| Basic Information | |
|---|---|
| Family ID | F019182 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 231 |
| Average Sequence Length | 47 residues |
| Representative Sequence | AEIAGLSAAEVVCRGEVVRTVEAETPSMNPALAAKILQYHFQHGSHVPEA |
| Number of Associated Samples | 196 |
| Number of Associated Scaffolds | 231 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.87 % |
| % of genes near scaffold ends (potentially truncated) | 99.57 % |
| % of genes from short scaffolds (< 2000 bps) | 89.18 % |
| Associated GOLD sequencing projects | 182 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.372 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.255 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.242 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.918 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.95% β-sheet: 12.82% Coil/Unstructured: 69.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 231 Family Scaffolds |
|---|---|---|
| PF01926 | MMR_HSR1 | 31.17 |
| PF00071 | Ras | 3.90 |
| PF13561 | adh_short_C2 | 3.46 |
| PF10662 | PduV-EutP | 3.03 |
| PF00829 | Ribosomal_L21p | 2.60 |
| PF01207 | Dus | 2.16 |
| PF01016 | Ribosomal_L27 | 1.73 |
| PF00027 | cNMP_binding | 1.30 |
| PF01070 | FMN_dh | 1.30 |
| PF14534 | DUF4440 | 0.87 |
| PF01244 | Peptidase_M19 | 0.87 |
| PF00144 | Beta-lactamase | 0.87 |
| PF14520 | HHH_5 | 0.87 |
| PF01548 | DEDD_Tnp_IS110 | 0.43 |
| PF00691 | OmpA | 0.43 |
| PF12762 | DDE_Tnp_IS1595 | 0.43 |
| PF07499 | RuvA_C | 0.43 |
| PF13520 | AA_permease_2 | 0.43 |
| PF12681 | Glyoxalase_2 | 0.43 |
| PF07687 | M20_dimer | 0.43 |
| PF00210 | Ferritin | 0.43 |
| PF02824 | TGS | 0.43 |
| PF01850 | PIN | 0.43 |
| PF00975 | Thioesterase | 0.43 |
| PF06078 | DUF937 | 0.43 |
| PF15780 | ASH | 0.43 |
| PF01609 | DDE_Tnp_1 | 0.43 |
| PF00535 | Glycos_transf_2 | 0.43 |
| PF07704 | PSK_trans_fac | 0.43 |
| PF11937 | DUF3455 | 0.43 |
| PF02538 | Hydantoinase_B | 0.43 |
| PF01112 | Asparaginase_2 | 0.43 |
| PF13474 | SnoaL_3 | 0.43 |
| PF01925 | TauE | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 231 Family Scaffolds |
|---|---|---|---|
| COG0261 | Ribosomal protein L21 | Translation, ribosomal structure and biogenesis [J] | 2.60 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 2.16 |
| COG0211 | Ribosomal protein L27 | Translation, ribosomal structure and biogenesis [J] | 1.73 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 1.30 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 1.30 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.87 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.87 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 0.87 |
| COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 0.43 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.43 |
| COG0632 | Holliday junction resolvasome RuvABC DNA-binding subunit | Replication, recombination and repair [L] | 0.43 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.43 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.43 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
| COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.43 |
| COG4423 | Uncharacterized conserved protein | Function unknown [S] | 0.43 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.43 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.37 % |
| Unclassified | root | N/A | 5.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10337031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300002561|JGI25384J37096_10144573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300003220|JGI26342J46808_1029982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300004080|Ga0062385_10911985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300004080|Ga0062385_11269239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300004082|Ga0062384_100238746 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300004092|Ga0062389_103580605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300004463|Ga0063356_102380405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300004631|Ga0058899_11976986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300005172|Ga0066683_10334713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300005175|Ga0066673_10316632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300005331|Ga0070670_100978291 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005334|Ga0068869_101146742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300005338|Ga0068868_100095911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2395 | Open in IMG/M |
| 3300005338|Ga0068868_100643633 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300005341|Ga0070691_10125072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300005355|Ga0070671_101592442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300005365|Ga0070688_100813666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300005366|Ga0070659_101909782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300005367|Ga0070667_101116700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300005439|Ga0070711_100043124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3053 | Open in IMG/M |
| 3300005439|Ga0070711_100321919 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300005468|Ga0070707_102225512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300005536|Ga0070697_101264828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300005541|Ga0070733_11046075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300005542|Ga0070732_10011173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4938 | Open in IMG/M |
| 3300005602|Ga0070762_10209718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1195 | Open in IMG/M |
| 3300005602|Ga0070762_10313202 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300005712|Ga0070764_10134628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1347 | Open in IMG/M |
| 3300005764|Ga0066903_104280341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 763 | Open in IMG/M |
