |
| Ga0210383_112048531 | 3300021407 | Soil | RADDRTLLAEGETTHIVTDADMKIAMLPEKYLKVFRAAVGKL |
| Ga0210383_112832191 | 3300021407 | Soil | RNVATGALLAEGETTHIAANAKMKPRALPEKYMHVFRAAVKEE |
| Ga0210384_102891272 | 3300021432 | Soil | DGALLAEGETTHIVTDAQMRIAVLPDKYLNAFRAALRK |
| Ga0210402_103512232 | 3300021478 | Soil | ELARAEGGALLAEGETTHVVTDATMKAAALPEKYLKAFRKAMGKHPT |
| Ga0210409_107735241 | 3300021559 | Soil | LAEGETTHIVADSRMRPRVLPEKYMKVFRAAVGSP |
| Ga0242660_12167891 | 3300022531 | Soil | NALVAEGETTHIVTDSQMKVAALPEKYLTAFRAATGK |
| Ga0212123_101831902 | 3300022557 | Iron-Sulfur Acid Spring | DALLAEGETTHIVTDKDMNISALPEQYLTVFRAAVAKQDGKLS |
| Ga0224562_10102982 | 3300022733 | Soil | ELVRAEGGELLAEGETAHVVTDSEMRVAPLPEKYFKAFRKALGRSHL |
| Ga0224560_1074102 | 3300023019 | Soil | TTHIVTDEQMKIAVLPEKYLKIFRAAVGKRNGNPS |
| Ga0224557_11508203 | 3300023101 | Soil | EKREVLAEGETIHIVADSQMKPRKLPEKYMKVFRAAVGS |
| Ga0224556_10023585 | 3300024295 | Soil | LMSAEGRQLLAEGETTHIVANAQMKPRRLPEKYMKVFRAAVSN |
| Ga0208935_10486571 | 3300025414 | Peatland | VEGDVLLAEGETTHIVTDAAMKIAELPEKYFRVFRAAVGKQDAKP |
| Ga0208478_10248771 | 3300025475 | Arctic Peat Soil | AETAELLAEGETTHIIADAKMKPRALPEKYMTVFRAAVGNRSA |
| Ga0208688_10341511 | 3300025480 | Peatland | LRSAGTGKLLAEGETTHIVANSTMKPRALPEKYMQVFRAALGR |
| Ga0208714_11121732 | 3300025527 | Arctic Peat Soil | TGKLLAEGETTHIVADAKMTPRALPEKYLKAFRAAVGNRSA |
| Ga0208691_10323911 | 3300025612 | Peatland | GALLAEGETTHIVTDAELKVAALPEKYLKVFRAAVGKRDRNNS |
| Ga0207644_104153752 | 3300025931 | Switchgrass Rhizosphere | SDGTLLAEGETTHIVTDAEMKITTIPEKYLTIFRGAISR |
| Ga0207665_111680562 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ARANTGTVLAEGETTHIVTNSEMKVSALPDKYLSVFRAATGK |
| Ga0208778_10138532 | 3300026025 | Rice Paddy Soil | TGALLAEGETTHIVTDSKMKVAALPDKYLDVFRAAVKK |
| Ga0209863_101285611 | 3300026281 | Prmafrost Soil | SDGVLLAEGETTHIVTDAEMKVRAIPEKFMKVFREAAGKV |
| Ga0209839_100640292 | 3300026294 | Soil | VLAEGETTHIVTDAEMKVTAIPEKYLKVFREATGRL |
| Ga0209471_12398632 | 3300026318 | Soil | LVREEGGALLAEGETTHIVTDSKFKIAALPEKYLKVFREAVGK |
| Ga0209687_11263492 | 3300026322 | Soil | LLAEGETTHIVTNAKMEIAALPDKYMKVFLSAIGRDVI |
| Ga0209152_104890313 | 3300026325 | Soil | RADSGALLAEGETTHIVTDSNMKVAALPEKYLKVFRDAVGKRSP |
| Ga0209804_10751521 | 3300026335 | Soil | ESVIRFSYELERANTGTVLAEGETTHIVTNSEMKVSVLPDKYLSVFRAATGK |
| Ga0209805_12676891 | 3300026542 | Soil | GDGLLLADGETTHIVTNAKMEIAALPDKYMKVFLSAIGRDVI |
| Ga0209648_102151282 | 3300026551 | Grasslands Soil | LRRAETGELLAEGETTHIVANSKMKPRALPEKYLSAFRAAVGRP |
