| Basic Information | |
|---|---|
| Family ID | F019169 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 231 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MEPAATMSASPVTALERESAELRARRLAAARRRATALLAGVT |
| Number of Associated Samples | 178 |
| Number of Associated Scaffolds | 231 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.89 % |
| % of genes near scaffold ends (potentially truncated) | 99.13 % |
| % of genes from short scaffolds (< 2000 bps) | 93.51 % |
| Associated GOLD sequencing projects | 167 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.009 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.169 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.199 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.394 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.43% β-sheet: 0.00% Coil/Unstructured: 58.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 231 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 9.09 |
| PF08669 | GCV_T_C | 5.19 |
| PF09391 | DUF2000 | 3.90 |
| PF01227 | GTP_cyclohydroI | 2.60 |
| PF00378 | ECH_1 | 2.16 |
| PF04672 | Methyltransf_19 | 2.16 |
| PF00106 | adh_short | 1.73 |
| PF04199 | Cyclase | 1.30 |
| PF10604 | Polyketide_cyc2 | 1.30 |
| PF08378 | NERD | 0.87 |
| PF00311 | PEPcase | 0.87 |
| PF02133 | Transp_cyt_pur | 0.87 |
| PF02780 | Transketolase_C | 0.87 |
| PF08327 | AHSA1 | 0.87 |
| PF02566 | OsmC | 0.87 |
| PF04193 | PQ-loop | 0.43 |
| PF12833 | HTH_18 | 0.43 |
| PF02583 | Trns_repr_metal | 0.43 |
| PF13401 | AAA_22 | 0.43 |
| PF00403 | HMA | 0.43 |
| PF01850 | PIN | 0.43 |
| PF00528 | BPD_transp_1 | 0.43 |
| PF01061 | ABC2_membrane | 0.43 |
| PF13671 | AAA_33 | 0.43 |
| PF13185 | GAF_2 | 0.43 |
| PF03631 | Virul_fac_BrkB | 0.43 |
| PF09859 | Oxygenase-NA | 0.43 |
| PF03704 | BTAD | 0.43 |
| PF11716 | MDMPI_N | 0.43 |
| PF00069 | Pkinase | 0.43 |
| PF01625 | PMSR | 0.43 |
| PF07883 | Cupin_2 | 0.43 |
| PF07730 | HisKA_3 | 0.43 |
| PF12697 | Abhydrolase_6 | 0.43 |
| PF07690 | MFS_1 | 0.43 |
| PF00724 | Oxidored_FMN | 0.43 |
| PF04545 | Sigma70_r4 | 0.43 |
| PF03466 | LysR_substrate | 0.43 |
| PF04343 | DUF488 | 0.43 |
| PF00072 | Response_reg | 0.43 |
| PF02805 | Ada_Zn_binding | 0.43 |
| PF00730 | HhH-GPD | 0.43 |
| PF00196 | GerE | 0.43 |
| PF06224 | HTH_42 | 0.43 |
| PF13561 | adh_short_C2 | 0.43 |
| PF06210 | DUF1003 | 0.43 |
| PF13847 | Methyltransf_31 | 0.43 |
| PF03551 | PadR | 0.43 |
| PF00583 | Acetyltransf_1 | 0.43 |
| PF00772 | DnaB | 0.43 |
| PF00392 | GntR | 0.43 |
| PF01569 | PAP2 | 0.43 |
| PF02775 | TPP_enzyme_C | 0.43 |
| PF00440 | TetR_N | 0.43 |
| PF04542 | Sigma70_r2 | 0.43 |
| PF13180 | PDZ_2 | 0.43 |
| PF01402 | RHH_1 | 0.43 |
| PF09860 | DUF2087 | 0.43 |
| PF02311 | AraC_binding | 0.43 |
| PF00561 | Abhydrolase_1 | 0.43 |
| PF00270 | DEAD | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 231 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.73 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.30 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.87 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.87 |
| COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 0.87 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.43 |
| COG2169 | Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains | Replication, recombination and repair [L] | 0.43 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.43 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.43 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.43 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.43 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.43 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.43 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.43 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.43 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.43 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.43 