| 3300005995|Ga0066790_10151213 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300006041|Ga0075023_100529907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 536 | Open in IMG/M |
| 3300006057|Ga0075026_100338445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 831 | Open in IMG/M |
| 3300006059|Ga0075017_100486107 | Not Available | 935 | Open in IMG/M |
| 3300006102|Ga0075015_100364825 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300006102|Ga0075015_100697702 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006174|Ga0075014_101006743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300006794|Ga0066658_10026150 | All Organisms → cellular organisms → Bacteria | 2327 | Open in IMG/M |
| 3300006796|Ga0066665_10655383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300006796|Ga0066665_11644102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300006854|Ga0075425_102989043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300006860|Ga0063829_1237386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300006954|Ga0079219_11719686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300007076|Ga0075435_100663986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300007255|Ga0099791_10436017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300009098|Ga0105245_12948022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300009098|Ga0105245_13045861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300009177|Ga0105248_10858197 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300009520|Ga0116214_1177384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300009520|Ga0116214_1372288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300009521|Ga0116222_1016821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3351 | Open in IMG/M |
| 3300009522|Ga0116218_1567993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300009523|Ga0116221_1186690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 900 | Open in IMG/M |
| 3300009525|Ga0116220_10063736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1543 | Open in IMG/M |
| 3300009628|Ga0116125_1103825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300009665|Ga0116135_1078968 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300009683|Ga0116224_10556732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300009698|Ga0116216_10409884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300010043|Ga0126380_10050814 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
| 3300010303|Ga0134082_10075973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
| 3300010325|Ga0134064_10402548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300010360|Ga0126372_12553292 | Not Available | 562 | Open in IMG/M |
| 3300010361|Ga0126378_10779625 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300010366|Ga0126379_11405360 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300010371|Ga0134125_10375360 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300010373|Ga0134128_10770767 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300010376|Ga0126381_100133252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3237 | Open in IMG/M |
| 3300010376|Ga0126381_101972671 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300010379|Ga0136449_101395854 | Not Available | 1082 | Open in IMG/M |
| 3300010396|Ga0134126_10601661 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300010397|Ga0134124_11553164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300010398|Ga0126383_11605919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300010399|Ga0134127_13435768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300010399|Ga0134127_13525245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300011071|Ga0138595_1106346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300011120|Ga0150983_11379375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300011269|Ga0137392_10163294 | Not Available | 1805 | Open in IMG/M |
| 3300011269|Ga0137392_10185404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1696 | Open in IMG/M |
| 3300011270|Ga0137391_10351638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
| 3300011444|Ga0137463_1108624 | Not Available | 1044 | Open in IMG/M |
| 3300012203|Ga0137399_11161778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300012203|Ga0137399_11386607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300012206|Ga0137380_11371333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300012208|Ga0137376_11258706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300012211|Ga0137377_11045096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300012357|Ga0137384_10512699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300012363|Ga0137390_10155510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2273 | Open in IMG/M |
| 3300012363|Ga0137390_11266440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300012685|Ga0137397_11226215 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012917|Ga0137395_10851605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300012918|Ga0137396_11191356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300012929|Ga0137404_10052328 | All Organisms → cellular organisms → Bacteria | 3136 | Open in IMG/M |
| 3300012930|Ga0137407_10916394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300012944|Ga0137410_11344991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300012957|Ga0164303_10377410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300012971|Ga0126369_13630622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300012975|Ga0134110_10520655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300013306|Ga0163162_10356694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1595 | Open in IMG/M |
| 3300014169|Ga0181531_10354057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300014497|Ga0182008_10026635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2931 | Open in IMG/M |