| Ga0207779_10339911 | 3300026928 | Tropical Forest Soil | RAENGALLAEGETTHIVTDRSMKVAALPEKYLQAFRSAAGK |
| Ga0207726_10147922 | 3300027045 | Tropical Forest Soil | ELVRAENGALLAEGETTHIVTDRSMKVAALPEKYLQAFRSAAGK |
| Ga0208366_10220492 | 3300027073 | Forest Soil | LARAEDGQLLAEGETTHIVTDEQMKMVPLPGKYLNVFRAAVGR |
| Ga0208199_10846033 | 3300027497 | Peatlands Soil | AETGELLAEGETTHIVADSSMRPRALPEKYMKVFRAAVGR |
| Ga0209038_100647382 | 3300027737 | Bog Forest Soil | ETTHIVTDADMKIAVLPEKYLKVFRAAVGKLQPDH |
| Ga0209908_101225212 | 3300027745 | Thawing Permafrost | TTHIVTDRDMKIAVLPERYLKAFRAAIGKRDGKNS |
| Ga0209039_101378521 | 3300027825 | Bog Forest Soil | LAEGETTHIVADAQMKPRALPEKYMKVFRAAAGTKTP |
| Ga0209039_102855942 | 3300027825 | Bog Forest Soil | RAENGELLAEGETTHIVANAQMKPRALPEKYLKVFRAAVGGP |
| Ga0209180_100566313 | 3300027846 | Vadose Zone Soil | GYELRRAETGDLLAEGETTHIVANSKMKPRALPEKYLKAFRAAAGNRSA |
| Ga0209274_101615152 | 3300027853 | Soil | EGETTHIVTDANMKIAALPEKYMKAFRAALGKQDGKLS |
| Ga0209274_103290092 | 3300027853 | Soil | ESGALLAEGETTHIVADSTMKPRALPAKYMRVFRAAVSRP |
| Ga0209274_104307992 | 3300027853 | Soil | EGETTHIVTGPDMKVTALPAKYLKVFRAAIGKRNGNSS |
| Ga0209517_101141732 | 3300027854 | Peatlands Soil | VRESVVIFSYELVRADDRTLVAEGSTTHVVTDSTMKVAALPEKYLTAFRTAMGK |
| Ga0209693_103854822 | 3300027855 | Soil | AQDGSLLAEGETTHIVTDAAMKIAALPEKYLKVFRSALGKQDGKLS |
| Ga0209048_101187372 | 3300027902 | Freshwater Lake Sediment | AVTGELLAEGETTHIVANSKMKPRALPEKYMKVFRAAVGEKK |
| Ga0209415_108763782 | 3300027905 | Peatlands Soil | EDSTLLAEGETTHIVTDAEMKIASLPEKYLKAFRAALGKQDGKLS |
| Ga0302219_103356291 | 3300028747 | Palsa | ALLAEGETTHIVTDRDMKIAALPKKYLKAFRAAIGKGDGKNS |
| Ga0307504_103573391 | 3300028792 | Soil | LAEGETTHIVADKQMKARALPEKYMKVFRAAVAKP |
| Ga0302222_101391171 | 3300028798 | Palsa | LAEGETTHIVTDRDMKIAVLPERYLKTFRAAIGKRDGKNS |
| Ga0311329_100895883 | 3300029907 | Bog | GTLLAEGETTHIVTDAEMKIAVLPEKYLKVFRSVAGKEDGKLS |
| Ga0311362_111891152 | 3300029913 | Bog | ELLAEGETTHIVADAQMKPRALPEKYLRVFRAAVGSP |
| Ga0311326_105284132 | 3300029917 | Bog | VIHFGYELRAEKTGELLAEGETTHIVATSKIKPRTLPPKYMQAFRSALHNLGTRD |
| Ga0302141_11977251 | 3300029919 | Bog | EKTGELLAEGETTHIVATSKIKPRTLPPKYMQAFRSALHNLGTRD |
| Ga0311363_100458519 | 3300029922 | Fen | RAEDGTLLAEGETTHIVTDAGMKIAVLPEKYLKVFRAAVGKQDGKIS |
| Ga0311347_108754011 | 3300029923 | Fen | LLAEGETTHIVADSQMKPRSLPEKYMKAFRAAVAKSE |
| Ga0311352_101608983 | 3300029944 | Palsa | YELLAEGETIHIVADSKMKPRALPEKYRKIFRAAVGR |
| Ga0311330_103565881 | 3300029945 | Bog | DGTLLAEGETTHIVTDAAMKIAVLPEKYLKVFRAAVGKQDGKVS |
| Ga0311371_115686082 | 3300029951 | Palsa | NAQTGELLAEGETTHIVADANMTPRALPAKYLKVFRAAVGGP |