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.43 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.43 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.43 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.43 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.43 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.43 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.43 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.43 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.43 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.43 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.43 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.43 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.43 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.43 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.43 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.44 % |
| Unclassified | root | N/A | 41.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_81444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 955 | Open in IMG/M |
| 3300000156|NODE_c0234517 | Not Available | 508 | Open in IMG/M |
| 3300001408|JGI20206J14855_1016387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1238 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101148542 | Not Available | 665 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101591175 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300004479|Ga0062595_100168439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1305 | Open in IMG/M |
| 3300004479|Ga0062595_100792658 | Not Available | 779 | Open in IMG/M |
| 3300004633|Ga0066395_10504716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
| 3300004635|Ga0062388_101248713 | Not Available | 738 | Open in IMG/M |
| 3300005332|Ga0066388_102870714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 880 | Open in IMG/M |
| 3300005332|Ga0066388_108130400 | Not Available | 524 | Open in IMG/M |
| 3300005338|Ga0068868_101653431 | Not Available | 602 | Open in IMG/M |
| 3300005434|Ga0070709_10012387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4773 | Open in IMG/M |
| 3300005435|Ga0070714_100856572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 881 | Open in IMG/M |
| 3300005435|Ga0070714_100951039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 835 | Open in IMG/M |
| 3300005467|Ga0070706_100041435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4251 | Open in IMG/M |
| 3300005468|Ga0070707_102305742 | Not Available | 506 | Open in IMG/M |
| 3300005535|Ga0070684_100694199 | Not Available | 949 | Open in IMG/M |
| 3300005538|Ga0070731_10039671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3160 | Open in IMG/M |
| 3300005564|Ga0070664_102042875 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005610|Ga0070763_10509271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300005614|Ga0068856_101595781 | Not Available | 666 | Open in IMG/M |
| 3300005615|Ga0070702_101225651 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005764|Ga0066903_101681022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1208 | Open in IMG/M |
| 3300005764|Ga0066903_103136199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 894 | Open in IMG/M |
| 3300005764|Ga0066903_106031538 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005764|Ga0066903_106486566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300005921|Ga0070766_10955546 | Not Available | 588 | Open in IMG/M |
| 3300006175|Ga0070712_101741311 | Not Available | 545 | Open in IMG/M |
| 3300006804|Ga0079221_10193890 | Not Available | 1107 | Open in IMG/M |
| 3300006893|Ga0073928_10113336 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300006914|Ga0075436_100698753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
| 3300007265|Ga0099794_10306482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 823 | Open in IMG/M |