| 3300015195|Ga0167658_1109810 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300015245|Ga0137409_11496122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300015264|Ga0137403_11152805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300015373|Ga0132257_104278463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300015374|Ga0132255_100076626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 4465 | Open in IMG/M |
| 3300016294|Ga0182041_10543745 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300017822|Ga0187802_10238512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300017933|Ga0187801_10069204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1304 | Open in IMG/M |
| 3300017942|Ga0187808_10553618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300017975|Ga0187782_10154558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1707 | Open in IMG/M |
| 3300017995|Ga0187816_10048921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1762 | Open in IMG/M |
| 3300017999|Ga0187767_10206275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300017999|Ga0187767_10358155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300018006|Ga0187804_10187246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
| 3300018006|Ga0187804_10315605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300018035|Ga0187875_10612187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300018042|Ga0187871_10246559 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300018042|Ga0187871_10410975 | Not Available | 748 | Open in IMG/M |
| 3300018047|Ga0187859_10022964 | All Organisms → cellular organisms → Bacteria | 3430 | Open in IMG/M |
| 3300020001|Ga0193731_1166860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300020002|Ga0193730_1101912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300020021|Ga0193726_1011809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4664 | Open in IMG/M |
| 3300020579|Ga0210407_10566353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
| 3300020582|Ga0210395_11128243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300020583|Ga0210401_11175260 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300021088|Ga0210404_10565326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300021168|Ga0210406_11029196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300021168|Ga0210406_11125437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300021171|Ga0210405_11118710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300021180|Ga0210396_10383729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300021401|Ga0210393_10524906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300021402|Ga0210385_11499276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300021407|Ga0210383_10175658 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300021407|Ga0210383_10353098 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300021407|Ga0210383_10701679 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300021420|Ga0210394_10924131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300021432|Ga0210384_10211520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1744 | Open in IMG/M |
| 3300021432|Ga0210384_10528807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300021478|Ga0210402_11027325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300021478|Ga0210402_11552216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300021479|Ga0210410_11163520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300021559|Ga0210409_10351361 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300021559|Ga0210409_11493987 | Not Available | 551 | Open in IMG/M |
| 3300022714|Ga0242671_1121316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300022726|Ga0242654_10215127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 674 | Open in IMG/M |
| 3300023019|Ga0224560_105860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300024271|Ga0224564_1093075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300024271|Ga0224564_1102876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300025612|Ga0208691_1047043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300025914|Ga0207671_11595364 | Not Available | 502 | Open in IMG/M |
| 3300025925|Ga0207650_10092281 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
| 3300025931|Ga0207644_10371593 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300025931|Ga0207644_11433455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300025938|Ga0207704_11416987 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300025939|Ga0207665_10222416 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300025942|Ga0207689_11346371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300025960|Ga0207651_11445358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300026035|Ga0207703_11339327 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300026078|Ga0207702_11839345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300026298|Ga0209236_1257171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300026314|Ga0209268_1090736 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300026314|Ga0209268_1127069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300026318|Ga0209471_1075224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1501 | Open in IMG/M |
| 3300026325|Ga0209152_10014035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2759 | Open in IMG/M |
| 3300026480|Ga0257177_1041403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300026529|Ga0209806_1151514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300026532|Ga0209160_1104106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1431 | Open in IMG/M |
| 3300026538|Ga0209056_10196645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1481 | Open in IMG/M |
| 3300026547|Ga0209156_10488388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300026548|Ga0209161_10191962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
| 3300026550|Ga0209474_10173178 | Not Available | 1393 | Open in IMG/M |