| Ga0311346_101463313 | 3300029952 | Bog | VRPKIIHFGYELRADKTGELLAEGETTHIVASSKMKPRVLPHKYMQAFRSALDKLTARD |
| Ga0311331_105962492 | 3300029954 | Bog | VVHFSYELRRVGDGALLAEGETTHIVTDAELKVAALPEKYLKVFRAAVGKRDRNNS |
| Ga0302304_100834132 | 3300029993 | Palsa | VVHFGYELRRAQDGAVLAEGETIHIVTGADMKTAVLPEKYLKVFRAAVGKPGGKVS |
| Ga0302210_100450011 | 3300029995 | Fen | DRKLLAEGETTHIVASSQMKPRKLPEKYMMVFRAATGQPSDEH |
| Ga0311339_104745601 | 3300029999 | Palsa | AEDGKLLAEGETTHIVTGRDLKIAVFPEKYLKAFRAAVGKQDRKLS |
| Ga0311339_107593313 | 3300029999 | Palsa | AETYELLAEGETIHIVADSKMKPRALPEKYRKIFRAAVGR |
| Ga0311338_109502672 | 3300030007 | Palsa | LVRANDAALLAEGETTHIVTDAQMKVAALPDRYVKAFREALAE |
| Ga0302274_104475201 | 3300030041 | Bog | YELRRAEDGTLLAEGETTHIVTDAGMKIAVLPEKYLKVFRAAVGKQDGKIS |
| Ga0302300_10389682 | 3300030042 | Palsa | GETTHIVTDGAMKIAELPEKYLSVFRAAVGKQGRKP |
| Ga0302306_100233333 | 3300030043 | Palsa | HFGYELRRAQDGAVLAEGETIHIVTGADMKTAVLPEKYLKVFRAAVGKPGGKVS |
| Ga0302176_104410332 | 3300030057 | Palsa | EGETTHIVTDSDMKVAALPQKYLQAFRAAVGKRNRKST |
| Ga0311353_103716321 | 3300030399 | Palsa | GELLAEGETAHVVTDSKMKVAPLPERYLKAFRKALGKHST |
| Ga0310037_102799393 | 3300030494 | Peatlands Soil | TGELLAEGETTHIVADSSMRPRALPEKYMKVFRAAVGR |
| Ga0302183_103041343 | 3300030509 | Palsa | LLAEGETIHIVADSKMKPRALPEKYRKIFRAAVGR |
| Ga0302193_106346262 | 3300030519 | Bog | GTLLAEGETTHIVTDAGMKIAVLPEKYLKVFRAAVGKQDGKIS |
| Ga0311357_104815671 | 3300030524 | Palsa | GYELRRAQDGAVLAEGETIHIVTGADMKTAVLPEKYLKVFRAAVGKPGGKVS |
| Ga0316363_100525181 | 3300030659 | Peatlands Soil | TLLAEGETTHIVTDLNMKVAALPEKYLKAFRNAMGK |
| Ga0316363_102539692 | 3300030659 | Peatlands Soil | TLLAEGESTHLVTDSKMKLAALPEKYLTAFRASMGK |
| Ga0302310_101233601 | 3300030737 | Palsa | LAEGETIHIVTGADMKTAVLPEKYLKVFRAAVGKPGGKVS |
| Ga0311366_117324132 | 3300030943 | Fen | SAETAELLAEGETTHIIADAKMKPRALPEKYMTVFRAAVGNRSA |
| Ga0170834_1056487171 | 3300031057 | Forest Soil | DGVLLAEGETTHLVTDANMNKTPIPEKYASAFREAMQRS |
| Ga0170822_118911742 | 3300031122 | Forest Soil | GVLLAEGETTHLVTDANMNKRPIPEKYASAFREAMQTS |
| Ga0170824_1222941022 | 3300031231 | Forest Soil | LLAEGETTHIVTDSNMKVAALPEKYLIAFREAIAK |
| Ga0170820_175398811 | 3300031446 | Forest Soil | LVRAGDGKLLAEGETTHVVTNSEMKVSPLPEKYLQAFRAALGK |
| Ga0311364_103991492 | 3300031521 | Fen | GTGELLAEGETTHIVADSQMKPRSLPEKYMKAFRAAVAKSE |
| Ga0310686_1193206102 | 3300031708 | Soil | RRAEDGTVLAEGETTHIVTDSDMKIAALPERYLTVFRAAVGKPDRKHS |
| Ga0307474_106572562 | 3300031718 | Hardwood Forest Soil | LVRADSRALVAEGETTHIVTDSKMKVAALPEKYLTAFRAAMAK |