| 3300009088|Ga0099830_10708642 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300009520|Ga0116214_1304474 | Not Available | 612 | Open in IMG/M |
| 3300009520|Ga0116214_1335626 | Not Available | 583 | Open in IMG/M |
| 3300009520|Ga0116214_1445209 | Not Available | 507 | Open in IMG/M |
| 3300009524|Ga0116225_1070997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1641 | Open in IMG/M |
| 3300009545|Ga0105237_12574580 | Not Available | 519 | Open in IMG/M |
| 3300009839|Ga0116223_10238898 | Not Available | 1099 | Open in IMG/M |
| 3300010048|Ga0126373_10875429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 962 | Open in IMG/M |
| 3300010048|Ga0126373_12208390 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010303|Ga0134082_10365167 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010358|Ga0126370_10204083 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300010360|Ga0126372_10434582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1210 | Open in IMG/M |
| 3300010360|Ga0126372_11191559 | Not Available | 785 | Open in IMG/M |
| 3300010371|Ga0134125_12107198 | Not Available | 613 | Open in IMG/M |
| 3300010373|Ga0134128_12777040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Phytoactinopolyspora → Phytoactinopolyspora limicola | 540 | Open in IMG/M |
| 3300010379|Ga0136449_100778983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1585 | Open in IMG/M |
| 3300010937|Ga0137776_1839466 | Not Available | 550 | Open in IMG/M |
| 3300012096|Ga0137389_10234582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia africana | 1538 | Open in IMG/M |
| 3300012096|Ga0137389_11576748 | Not Available | 553 | Open in IMG/M |
| 3300012199|Ga0137383_10894712 | Not Available | 648 | Open in IMG/M |
| 3300012201|Ga0137365_10537708 | Not Available | 858 | Open in IMG/M |
| 3300012205|Ga0137362_10313371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 1358 | Open in IMG/M |
| 3300012361|Ga0137360_10722789 | Not Available | 855 | Open in IMG/M |
| 3300012929|Ga0137404_10758073 | Not Available | 880 | Open in IMG/M |
| 3300012948|Ga0126375_10256818 | Not Available | 1187 | Open in IMG/M |
| 3300012987|Ga0164307_11697758 | Not Available | 535 | Open in IMG/M |
| 3300013104|Ga0157370_11522968 | Not Available | 601 | Open in IMG/M |
| 3300013306|Ga0163162_11800422 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300014969|Ga0157376_10917134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
| 3300015242|Ga0137412_10650833 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300015264|Ga0137403_10581682 | Not Available | 986 | Open in IMG/M |
| 3300015371|Ga0132258_13686323 | Not Available | 1046 | Open in IMG/M |
| 3300016270|Ga0182036_11233080 | Not Available | 623 | Open in IMG/M |
| 3300016294|Ga0182041_10146988 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300016319|Ga0182033_10662564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
| 3300016319|Ga0182033_11824816 | Not Available | 552 | Open in IMG/M |
| 3300016357|Ga0182032_10199746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1521 | Open in IMG/M |
| 3300016404|Ga0182037_10326348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1242 | Open in IMG/M |
| 3300017821|Ga0187812_1071591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens | 1150 | Open in IMG/M |
| 3300017823|Ga0187818_10252364 | Not Available | 771 | Open in IMG/M |
| 3300017926|Ga0187807_1095349 | Not Available | 934 | Open in IMG/M |
| 3300017926|Ga0187807_1122693 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300017926|Ga0187807_1198730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 649 | Open in IMG/M |
| 3300017928|Ga0187806_1278757 | Not Available | 584 | Open in IMG/M |
| 3300017937|Ga0187809_10080458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1075 | Open in IMG/M |