| 3300026551|Ga0209648_10523081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300027370|Ga0209010_1045278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300027570|Ga0208043_1101240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300027648|Ga0209420_1098371 | Not Available | 833 | Open in IMG/M |
| 3300027676|Ga0209333_1100717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300027701|Ga0209447_10143647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300027737|Ga0209038_10262809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300027824|Ga0209040_10289069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300027846|Ga0209180_10018334 | All Organisms → cellular organisms → Bacteria | 3685 | Open in IMG/M |
| 3300027855|Ga0209693_10063955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1812 | Open in IMG/M |
| 3300027862|Ga0209701_10627675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300027905|Ga0209415_10339508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1260 | Open in IMG/M |
| 3300028047|Ga0209526_10535581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300028379|Ga0268266_10763061 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300028381|Ga0268264_10079431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2799 | Open in IMG/M |
| 3300028777|Ga0302290_10204183 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300028808|Ga0302228_10476387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300028909|Ga0302200_10170959 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300029923|Ga0311347_10339880 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300029951|Ga0311371_10347425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2054 | Open in IMG/M |
| 3300029995|Ga0302210_10071043 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300030503|Ga0311370_10074605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4887 | Open in IMG/M |
| 3300030519|Ga0302193_10342863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300030739|Ga0302311_10911447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300030740|Ga0265460_12452970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300030762|Ga0265775_115320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300030888|Ga0265769_120181 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300030940|Ga0265740_1038640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300031231|Ga0170824_112185007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300031525|Ga0302326_10350949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2320 | Open in IMG/M |
| 3300031708|Ga0310686_106880329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3032 | Open in IMG/M |
| 3300031708|Ga0310686_107496354 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
| 3300031708|Ga0310686_111577285 | Not Available | 1210 | Open in IMG/M |
| 3300031708|Ga0310686_116468767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1183 | Open in IMG/M |
| 3300031715|Ga0307476_10062319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2567 | Open in IMG/M |
| 3300031715|Ga0307476_10334628 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300031720|Ga0307469_10347784 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300031720|Ga0307469_10546307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1025 | Open in IMG/M |
| 3300031726|Ga0302321_101858524 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031754|Ga0307475_10018218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4873 | Open in IMG/M |
| 3300031754|Ga0307475_10745448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300031754|Ga0307475_11288470 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031820|Ga0307473_10626040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300031823|Ga0307478_10756086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300031823|Ga0307478_10885528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300031823|Ga0307478_11009051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300031823|Ga0307478_11604757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300031996|Ga0308176_10271973 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300032042|Ga0318545_10133723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 878 | Open in IMG/M |
| 3300032160|Ga0311301_10755537 | Not Available | 1349 | Open in IMG/M |
| 3300032163|Ga0315281_10808589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 966 | Open in IMG/M |
| 3300032174|Ga0307470_10029743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2584 | Open in IMG/M |
| 3300032180|Ga0307471_102624540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300032205|Ga0307472_100177119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1593 | Open in IMG/M |
| 3300032783|Ga0335079_12073162 | Not Available | 546 | Open in IMG/M |
| 3300032828|Ga0335080_11530168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300032892|Ga0335081_11983874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300032897|Ga0335071_11604362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300033004|Ga0335084_12092006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300033412|Ga0310810_10629723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.49% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.49% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.06% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.16% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.16% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.73% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.73% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.30% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.30% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.43% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.43% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.43% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.43% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003220 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006860 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011071 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028777 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029995 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_103370312 | 3300001867 | Forest Soil | AEVVCRGEVVRTVQSEEASVSPALAAKILQYHFQHGAHLVEA* |