| Ga0307474_114196631 | 3300031718 | Hardwood Forest Soil | VAEGETTHIVTDSKMKVAALPEKYLTAFRAATGKQ |
| Ga0307469_108822841 | 3300031720 | Hardwood Forest Soil | ETGELLAEGETTHIVADSKMKPRALPEKYIKVFRAAVGSP |
| Ga0307475_105909531 | 3300031754 | Hardwood Forest Soil | VADRVLLAEGETTHIVTDADMKIAVLPEKYLSVFRSAVGKQNGKHS |
| Ga0307478_106434791 | 3300031823 | Hardwood Forest Soil | TGTVLAEGETTHIVTNSDMKVSALPDKYLSVFRAATGK |
| Ga0306926_107336291 | 3300031954 | Soil | ALLAEGETTHIVADAEMRKAALPERYMKVFREAAAR |
| Ga0306926_111294942 | 3300031954 | Soil | ELARADTGVLLAEGETTHVVTNSKMKIASLPKKYLAVFRVAAGK |
| Ga0307479_106255231 | 3300031962 | Hardwood Forest Soil | ETTHIVTDADMKIAPLPEKYLKVFRAAVGKRNGKLS |
| Ga0308176_104160681 | 3300031996 | Soil | ELLAEGETTHIVTNSKMKTKALPEKYLNAFRMCVGA |
| Ga0307470_102606132 | 3300032174 | Hardwood Forest Soil | FSYELARANTGTLLAEGETTHIVTNSEMKVSTLPPKYLNVFRAAAGK |
| Ga0307470_118915212 | 3300032174 | Hardwood Forest Soil | LRRVADGVLLAEGETTHIVTDADMKIAVLPEKYLSVFRSAVGKQNGKHS |
| Ga0307471_1005027902 | 3300032180 | Hardwood Forest Soil | ELLAEGETTHIVTDEEMRAKPLPEKYLNVFRGAAARNTSV |
| Ga0307471_1014484492 | 3300032180 | Hardwood Forest Soil | RFGYELRSAETGELLAEGETTHIVADSKMKPRALPEKYIKVFRAAVGSP |
| Ga0335078_103917281 | 3300032805 | Soil | GAESLLAEGETTHIVTDAQMRPRPLPEKYLKVFRAAMEKERA |
| Ga0335080_102004791 | 3300032828 | Soil | SEGGALLAEGETTHIVTNTEMKVAALPEKYLRAFRAAVGK |
| Ga0335080_112082022 | 3300032828 | Soil | ASDRTLLAEGETTHIVTDSTFSRRTLPEKYLSVFRVAVGS |
| Ga0335081_108693182 | 3300032892 | Soil | TRAGNGTLLAEGETTHIVTDANMKIAALPEKYLTAFRVAMGK |
| Ga0335081_123320232 | 3300032892 | Soil | DGTVLAEGETAHLVTDAQMKVRTLPEKYLRALAEAAGGA |
| Ga0335069_104611722 | 3300032893 | Soil | RAQTGELLAEGETMHIVANAEMKPRALPAKYLKVFRAAVAKPD |
| Ga0335071_101748132 | 3300032897 | Soil | LLAEGETTHIVVGEDMQKKALPEKYLGPFKAAVGR |
| Ga0335071_104507712 | 3300032897 | Soil | FGYELSRAEDGKLLAEGHTTHIVTDSNMKVSTLPEKYLKAFRSAVGK |
| Ga0335072_103411892 | 3300032898 | Soil | ALLAEGETTHIVTDSNMKVAALPEKYLAAFRAATRKQSPATGVS |
| Ga0335072_108123161 | 3300032898 | Soil | RADGKLLAEGETTHIVTDANMKVSFLPDKYLTAFRAAIRK |
| Ga0335076_103086032 | 3300032955 | Soil | TGALLAEGETTHIVTDSNMKIAALPPKYLTAFRTAKGK |
| Ga0335073_114775121 | 3300033134 | Soil | YELLAADSRQVLAEGETTHIVANSRMKPRRLPEKYLKVFQSAVGA |
| Ga0335077_108347532 | 3300033158 | Soil | TVVVFGYELLEAQSGKLLAEGETTHVVTDLNMKVAALPEKYLSAFRAAMGKQ |
| Ga0335077_113065651 | 3300033158 | Soil | DADGALLAEGETAHLVTDAQMKVRTLPEKYVRALAEAAGGA |
| Ga0370514_190825_1_123 | 3300034199 | Untreated Peat Soil | AETGALLAEGETTHVVTDSDMKVSTLPEKYLRVFRAAIGK |
| ⦗Top⦘ |