| 3300017937|Ga0187809_10094801 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300017937|Ga0187809_10128614 | Not Available | 865 | Open in IMG/M |
| 3300017942|Ga0187808_10192972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
| 3300017942|Ga0187808_10365565 | Not Available | 656 | Open in IMG/M |
| 3300017943|Ga0187819_10875090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300017972|Ga0187781_10637518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 769 | Open in IMG/M |
| 3300017972|Ga0187781_11422010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 513 | Open in IMG/M |
| 3300017974|Ga0187777_10943249 | Not Available | 622 | Open in IMG/M |
| 3300018001|Ga0187815_10316931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 661 | Open in IMG/M |
| 3300018058|Ga0187766_10422689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 885 | Open in IMG/M |
| 3300018085|Ga0187772_11436031 | Not Available | 513 | Open in IMG/M |
| 3300020582|Ga0210395_11436182 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300021088|Ga0210404_10875423 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300021180|Ga0210396_11377492 | Not Available | 584 | Open in IMG/M |
| 3300021181|Ga0210388_10759783 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300021404|Ga0210389_11533296 | Not Available | 506 | Open in IMG/M |
| 3300021406|Ga0210386_11027571 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300021407|Ga0210383_10897161 | Not Available | 755 | Open in IMG/M |
| 3300021479|Ga0210410_10462373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1135 | Open in IMG/M |
| 3300021559|Ga0210409_11522680 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Leotiomycetes incertae sedis → Pseudeurotiaceae → Pseudogymnoascus | 545 | Open in IMG/M |
| 3300021560|Ga0126371_11521468 | Not Available | 797 | Open in IMG/M |
| 3300021560|Ga0126371_12784030 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300021861|Ga0213853_10137861 | Not Available | 559 | Open in IMG/M |
| 3300025906|Ga0207699_11446597 | Not Available | 508 | Open in IMG/M |
| 3300025914|Ga0207671_11596460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300025915|Ga0207693_10592296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 863 | Open in IMG/M |
| 3300025921|Ga0207652_11457317 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300025922|Ga0207646_10729800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
| 3300025922|Ga0207646_11024565 | Not Available | 729 | Open in IMG/M |
| 3300025928|Ga0207700_10404830 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300025929|Ga0207664_10153840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1956 | Open in IMG/M |
| 3300025929|Ga0207664_10809343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 843 | Open in IMG/M |
| 3300025929|Ga0207664_10871134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 809 | Open in IMG/M |
| 3300025929|Ga0207664_10880889 | Not Available | 804 | Open in IMG/M |
| 3300026319|Ga0209647_1235625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300026374|Ga0257146_1011443 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300027072|Ga0208238_1010891 | Not Available | 767 | Open in IMG/M |
| 3300027089|Ga0207943_101398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2030 | Open in IMG/M |
| 3300027432|Ga0209421_1065733 | Not Available | 729 | Open in IMG/M |
| 3300027604|Ga0208324_1009481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis taiwanensis | 3207 | Open in IMG/M |
| 3300027765|Ga0209073_10070937 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300027775|Ga0209177_10406468 | Not Available | 547 | Open in IMG/M |
| 3300027783|Ga0209448_10013605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2629 | Open in IMG/M |
| 3300027853|Ga0209274_10550959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300027855|Ga0209693_10508965 | Not Available | 575 | Open in IMG/M |