| JGI25384J37096_101445731 | 3300002561 | Grasslands Soil | NLVLPAEIAGLSAAEVVCRGEIVRAMQPEQPTMNPAVAAKILQYHFQHGQIPEA* |
| JGI26342J46808_10299822 | 3300003220 | Bog Forest Soil | NLVLPAEIAGLSAAEVVCRGEVVRTLEPETPSMNPALAAKILQYHFQHGSHMPEA* |
| Ga0062385_109119851 | 3300004080 | Bog Forest Soil | GLSAAEVVCRGEVVRTLEPETPSMNPALAAKILQYHFQHGSHMPEA* |
| Ga0062385_112692392 | 3300004080 | Bog Forest Soil | VCKGEVVRTIAANGEKMPPALAAKILQYHFQHGSQLPRA* |
| Ga0062384_1002387462 | 3300004082 | Bog Forest Soil | GLSPTEVICKGEVVRTVESNGEKMPPALAAKILQYHFQHGSQLPRA* |
| Ga0062389_1035806051 | 3300004092 | Bog Forest Soil | GLSAAEVVCRGEVVRTVEAETPSMNPALAAKILQYHFQHGSHMAEA* |
| Ga0063356_1023804053 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ISIVLPVEIAGLSAAEVVCRGEVVRALEPKQPRMSPALAAKILQYHFQHGSQQPQG* |
| Ga0058899_119769862 | 3300004631 | Forest Soil | NLVLPAEIAGLSAAEVVCRGEVVRTMEAETPSMNPALAAKILQYHFQHGSHVPEA* |
| Ga0066683_103347132 | 3300005172 | Soil | LVLPAEIAGLSAAEVVCRGEVVRMVEAESSKVSPALAAKILQYHFQHGSHVPEA* |
| Ga0066673_103166321 | 3300005175 | Soil | EIAGLSAAEVVCRGEVVRMVEAESSKVSPALAAKILQYHFQHGSHVPEA* |
| Ga0070670_1009782912 | 3300005331 | Switchgrass Rhizosphere | TEVVCRGEVVRSVETGASVNPALAAKILQYHFQHGSRMSQA* |
| Ga0068869_1011467422 | 3300005334 | Miscanthus Rhizosphere | LPAEIAGLSTAEVICRGEVVRTLESEAPTLAAKILQYHFQHNERIPA* |
| Ga0068868_1000959113 | 3300005338 | Miscanthus Rhizosphere | VLPAEIAGLAAAEVVCRGEVVRAVTTEAGTVSPTLAAKILQYHFQHGSHLSQA* |
| Ga0068868_1006436332 | 3300005338 | Miscanthus Rhizosphere | AAEVVCRGEVVRTARSEGETVSPTLAAKILQYHFQHGSHLSQA* |
| Ga0070691_101250723 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | NLVLPAEIAGLAAAEVVCRGEVVRAVTTEAGTVSPTLAAKILQYHFQHGSHLSQA* |
| Ga0070671_1015924421 | 3300005355 | Switchgrass Rhizosphere | INLVLPAEIAGLASAEVVCRGEVVRMVDESSSKVHPALAAKILQYHFQHGSRSAEA* |
| Ga0070688_1008136662 | 3300005365 | Switchgrass Rhizosphere | LVLPAEIAGLTSAEVVCRGEVVRTVEGDKQAVHPALAAKIIQYHFQHGSNAAQA* |
| Ga0070659_1019097821 | 3300005366 | Corn Rhizosphere | IAGLSAAEVICRGEIVRTVRPENAQIQPALAAKILQYHFQHGNQIPQA* |
| Ga0070667_1011167002 | 3300005367 | Switchgrass Rhizosphere | SAEVVCRGEVVRTVEGDKQAVHPALAAKIIQYHFQHGSNAAQA* |
| Ga0070711_1000431246 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SPTEVVCRGEVVRSVEGEGATTTPALAAKILQYHFQHGSRVSEA* |
| Ga0070711_1003219191 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EVVCRGEVVRMIDPESGTVSPTLAAKILQYHFQHGSLLSEA* |
| Ga0070707_1022255121 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AEIAGLSAAEVVCRGEVVRALKSDPMHPALAAKILQYRFQHGSQMHEA* |
| Ga0070697_1012648281 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ICRGEVVRSLEPDAPSVGPALAAKILQYHFQHGSHVPQA* |
| Ga0070733_110460751 | 3300005541 | Surface Soil | CRGEVVRTMEAEAPSMNPALAAKILQYHFQHGAHVPEA* |
| Ga0070732_100111731 | 3300005542 | Surface Soil | PTEVVCRGEVVRSVETEGAATSPALAAKILQYHFQHGSRLSEA* |
| Ga0070762_102097183 | 3300005602 | Soil | LPAEIAGLSAAEVVCRGEVVRTVEAETPSMNPALAAKILQYHLQHGSRMAEV* |
| Ga0070762_103132021 | 3300005602 | Soil | TEVVCKGEVVRTIASNGEKMPPALAAKILQYHFQHGSQLPRA* |
| Ga0070764_101346281 | 3300005712 | Soil | AEIAGLSAAEVVCRGEVVRTVEAETPSMNPALAAKILQYHFQHGSHVPEA* |
| Ga0066903_1042803411 | 3300005764 | Tropical Forest Soil | PAEIAGLSPTEVVCRGEVVRSVAGEGSVTSPELAAKILQYHFQHGSRVTEA* |
| Ga0066790_101512131 | 3300005995 | Soil | AGLSAAEVVCRGEVVRTVEAETPSMNPALAAKILQYHFQHGSHAGQA* |
| Ga0075023_1005299072 | 3300006041 | Watersheds | LVLPAEIAGLSAAEVVCRGEVVRSVEAETPSMNPALAAKILQYHFQHGSHVPEA* |
| Ga0075026_1003384452 | 3300006057 | Watersheds | AEIAGLAAAEVVCRGEVVRTIETESGTVSPTLAAKILQYHFQHGSHLSEA* |
| Ga0075017_1004861072 | 3300006059 | Watersheds | IVRTVDSESGDVSPTLAAKILQYHFQHGSQLSQA* |
| Ga0075015_1003648251 | 3300006102 | Watersheds | AGLAAAEVVCRGEVVRTIDPESGTVNPTLAAKILQYHFQHGSLMSEA* |
| Ga0075015_1006977021 | 3300006102 | Watersheds | EVVCRGEVVRSIGPQGTALTPALAAKILQYHFQHGSHVPEA* |
| Ga0075014_1010067432 | 3300006174 | Watersheds | VCRGEVVRSVDSEGASTSPALAAKILQYHFQHGSRVSEA* |
| Ga0066658_100261502 | 3300006794 | Soil | GEVVRSVSAEGTETSPSLAAKILQYHFQHGSRVSEA* |
| Ga0066665_106553831 | 3300006796 | Soil | NLVLPAEIAGLSAAEVVCRGEVVRMVEAESSKVSPALAAKILQYHFQHGSHVPEA* |
| Ga0066665_116441022 | 3300006796 | Soil | CRGEIVRTIDRESGKVSPTLAAKILQYHFQHGSRMSEA* |
| Ga0075425_1029890431 | 3300006854 | Populus Rhizosphere | LPAEIAGLASAEVICRGEVVRAMEPEQPSVSPALAAKILQYHFQHGSHIPEA* |
| Ga0063829_12373862 | 3300006860 | Peatlands Soil | RGEVVRTVEAETPSMNPALAAKILQYHFQHGSRVPEA* |
| Ga0079219_117196861 | 3300006954 | Agricultural Soil | IAGLAATEVVCRGEVVRSIDAPGANVSPALAAKILQYHFQHGSRVSQA* |
| Ga0075435_1006639862 | 3300007076 | Populus Rhizosphere | VVRTVEAESSKLNPALAAKILQYHFQHGSHVPEA* |
| Ga0099791_104360172 | 3300007255 | Vadose Zone Soil | CRGEVVRTIDPQSGKVSPTLAAKILQYHFQHGSRISEA* |
| Ga0105245_129480221 | 3300009098 | Miscanthus Rhizosphere | RGEVVRSVETGASVNPALAAKILQYHFQHGSRMSQA* |
| Ga0105245_130458611 | 3300009098 | Miscanthus Rhizosphere | IAGLAAAEVVCRGEVVRAVTTEAGTVSPTLAAKILQYHFQHGSHLSQA* |
| Ga0105248_108581972 | 3300009177 | Switchgrass Rhizosphere | LPAEIAGLSAAEVVCRGEVVRMIDPESGTVSPTLAAKILQYHFQHGSLLSEA* |
| Ga0116214_11773842 | 3300009520 | Peatlands Soil | LPAEIAGLSAAEVVCRGEVVRTIEAETPSMNPALAAKILQYHFQHGSHMAEA* |
| Ga0116214_13722881 | 3300009520 | Peatlands Soil | AAEVVCRGQIVRTLEPGQDANSPALAAKILQYRFQHGSSQAAHA* |
| Ga0116222_10168211 | 3300009521 | Peatlands Soil | SAAEVVCRGEVVRTIEAETPSMNPALAAKILQYHFQHGSHMAEA* |
| Ga0116218_15679931 | 3300009522 | Peatlands Soil | IAGLSPTEVVCKGEVVRTIESNGDKMPPALAAKILQYHFQHGSQLPRA* |
| Ga0116221_11866901 | 3300009523 | Peatlands Soil | EVVCRGEVVRSLKPGASTTTTALAAKILQYRFQHGSQIARA* |
| Ga0116220_100637363 | 3300009525 | Peatlands Soil | LVLPAEIAGLSAAEVVCRGEVVRTVEAETPSMNPALAAKILQYHFQHGSHMAEA* |