| 3300027884|Ga0209275_10357511 | Not Available | 819 | Open in IMG/M |
| 3300027908|Ga0209006_10640990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 874 | Open in IMG/M |
| 3300028806|Ga0302221_10140797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1063 | Open in IMG/M |
| 3300028879|Ga0302229_10452825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 568 | Open in IMG/M |
| 3300028906|Ga0308309_10710179 | Not Available | 873 | Open in IMG/M |
| 3300029882|Ga0311368_10602344 | Not Available | 774 | Open in IMG/M |
| 3300029943|Ga0311340_10537241 | Not Available | 1036 | Open in IMG/M |
| 3300029999|Ga0311339_11349067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 644 | Open in IMG/M |
| 3300030520|Ga0311372_12037214 | Not Available | 670 | Open in IMG/M |
| 3300030524|Ga0311357_10462407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1187 | Open in IMG/M |
| 3300030580|Ga0311355_10542102 | Not Available | 1108 | Open in IMG/M |
| 3300030677|Ga0302317_10365714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300030677|Ga0302317_10458191 | Not Available | 558 | Open in IMG/M |
| 3300030730|Ga0307482_1040535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
| 3300031234|Ga0302325_11428668 | Not Available | 897 | Open in IMG/M |
| 3300031525|Ga0302326_10633270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1581 | Open in IMG/M |
| 3300031525|Ga0302326_11098126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1106 | Open in IMG/M |
| 3300031564|Ga0318573_10184802 | Not Available | 1102 | Open in IMG/M |
| 3300031564|Ga0318573_10350791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 792 | Open in IMG/M |
| 3300031564|Ga0318573_10770698 | Not Available | 517 | Open in IMG/M |
| 3300031572|Ga0318515_10326931 | Not Available | 822 | Open in IMG/M |
| 3300031573|Ga0310915_10478648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
| 3300031640|Ga0318555_10640302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300031668|Ga0318542_10335689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300031679|Ga0318561_10342019 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300031708|Ga0310686_102017636 | Not Available | 808 | Open in IMG/M |
| 3300031708|Ga0310686_102670241 | Not Available | 506 | Open in IMG/M |
| 3300031708|Ga0310686_105115575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300031713|Ga0318496_10439310 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300031724|Ga0318500_10302295 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300031744|Ga0306918_10691966 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300031747|Ga0318502_10118909 | Not Available | 1482 | Open in IMG/M |
| 3300031751|Ga0318494_10788442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 557 | Open in IMG/M |
| 3300031765|Ga0318554_10866998 | Not Available | 504 | Open in IMG/M |
| 3300031780|Ga0318508_1205404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300031780|Ga0318508_1215949 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031781|Ga0318547_10606971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Actinacidiphila → Actinacidiphila oryziradicis | 679 | Open in IMG/M |
| 3300031781|Ga0318547_10677627 | Not Available | 641 | Open in IMG/M |
| 3300031782|Ga0318552_10301595 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300031792|Ga0318529_10222624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 877 | Open in IMG/M |
| 3300031793|Ga0318548_10219130 | Not Available | 935 | Open in IMG/M |
| 3300031793|Ga0318548_10279174 | Not Available | 821 | Open in IMG/M |
| 3300031795|Ga0318557_10392474 | Not Available | 638 | Open in IMG/M |
| 3300031796|Ga0318576_10545587 | Not Available | 546 | Open in IMG/M |
| 3300031797|Ga0318550_10325539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
| 3300031797|Ga0318550_10402374 | Not Available | 663 | Open in IMG/M |
| 3300031799|Ga0318565_10018547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens | 3021 | Open in IMG/M |
| 3300031799|Ga0318565_10071595 | Not Available | 1637 | Open in IMG/M |
| 3300031799|Ga0318565_10447974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300031799|Ga0318565_10649550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300031821|Ga0318567_10046648 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300031821|Ga0318567_10151673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1282 | Open in IMG/M |
| 3300031831|Ga0318564_10230537 | Not Available | 823 | Open in IMG/M |
| 3300031833|Ga0310917_10764701 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300031854|Ga0310904_10816360 | Not Available | 654 | Open in IMG/M |
| 3300031860|Ga0318495_10453923 | Not Available | 562 | Open in IMG/M |
| 3300031890|Ga0306925_10517924 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300031890|Ga0306925_11595010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 635 | Open in IMG/M |
| 3300031890|Ga0306925_12230283 | Not Available | 508 | Open in IMG/M |
| 3300031893|Ga0318536_10395399 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031894|Ga0318522_10062137 | Not Available | 1338 | Open in IMG/M |
| 3300031897|Ga0318520_10657346 | Not Available | 653 | Open in IMG/M |
| 3300031897|Ga0318520_10697202 | Not Available | 634 | Open in IMG/M |
| 3300031897|Ga0318520_10729373 | Not Available | 620 | Open in IMG/M |
| 3300031897|Ga0318520_10733225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300031910|Ga0306923_10982176 | Not Available | 919 | Open in IMG/M |
| 3300031941|Ga0310912_11289490 | Not Available | 554 | Open in IMG/M |
| 3300031941|Ga0310912_11477997 | Not Available | 512 | Open in IMG/M |
| 3300031947|Ga0310909_11212795 | Not Available | 610 | Open in IMG/M |
| 3300031954|Ga0306926_10480564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1529 | Open in IMG/M |
| 3300031954|Ga0306926_11149091 | Not Available | 915 | Open in IMG/M |
| 3300031954|Ga0306926_12305335 | Not Available | 596 | Open in IMG/M |
| 3300031962|Ga0307479_10379836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1397 | Open in IMG/M |
| 3300032008|Ga0318562_10383900 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300032008|Ga0318562_10888831 | Not Available | 508 | Open in IMG/M |
| 3300032009|Ga0318563_10081669 | Not Available | 1690 | Open in IMG/M |
| 3300032009|Ga0318563_10244762 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300032041|Ga0318549_10387538 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300032041|Ga0318549_10496498 | Not Available | 549 | Open in IMG/M |
| 3300032042|Ga0318545_10238438 | Not Available | 653 | Open in IMG/M |
| 3300032043|Ga0318556_10147647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1212 | Open in IMG/M |
| 3300032043|Ga0318556_10225613 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300032044|Ga0318558_10217068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 936 | Open in IMG/M |
| 3300032054|Ga0318570_10009090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3386 | Open in IMG/M |
| 3300032055|Ga0318575_10172278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1081 | Open in IMG/M |
| 3300032064|Ga0318510_10255978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
| 3300032065|Ga0318513_10313863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 762 | Open in IMG/M |
| 3300032067|Ga0318524_10128129 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300032068|Ga0318553_10297256 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300032074|Ga0308173_10994826 | Not Available | 779 | Open in IMG/M |
| 3300032076|Ga0306924_11078196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 877 | Open in IMG/M |