| Ga0116125_11038251 | 3300009628 | Peatland | VLPAEIAGLAAAEVVCRGEVVRTVQSESSTMGPALAAKILQYHFQHGSQMPEA* |
| Ga0116135_10789681 | 3300009665 | Peatland | IAGLAATEVICRGELVRSVEAHGQSVNPALAAKILQYHFQHGSYVGEA* |
| Ga0116224_105567321 | 3300009683 | Peatlands Soil | EVVCKGEVVRTIESNGDKMPPALAAKILQYHFQHGSQLPRA* |
| Ga0116216_104098841 | 3300009698 | Peatlands Soil | PAEIAGLSPTEVVCKGEVVRTIESNGDKMPPALAAKILQYHFQHGSQLPRA* |
| Ga0126380_100508141 | 3300010043 | Tropical Forest Soil | VVCRGEVVRAVDSPEGASTSPALAAKILQYHFQHGSRVPEA* |
| Ga0134082_100759731 | 3300010303 | Grasslands Soil | GLSAAEVVCRGEVVRMVEAESSKVNPALAAKILQYHFQHGSHVPEA* |
| Ga0134064_104025481 | 3300010325 | Grasslands Soil | NIVLPAEIAGLASAEVVCRGEVVRTVEGDKQAVHPALAAKIIQYHFQHGSNVAQA* |
| Ga0126372_125532921 | 3300010360 | Tropical Forest Soil | EVVRSVESEGATTSPSLAAKILQYHFQHGSRVSEA* |
| Ga0126378_107796251 | 3300010361 | Tropical Forest Soil | IAGLSAAEVVCRGEIVRTVSAEAPAAHPALAAKILQYHFQHGSQMAN* |
| Ga0126379_114053602 | 3300010366 | Tropical Forest Soil | GLSAAEVVCRGEIVRTVSAEAPAAHPALAAKILQYHFQHGSQMAN* |
| Ga0134125_103753601 | 3300010371 | Terrestrial Soil | PAEIAGLSAAEVVWRGEGVRMSDPESGTVSPTLAAKILQYHFQHGSLLSEA* |
| Ga0134128_107707672 | 3300010373 | Terrestrial Soil | GEVVRTVETTGSKVMPALAAKILQYHFQHGSRVSQA* |
| Ga0126381_1001332521 | 3300010376 | Tropical Forest Soil | AEIAGLSATEVVCRGEIVRTVEPESPAFSPALAAKILQYHFQHGSQLPEA* |
| Ga0126381_1019726711 | 3300010376 | Tropical Forest Soil | AEIAGLSAAEVVCRGEIVRTVSAEAPASHPALAAKILQYHFQHGSQMAN* |
| Ga0136449_1013958541 | 3300010379 | Peatlands Soil | VVRTIESNGDKMPPALAAKILQYHFQHGSQLPRA* |
| Ga0134126_106016611 | 3300010396 | Terrestrial Soil | AAEVVCRGEIVRSVQSDSSQVHPALAAKILQYHFQHGSQVAEA* |
| Ga0134124_115531641 | 3300010397 | Terrestrial Soil | EIAGLSAAEVICRGEIVRTVRPENAQIQPALAAKILQYHFQHGNQIPQA* |
| Ga0126383_116059192 | 3300010398 | Tropical Forest Soil | EIAGLSAAEVVCRGEIVRTVSAEAPAAHPALAAKILQYHFQHGAQMAN* |
| Ga0134127_134357681 | 3300010399 | Terrestrial Soil | VLPAEIAGLAAAEVVCSGEVVRTARSEGETVSPTLAAKILQYHFQHGSHLSQA* |
| Ga0134127_135252451 | 3300010399 | Terrestrial Soil | NLVLPAEIAGLSAAEVICRGEIVRTVRPENAQIQPALAAKILQYHFQHGNQIADA* |
| Ga0138595_11063461 | 3300011071 | Peatlands Soil | LVLPAEIAGLSAAEVVCRGEVVRTVEAETPSMNPALAAKILQYHFQHGSRVPEA* |
| Ga0150983_113793752 | 3300011120 | Forest Soil | EIAGLSAAEVVCRGEVVRTMQAEAPSMNPALAAKILQYHFQHGSHMPEA* |
| Ga0137392_101632941 | 3300011269 | Vadose Zone Soil | IVRTVDAPEPAMPPALAAKILQYHFQHGTQVPEA* |
| Ga0137392_101854043 | 3300011269 | Vadose Zone Soil | LSAAEVVCRGEIVRTVEPDSPTVSPALAAKILQYHFQHGSLPQA* |
| Ga0137391_103516381 | 3300011270 | Vadose Zone Soil | LVLPAEIAGLSAAEVVCRGEIVRAMQPEQPTMNPAVAAKILQYHFRHGQIPEA* |
| Ga0137463_11086241 | 3300011444 | Soil | IAGLAAAEVVCRGEVVRTINPESGTVSPTLAAKILQYHFQHGSLLSEA* |
| Ga0137399_111617781 | 3300012203 | Vadose Zone Soil | IAGLSPTEVVCRGEVVRNVQPKGGAVSPALAAKILQYRFQHGSKTAHA* |
| Ga0137399_113866071 | 3300012203 | Vadose Zone Soil | IAGLSAAEVTCRGEIVRTMDAGEPAMSPAMAAKILQYHFQHGTQVPQA* |
| Ga0137380_113713332 | 3300012206 | Vadose Zone Soil | AGLSAAEVVCRGEVVRMVEAESSKVNPALAAKILQYHFQHGSHVPEA* |
| Ga0137376_112587061 | 3300012208 | Vadose Zone Soil | EIAGLSAAEVVCRGEIVRAMQPEQPTMNPAVAAKILQYHFQHGQIPEA* |
| Ga0137377_110450961 | 3300012211 | Vadose Zone Soil | IAGLSAAEVVCRGEVVRMVEAESSKVSPALAAKILQYHFQHGSHVPEA* |
| Ga0137384_105126992 | 3300012357 | Vadose Zone Soil | LPAEIAGLSAAEVVCRGEVVRMVEAESSKVSPALAAKILQYHFQHGSHVPEA* |
| Ga0137390_101555105 | 3300012363 | Vadose Zone Soil | PAEIGGLSAAEVVCRGEVVRALEPEQPTMSPALAAKILQYHFQPGSQQPQG* |
| Ga0137390_112664402 | 3300012363 | Vadose Zone Soil | LAATEVVCRGEVVRSVEASESVSPALAAKILQYHFQHGSRVSQA* |
| Ga0137397_112262152 | 3300012685 | Vadose Zone Soil | VVRTIGAPGSGVSPALAAKILQYHFQHGSHVSQA* |
| Ga0137395_108516051 | 3300012917 | Vadose Zone Soil | ATEVVCRGEVVRSVEAGESVSPALAAKILQYHFQHGSQLPQA* |
| Ga0137396_111913562 | 3300012918 | Vadose Zone Soil | VCRGEVVRTVNRESGTVSATLAAKILQYHFQHGSRLSEA* |
| Ga0137404_100523281 | 3300012929 | Vadose Zone Soil | VVCRGEVVRALEPKQPRMSPALAAKILQYHFQHGSLQPQG* |
| Ga0137407_109163942 | 3300012930 | Vadose Zone Soil | EVVCRGEVVRAVETAGTSTSPALAAKILQYHFQHGSRVSEA* |
| Ga0137410_113449912 | 3300012944 | Vadose Zone Soil | LVLPAEIAGLSPTEVVCRGEVVRAVDLGDSSTSPALAAKILQYHFQHGSRVSEA* |
| Ga0164303_103774102 | 3300012957 | Soil | TEVVCRGEVVRSVEGEGATTTPALAAKILQYHFQHGSRVSEA* |
| Ga0126369_136306222 | 3300012971 | Tropical Forest Soil | EVICRGEVVRAMKPEQPSVSPALAAKILQYHFQHGSHIPEA* |
| Ga0134110_105206551 | 3300012975 | Grasslands Soil | AEIAGLSAAEVMCRGEVVRTVKPESSTVNPALAAKILQYHFQHGSHVPEA* |
| Ga0163162_103566942 | 3300013306 | Switchgrass Rhizosphere | GLASAEVVCRGEVVRMVDESSSKVHPALAAKILQYHFQHGSRSAEA* |
| Ga0181531_103540572 | 3300014169 | Bog | CRGEVVRTMQAETPSMNPALAAKILQYHFQHGSHMPEA* |
| Ga0182008_100266351 | 3300014497 | Rhizosphere | EIAGLSAAEVICRGEIVRTVRPENAQIQPALAAKILQYHFQHGNQIADA* |
| Ga0167658_11098102 | 3300015195 | Glacier Forefield Soil | VLPAEIAGLSATEVVCRGEVVRTVGKGGKGVHPALAAKILQYHFQHGAHTAQA* |
| Ga0137409_114961221 | 3300015245 | Vadose Zone Soil | GLSPTEVVCRGEVVRAVDSVGTSTSPALAAKILQYHFQHGSRVSEA* |
| Ga0137403_111528051 | 3300015264 | Vadose Zone Soil | IAGLAAAEVVCRGEVVRTIDPRSGKVTPVLAAKILQYHFQHGSRLEA* |
| Ga0132257_1042784631 | 3300015373 | Arabidopsis Rhizosphere | TVACLVLPAEIAGLSAAEVVCRGEVVRMIDPESGTVSPTLAAKILQYHFQHGSLLSEA* |
| Ga0132255_1000766265 | 3300015374 | Arabidopsis Rhizosphere | VEIAGLAATEVVCRGEVVRTVETPGSKVTPALAAKILQYHFQHGSRVSQA* |
| Ga0182041_105437451 | 3300016294 | Soil | IAGLSPTEVVCRGEIVRAVEPGDPNVSPALAAKILQYHFQHGAHVPEA |
| Ga0187802_102385121 | 3300017822 | Freshwater Sediment | LSPTEVVCRGQIVRTVKSAGEEMHPALAAKILQYHFQHGSQIPRA |
| Ga0187801_100692041 | 3300017933 | Freshwater Sediment | AEVVCRGEVVRTMEGETPSMNPALAAKILQYHFQHGSHMPEA |
| Ga0187808_105536181 | 3300017942 | Freshwater Sediment | AAAEVVCRGEVVRAMDAETPAMSPALAAKILQYHFHHGSQMGEA |
| Ga0187782_101545581 | 3300017975 | Tropical Peatland | AEVMCRGEVVRTVAAEAPAMSPALAAKILQYRFEHGSKLAEA |