| 3300032076|Ga0306924_11642380 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300032090|Ga0318518_10043932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2101 | Open in IMG/M |
| 3300032090|Ga0318518_10398916 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300032091|Ga0318577_10158832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1077 | Open in IMG/M |
| 3300032160|Ga0311301_10109670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5307 | Open in IMG/M |
| 3300032261|Ga0306920_100212299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 2888 | Open in IMG/M |
| 3300032770|Ga0335085_12138494 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300032782|Ga0335082_10592581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 970 | Open in IMG/M |
| 3300032805|Ga0335078_11745485 | Not Available | 680 | Open in IMG/M |
| 3300032805|Ga0335078_12600558 | Not Available | 519 | Open in IMG/M |
| 3300032893|Ga0335069_11755405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300032895|Ga0335074_10270189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1977 | Open in IMG/M |
| 3300033158|Ga0335077_11194909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 745 | Open in IMG/M |
| 3300034124|Ga0370483_0258813 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300034199|Ga0370514_107250 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.63% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.46% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.30% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.87% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.87% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.43% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.43% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.43% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300001408 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300027072 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027089 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_01170000 | 2199352025 | Soil | MEPATATPASPVRTLQRESPALRARRLAAARRRATALLVGAT |
| NODE_02345172 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MEPTATITGTPATSLEPESAAVRARQLAAARRRATALLAGVTVLFVAVTA |
| JGI20206J14855_10163872 | 3300001408 | Arctic Peat Soil | MEPTAPMPASPVPAPGHESAAQRARGLAAARRRATALLAGVTVLFVAV |
| JGIcombinedJ26739_1011485421 | 3300002245 | Forest Soil | MEPAAPTSTSPASTIKRESVELRTRRLAAARRRATALLG |
| JGIcombinedJ26739_1015911752 | 3300002245 | Forest Soil | MEPAATTPASAAPAIKRESLELRTRRLAAARRRATALLAAVT |
| Ga0062595_1001684391 | 3300004479 | Soil | MTRGYRVEPARTVSASPVPGLAREPIEVRARRLVAARRRATALLAGMT |
| Ga0062595_1007926582 | 3300004479 | Soil | MEPATAMSPSPVPAIERESAALRARRLAAARRRATALLVGVTALFVAVTVA |
| Ga0066395_105047162 | 3300004633 | Tropical Forest Soil | MEPTETMSAPPVPALRRESVALRTRRLTVARRRATALLAA |
| Ga0062388_1012487132 | 3300004635 | Bog Forest Soil | MEPTAATPAAPMRTVERESLALRTRRLAAARRRATAVLAGVTILFIAVTV |
| Ga0066388_1028707141 | 3300005332 | Tropical Forest Soil | MEPTATIAATPATSLEPESTAVRARQLAAARRRATALLAGVTVLFVAVT |
| Ga0066388_1081304002 | 3300005332 | Tropical Forest Soil | MEPTETMSAPPVPALRHESVALRARRLTVVRRRATALLAAVTALFIAVTAVGV |
| Ga0068868_1016534312 | 3300005338 | Miscanthus Rhizosphere | MEPTATMSASPAFRAEPESAEVRARQLAAARRRATALLGAVTVLFVAVT |
| Ga0070709_100123871 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPAETISASPVPPLGHEPVALRVRRLAAARRRATALLAAVTAL |
| Ga0070714_1008565723 | 3300005435 | Agricultural Soil | MEPAVPTPAGRVAAPEHEPVELRVRRLAAARRRATALLAAVTALFVAVT |
| Ga0070714_1009510391 | 3300005435 | Agricultural Soil | MTTAVTTPAPGRESPELRVRRLVAARRRATALLAAVTVLFLVV |
| Ga0070706_1000414351 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPAATMSASPVSGLGREPRDVRVRRLAAARRRATALLAGVAVVFVAVTVAGVHGTL |
| Ga0070707_1023057422 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPSPGPGHEPVELRARRLAAARRRATALLAGVTAVFVAVTVAGVHGMF |
| Ga0070684_1006941992 | 3300005535 | Corn Rhizosphere | MEPAVPTSTSLVAATEHEPVELRVRRLAAARRRATALLAAVTALFVAVTA |