| Ga0187816_100489211 | 3300017995 | Freshwater Sediment | NLVLPAEIAGLSAAEVVCRGEVVRTMEGETPSMNPALAAKILQYHFQHGSHMPEA |
| Ga0187767_102062751 | 3300017999 | Tropical Peatland | INLVLPAEIAGLSSAEVVCRGEVVRTVEGDASTVNPALAAKILQYHFQHGSHVPEA |
| Ga0187767_103581552 | 3300017999 | Tropical Peatland | AEIAGLAATEVVCRGEIVRSIGAEGVQVNPALAAKILQYHFQHGSHIGEA |
| Ga0187804_101872463 | 3300018006 | Freshwater Sediment | VLPAEIAGLSAAEVVCRGEVVRAIEAESPAMSPALAAKIVQYHFQQGAMAAEA |
| Ga0187804_103156052 | 3300018006 | Freshwater Sediment | GEVVRTMEGETPSMNPALAAKILQYHFQHGSHMPEA |
| Ga0187875_106121872 | 3300018035 | Peatland | EVVCRGEVVRTMQAETPSMNPALAAKILQYHFQHGSHMPEA |
| Ga0187871_102465591 | 3300018042 | Peatland | AGLAPAEVVCRGEVVRSVAGETPSMSPALAAKILQYHFHHGGQIPQA |
| Ga0187871_104109751 | 3300018042 | Peatland | INLVLPAEIAGLSAAEVVCRGEVVRTMQAETPSMNPALAAKILQYHFQHGSHMPEA |
| Ga0187859_100229641 | 3300018047 | Peatland | EVVCRGEVVRTLEAESPAMNPALAAKILQYHFQHGAHAAEA |
| Ga0193731_11668601 | 3300020001 | Soil | NLVLPAEIAGLSAAEVVCRGEIVRAMKPEQPTMSPAVAAKILQYHFQHGSQIPEA |
| Ga0193730_11019121 | 3300020002 | Soil | IAGLSTAEVICRGEVVRTLESEAPTLAAKILQYHFQHKERIPA |
| Ga0193726_10118098 | 3300020021 | Soil | EIAGLSAAEVVCRGEVVRSTRSEQSTIGPALAAKIIQYHFQHGSHVPEA |
| Ga0210407_105663531 | 3300020579 | Soil | EIAGLSAAEVVCRGEVVRTVQAETPSMNPALAAKILQYHFQHGSHVPEA |
| Ga0210395_111282431 | 3300020582 | Soil | PAEIAGLSPTEVICRGEIVRTVKSTAEEMPPALAAKILQYHFQHGSQLPRA |
| Ga0210401_111752601 | 3300020583 | Soil | EVVCRGEVVRTIEAEAPSMNPALAAKILQYHFQHGSHMAEA |
| Ga0210404_105653262 | 3300021088 | Soil | GGEVVRSVDLEDGASTSPALAAKILQYHFQHGSRVSEA |
| Ga0210406_110291961 | 3300021168 | Soil | PAEIAGLSAAEVVCRGEVVRTVEAETPSMNPALAAKILQYHFQHGSHMAEA |
| Ga0210406_111254372 | 3300021168 | Soil | PAEIAGLSAAEVVCRGEIVRTVEADSSTVHPALAAKILQYHFQHGSQIPEA |
| Ga0210405_111187101 | 3300021171 | Soil | VLPAEIAGLSPTEVVCRGEVVRTVTEGSEEMPPALAAKILQYRFQHGSQLPRA |
| Ga0210396_103837291 | 3300021180 | Soil | EIAGLSAAEVVCRGEVVRTVQPEAPSMNPALAAKILQYHFQHGSHVPEA |
| Ga0210393_105249063 | 3300021401 | Soil | IAGLASAEVVCRGEVVRSVAGETPSMSPALAAKILQYHFHHGGQMPQA |
| Ga0210385_114992762 | 3300021402 | Soil | LSAAEVVCRGEIVRTSSSDTAAVHPALAAKILQYHFQHTSQMDA |
| Ga0210383_101756583 | 3300021407 | Soil | GLSPTEVVCRGEVVRTVTEGSEEMPPALAAKILQYRFQHGSQLPRA |
| Ga0210383_103530981 | 3300021407 | Soil | GQIVRTVKSAGEEMHPALAAKILQYHFQHGQIPRA |
| Ga0210383_107016793 | 3300021407 | Soil | EVVCRGEVVRTVEAETPSMNPALAAKILQYHFQHGSHMAEA |
| Ga0210394_109241311 | 3300021420 | Soil | LVLPAEIAGLSAAEVVCRGEVVRTVQPEAPSMNPALAAKILQYHFQHGSHVPEA |
| Ga0210384_102115203 | 3300021432 | Soil | EVVCRGEVVRTIDPESGNVSPTLAAKILQYHFQHGSRLSEA |
| Ga0210384_105288071 | 3300021432 | Soil | LVLPAEIAGLSAAEVVCRGEVVRSVEAEAPSMNPALAAKILQYHFQHGSHLAEA |
| Ga0210402_110273251 | 3300021478 | Soil | RGEVVRSVESEGSATSPALAAKILQYHFQHGSRVSEA |
| Ga0210402_115522161 | 3300021478 | Soil | EIAGLSPTEVVCRGEIVRAVEPGDPNVSPALAAKILQYHFQHGSHVPEA |
| Ga0210410_111635202 | 3300021479 | Soil | VVCRGEIVRTVEADSSTVHPALAAKILQYHFQHGSQIPEA |
| Ga0210409_103513612 | 3300021559 | Soil | VVCRGEVVRTIDPESGKVSPTLAAKILQYHFQHGSRLSEA |
| Ga0210409_114939872 | 3300021559 | Soil | AEIAGLSAAEVVCRGEVVRTVKPEQPTMNPALAAKILQYQFQQG |
| Ga0242671_11213161 | 3300022714 | Soil | EIAGLSAAEVVCRGEVVRTMQAEAPSMNPALAAKILQYHFQHGSHMPEA |
| Ga0242654_102151273 | 3300022726 | Soil | WAPAEVVCRGEVVRSVAGETPSMSPALATKILQYHFHHGQIPQA |
| Ga0224560_1058601 | 3300023019 | Soil | GEVVRTIEPLGEEMSPALAAKILQYHFQHGSQLPRA |
| Ga0224564_10930751 | 3300024271 | Soil | LSAAEVVCRGEVVRTMEAETPAMNPALAAKILQYHFQHGSHMPEA |
| Ga0224564_11028762 | 3300024271 | Soil | EIAGLSPTEVVCRGEVVRAVTGTEGEMTPALAAKILQYRFQHGGHLPRA |
| Ga0208691_10470432 | 3300025612 | Peatland | TEVVCRGEVVRTVQPAGEEMPPALAAKILQYHFQHGSQLPQA |
| Ga0207671_115953641 | 3300025914 | Corn Rhizosphere | EVVRIIDAESGKVSPVLAAKILQYHFQHGSRLSEA |
| Ga0207650_100922811 | 3300025925 | Switchgrass Rhizosphere | LAATEVVCRGEVVRSVETGASVNPALAAKILQYHFQHGSRMSQA |
| Ga0207644_103715931 | 3300025931 | Switchgrass Rhizosphere | INLVLPAEIAGLAAAEVVCRGEVVRTARSEGETVSPTLAAKILQYHFQHGSHLSQA |
| Ga0207644_114334551 | 3300025931 | Switchgrass Rhizosphere | INLVLPAEIAGLASAEVVCRGEVVRMVDESSSKVHPALAAKILQYHFQHGSRSAEA |
| Ga0207704_114169871 | 3300025938 | Miscanthus Rhizosphere | GEVVRTARSEGETVSPTLAAKILQYHFQHGSPLSQA |
| Ga0207665_102224161 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | EIAGLAAAEVVCRGDVVRAVEPQQPEVSPALAARILQYHFQHGPHPGNA |
| Ga0207689_113463711 | 3300025942 | Miscanthus Rhizosphere | LPAEIAGLSTAEVICRGEVVRTLESEAPTLAAKILQYHFQHNERIPA |
| Ga0207651_114453581 | 3300025960 | Switchgrass Rhizosphere | TSAEVVCRGEVVRTVEGDKQAVHPALAAKIIQYHFQHGSNAAQA |
| Ga0207703_113393272 | 3300026035 | Switchgrass Rhizosphere | AAEVVCRGEVVRTARSEGETVSPTLAAKILQYHFQHGSHLSQA |
| Ga0207702_118393451 | 3300026078 | Corn Rhizosphere | LVLPAEIAGLAAAEVVCRGEVVRAVTTEAGTVSPTLAAKILQYHFQHGSHLSQA |
| Ga0209236_12571711 | 3300026298 | Grasslands Soil | VLPPEIAGLSQAEVICRGEVVRTVKGDVSPALAAKILQYHFQHGSHVPLA |
| Ga0209268_10907362 | 3300026314 | Soil | EIAGLSAAEVVCRGEVVRMVEAESSKVSPALAAKILQYHFQHGSHVPEA |
| Ga0209268_11270692 | 3300026314 | Soil | LPPEIAGLSQAEVICRGEVVRTVKGDVSPALAAKILQYHFQHGSHVPLA |
| Ga0209471_10752242 | 3300026318 | Soil | AEIAGLSAAEVVCRGEVVRMVEAESSKVSPALAAKILQYHFQHGSHVPEA |
| Ga0209152_100140351 | 3300026325 | Soil | AEIAGLSAAEVVCRGEIVRAMEAENAATNPALAAKILQYHFQHGSPMPEAS |
| Ga0257177_10414032 | 3300026480 | Soil | PTEIAGLSAAEVVCRGEIVRTVEPDSPTVSPALAAKILQYHFQHGSLPQA |
| Ga0209806_11515141 | 3300026529 | Soil | AGLSAAEVVCRGEVVRMVEAESSKVSPALAAKILQYHFQHGSHVPEA |
| Ga0209160_11041061 | 3300026532 | Soil | INLVLPAEIAGLSAAEVVCRGEVVRMVEAESSKVSPALAAKILQYHFQHGSHVPEA |
| Ga0209056_101966453 | 3300026538 | Soil | EVICRGEVVRTVKGDVSPALAAKILQYHFQHGSHVPLA |
| Ga0209156_104883881 | 3300026547 | Soil | VLPAEIAGLSAAEVVCRGEVVRMVEAESSKVSPALAAKILQYHFQHGSHVPEA |
| Ga0209161_101919622 | 3300026548 | Soil | LSAAEVVCRGEVVRMVEAESSKVSPALAAKILQYHFQHGSHVPEA |
| Ga0209474_101731781 | 3300026550 | Soil | GLAAAEVVCRGEVVRTVDSESATVSPTLAAKILQYHFQHGSHISEA |
| Ga0209648_105230812 | 3300026551 | Grasslands Soil | VLPAEIAGLSATEVVCRGEVVRTVERNGDKIPPALAAKILQYHFQHGSQLSRA |
| Ga0209010_10452782 | 3300027370 | Forest Soil | EIAGLSPTEVVCRGQIVRTVQPSGEKMPPALAAKILQYHFQHGSHLPRA |
| Ga0208043_11012401 | 3300027570 | Peatlands Soil | SAAEVVCRGEVVRTIEAETPSMNPALAAKILQYHFQHGSHMAEA |
| Ga0209420_10983712 | 3300027648 | Forest Soil | PAEIAGLSPTEVVCRGQIVRTVKSAGEEMHPALAAKILQYHFQHGQIPRA |
| Ga0209333_11007171 | 3300027676 | Forest Soil | LPAEIAGLSPTEVICRGEIVRTIKPAEEAMPPALAAKILQYHFQHGSQMPRAQA |
| Ga0209447_101436472 | 3300027701 | Bog Forest Soil | AEIAGLSPTEVICKGEVVRTIESNGEKMPPALAAKILQYHFQHGSQLPRA |
| Ga0209038_102628092 | 3300027737 | Bog Forest Soil | PTEVICKGEVVRTIESNGEKMPPALAAKILQYHFQHGSQLPRA |
| Ga0209040_102890692 | 3300027824 | Bog Forest Soil | LSPTEVVCKGEVVRTIASNGEKMPPALAAKILQYHFQHGSQLPRA |
| Ga0209180_100183343 | 3300027846 | Vadose Zone Soil | IAGLSAAEVTCRGEIVRTVDAPEPAMPPALAAKILQYHFQHGTQVPEA |
| Ga0209693_100639553 | 3300027855 | Soil | VVCRGEVVRTVEAETPSMNPALAAKILQYHFQHGSHMAEA |
| Ga0209701_106276752 | 3300027862 | Vadose Zone Soil | GLAATEVVCRGEVVRSVEAGESVSPALAAKILQYHFQHGSQLPQA |
| Ga0209415_103395081 | 3300027905 | Peatlands Soil | LPAEIAGLSAAEVVCRGEVVRTVEAETPSMNPALAAKILQYHFQHGSHMAEA |
| Ga0209526_105355811 | 3300028047 | Forest Soil | LPAEIAGLSPTEVVCRGEVVRTVQPAGEEITPALAAKILQYHFQHGSQLPRA |
| Ga0268266_107630611 | 3300028379 | Switchgrass Rhizosphere | RAHHLAAAEVVCRGEVVRTARSEGETVSPTLAAKILQYHFQHGSHLSQA |
| Ga0268264_100794311 | 3300028381 | Switchgrass Rhizosphere | IAGLPSAEVVCRGEVVRTVEGDKQAVHPALAAKIIQYHFQHGSNAAQA |
| Ga0302290_102041832 | 3300028777 | Fen | CRGEIVRTMGGKSEVSPALAAKIVQYHFQHSMHAGEA |
| Ga0302228_104763872 | 3300028808 | Palsa | AEIAGLSPTEVICRGEVVRTIKPAEEAMPPALAAKILQYHFQHGSQMPRAQA |
| Ga0302200_101709592 | 3300028909 | Bog | VICRGEIVRTVEPNGERLPPALAAKILQYRFQHGSNLPRA |
| Ga0311347_103398801 | 3300029923 | Fen | AEIAGLAATEVVCRGEVVRAIGTPGKGVSPALAAKILQYHFQHGSHLAEA |
| Ga0311371_103474254 | 3300029951 | Palsa | EIAGLSATEVVCRGEIVRTVKPNGEKMPPALAAKILQYHFQHGTHLPRA |
| Ga0302210_100710433 | 3300029995 | Fen | EVICRGEVVRSIEAAGRGVNPALAAKILQYHFQHGSRVSEA |
| Ga0311370_100746051 | 3300030503 | Palsa | CRGEIVRTVKPNGEKMPPALAAKILQYHFQHGTHLPRA |
| Ga0302193_103428632 | 3300030519 | Bog | LSPTEVICRGEIVRTVEPNGERLPPALAAKILQYRFQHGSNLPRA |
| Ga0302311_109114471 | 3300030739 | Palsa | PAEIAGLSPTEVVCRGEVVRTVKPAGDEMPPALAAKILQYHFQHGSQLPRA |
| Ga0265460_124529701 | 3300030740 | Soil | AEIAGLSATEVICRGEVVRTVNSNGEKMPPALAAKILQYHFQHGSQLRRA |
| Ga0265775_1153201 | 3300030762 | Soil | EIAGLSPTEVVCRGEIVRTVGSDGEKMPPALAAKILQYHFQHGSQLPRA |
| Ga0265769_1201812 | 3300030888 | Soil | VLPAEIAGLSATEVVCRGEVVRSVEPNGSTLSPALAARILQYHFQHG |
| Ga0265740_10386402 | 3300030940 | Soil | RGEVVRTIQAETPSMNPALAAKILQYHFQHGSHMAEA |
| Ga0170824_1121850071 | 3300031231 | Forest Soil | LVLPAEIAGLSPTEVVCRGEVVRSVEGEGTTTTPALAAKILQYHFQHGSRVSEA |
| Ga0302326_103509491 | 3300031525 | Palsa | EVVCRGEIVRTVQPVGEEMPPALAAKILQYHFQHGSQLPQA |
| Ga0310686_1068803293 | 3300031708 | Soil | SPTEVVCKGEVVRTVASNGEKMPPALAAKILQYHFQHGSQFPRA |
| Ga0310686_1074963544 | 3300031708 | Soil | VLPAEIAGLSAAEVVCRGEVVRTIQAETPSMNPALAAKILQYHFQHGARAGEA |
| Ga0310686_1115772851 | 3300031708 | Soil | LAAAEVVCRGEVVRTVQSESSTMGPALAAKILQYHFQHGSQMPEA |
| Ga0310686_1164687672 | 3300031708 | Soil | AGLSAAEVVCRGEVVRTLEAESPSMNPALAAKILQYHFQHGSHMPEA |
| Ga0307476_100623194 | 3300031715 | Hardwood Forest Soil | PTEVVCRGEIVRAVESAGEQMPAALAAKILKYRFQHGSQLPRA |
| Ga0307476_103346281 | 3300031715 | Hardwood Forest Soil | VLPAEIAGLSPTEVVCKGEIVRTIESNGEKMPPALAAKILQYHFQHGSQLPRA |
| Ga0307469_103477841 | 3300031720 | Hardwood Forest Soil | PAEIAGLSPTEVVCKGEVVRTVADGEELPPALAAKILQYRFQHGSQLPRA |
| Ga0307469_105463071 | 3300031720 | Hardwood Forest Soil | GLSPTEVVCRGEVVRAVDSPGTSTSPALAAKILQYHFQHGSRVPEA |
| Ga0302321_1018585242 | 3300031726 | Fen | EVVRAIGTPGKGVSPALAAKILQYHCQHGSHLAEA |
| Ga0307475_100182181 | 3300031754 | Hardwood Forest Soil | CRGEVVRSVETEGASTSPALAAKILQYHFQHGSRVSEA |
| Ga0307475_107454482 | 3300031754 | Hardwood Forest Soil | REIAGLSAAEVVCRGEIVRAVEGTEPTMGAAIAAKILQYHFQHGMDIPSA |
| Ga0307475_112884701 | 3300031754 | Hardwood Forest Soil | PAEIAGLSPTEVVCRGEVVRSVDAENTSTSPELAAKILQYHFQHGARVSEA |
| Ga0307473_106260402 | 3300031820 | Hardwood Forest Soil | VCRGEVVRAVDTAGSSTSPALAAKILQYHFQHGSRVSEA |
| Ga0307478_107560862 | 3300031823 | Hardwood Forest Soil | VLPAEIAGLSPTEVVCRGEVVRSVNVEEGASTSPALAAKILQYHFQHGSRVQEA |
| Ga0307478_108855282 | 3300031823 | Hardwood Forest Soil | INLVLPAEIAGLSAAEVVCRGEVVRTMQAETPSMNPALAAKILQYHFQHGSHVPEA |
| Ga0307478_110090511 | 3300031823 | Hardwood Forest Soil | RGEVVRTVQAAGEEMPPALAAKILQYRFQHGTELPQA |
| Ga0307478_116047571 | 3300031823 | Hardwood Forest Soil | AGLSAAEVVCRGEVVRTMEAETPSMNPALAAKILQYHFQHGSHVPEA |
| Ga0308176_102719735 | 3300031996 | Soil | SLVLPAEIAGLASAEVICRGEVVRAMAPEQPWVSPALAAKILQYHFQHGSHVPEA |
| Ga0318545_101337232 | 3300032042 | Soil | AEIAGLSPTEVVCKGEVVRSVESEGATTSPSLAAKILQYHFQHGSRVQEA |
| Ga0311301_107555372 | 3300032160 | Peatlands Soil | TEVVCKGEVVRTIESNGDKMPPALAAKILQYHFQHGSQLPRA |
| Ga0315281_108085892 | 3300032163 | Sediment | LVLPVEIGGLSATEVFCRGEVVRTVQGEEPALHPALAAKILQYHFHHGSHVSEA |
| Ga0307470_100297434 | 3300032174 | Hardwood Forest Soil | VVCRGEVVRSVETEGTTTSPSLAAKILQYHFQHGSRVSEA |
| Ga0307471_1026245401 | 3300032180 | Hardwood Forest Soil | VLPAEIAGLSPTEVVCRGEVVRSVETEGTTTSPSLAAKILQYHFQHGSRVSEA |
| Ga0307472_1001771191 | 3300032205 | Hardwood Forest Soil | CRGEIVRTVEADSSTVHPALAAKILQYHFQHGSQVPEA |
| Ga0335079_120731621 | 3300032783 | Soil | VVCRGEVVRAVKPESMGVNPALAAKIVQYHFQHGSRVGEA |
| Ga0335080_115301681 | 3300032828 | Soil | GLSPTEVVCCGEVVRAVQPGDPTVSPALAAKILQYHFQHGSHVPEA |
| Ga0335081_119838742 | 3300032892 | Soil | PPEIAGLAPAEVICRGEVVRTVVAETPSMHPALAAKILQYHFHHGSQIAEA |
| Ga0335071_116043621 | 3300032897 | Soil | EINLVLPAEIAGLSAAEVVCKGEIVRTVFSDPPALHPALAAKILQYHFQHNAQTDA |
| Ga0335084_120920062 | 3300033004 | Soil | AAEVVCRGEVVRALQPEAPAMHPALAAKILQYRFQHGPHIPEA |
| Ga0310810_106297231 | 3300033412 | Soil | NLVLPAEIAGLSAAEVICRGEIVRTVRPENAQIQPALAAKILQYHFQHGNQIADA |
| ⦗Top⦘ |