| Ga0070731_100396711 | 3300005538 | Surface Soil | MEPIATMPASPLRPHEHESVEERTRRLAAARLRATALLA |
| Ga0070733_102956411 | 3300005541 | Surface Soil | MEPTTTMPASPVRATEHESVEERTRRLAAARLRATALLA |
| Ga0070664_1020428752 | 3300005564 | Corn Rhizosphere | MEPAASAAPVPRVKRESLEARKRRLVVARRRATALLGAVTVLFI |
| Ga0070763_105092712 | 3300005610 | Soil | MEPAATMPGSPAPALEREPAELRARRLAAARRRATGLLVAVTAVFVVVTAFGAHGTLLGFVQ |
| Ga0068856_1015957811 | 3300005614 | Corn Rhizosphere | MEPTATMSASPALRAEPESAEVRARQLAAARRRAT |
| Ga0070702_1012256512 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPATAIPASPVPTIQRESTALRKRRLAAARRRATALLVGATALFVGVTA |
| Ga0066903_1016810221 | 3300005764 | Tropical Forest Soil | MEPTETMSAPPVPALRRESVALRARRLAAARRRAT |
| Ga0066903_1031361991 | 3300005764 | Tropical Forest Soil | MEPTATITATPATSLEPESAAVRARQLAAARRRAT |
| Ga0066903_1060315381 | 3300005764 | Tropical Forest Soil | MEPTATITATPATSLEPESAAVRARQLAAARRRATAL |
| Ga0066903_1064865661 | 3300005764 | Tropical Forest Soil | MEPATAASASPVSTLQREPTALRARRLAAARRRAT |
| Ga0070766_109555461 | 3300005921 | Soil | MEPAVTVPASPVAAPGHESPELRARRPAAARRRATALLAGVTAV |
| Ga0070712_1017413113 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASPAFTAEPESAEVRVRQLAAARRRATALLGAVTVLFV |
| Ga0079221_101938902 | 3300006804 | Agricultural Soil | MEPAVPTPAGRVAASEYEPVELRVRRLAAARRRATALLAAVTALFVAV |
| Ga0073928_101133364 | 3300006893 | Iron-Sulfur Acid Spring | MGPAAAMYASPVPTLEHETAQVRARRLRAARHRATALLAAVTVLFVAVTVAGA |
| Ga0075436_1006987532 | 3300006914 | Populus Rhizosphere | MEPAATTSASPAYKLKRESLELRTRRLAAARRRATAL |
| Ga0099794_103064821 | 3300007265 | Vadose Zone Soil | MEPAATTPASAVPGVKRESLETRTRRLAAARRRATALLAAVTALFVAVT |
| Ga0102924_11624923 | 3300007982 | Iron-Sulfur Acid Spring | MEPTTAMPASPASTLDRESIAERRRRLAAARLRATA |
| Ga0099830_107086421 | 3300009088 | Vadose Zone Soil | MEPAASMPASPVSGLGREPADVRVRRLAAARRRATALLAGV |
| Ga0116214_13044742 | 3300009520 | Peatlands Soil | MEPTATMPAAPVSRLERESVAERTRLLAAARRRATALLAGVTVLFLAVTAAGV |
| Ga0116214_13356262 | 3300009520 | Peatlands Soil | MSASPVSALEREPVEVRARRLAAARRRATALLAGVTVLF |
| Ga0116214_14452091 | 3300009520 | Peatlands Soil | MEPTATMSAPPAPTLEREPAAVRARRLAAARRRATALLAGVTVL |
| Ga0116225_10709972 | 3300009524 | Peatlands Soil | MSAPPASTLEREPAAVRARRLAAARRRATALLAGVTVLFVAVTAVGV |
| Ga0105237_125745801 | 3300009545 | Corn Rhizosphere | MEPTATMSASPAFRAEPESAEVRARQLAAARRRATALLGAVTVLFVAVTVA |
| Ga0116223_102388984 | 3300009839 | Peatlands Soil | MEPTATMSASPVSALEREPVEVRARRLAAARRRATALLAGV |
| Ga0126373_108754291 | 3300010048 | Tropical Forest Soil | MEPATAMSASPVPTLQRESTAARARRLAAARRRATALLVGV |
| Ga0126373_122083902 | 3300010048 | Tropical Forest Soil | VTARPASPALKRESAEYRARRLASARRRATALLGVVTVLFIVVTA |
| Ga0134082_103651672 | 3300010303 | Grasslands Soil | MEPAETMSASPVPAPGHEPVALRARRLAAARRRATALLAAVTALFVAV |
| Ga0126370_102040831 | 3300010358 | Tropical Forest Soil | MEPAATASASPVSALGRESTELRVRRLAAARRRATAL |
| Ga0126372_104345821 | 3300010360 | Tropical Forest Soil | MESAETTSAPPVPALRRESVALRTRRLAAARRRAAALLVAVTALFVAVSAVG |
| Ga0126372_111915591 | 3300010360 | Tropical Forest Soil | MEPAETMTASPTTALGRESVAVRARRLAAARRRATALLAA |
| Ga0134125_121071981 | 3300010371 | Terrestrial Soil | MEPAATMSASPAFRAEPESAEVRARQLAAARRRATA |
| Ga0134128_127770402 | 3300010373 | Terrestrial Soil | MEPATAMPASPVPTIQRESTALRKRRLAAARRRATALLVGA |
| Ga0136449_1007789831 | 3300010379 | Peatlands Soil | MSESPVSTLEREPAAVRARRLAAARRRATALLAGVTVL |
| Ga0137776_18394661 | 3300010937 | Sediment | MEPTATMAAAPVSKLERESLELRTRRLAAARRRATALLGA |
| Ga0137389_102345821 | 3300012096 | Vadose Zone Soil | MEPTAPMSASPVPAPGHESAAERARDLAAARRRATALLAGVTVLFIAVT |
| Ga0137389_115767481 | 3300012096 | Vadose Zone Soil | MEPAATMSASPVSTLGRESAEVRARRLAAARRRATALLAGVTVVFVAV |
| Ga0137383_108947122 | 3300012199 | Vadose Zone Soil | MEPTETMSAPPVPALKPESAALRARRLAAARRRATALLA |
| Ga0137365_105377081 | 3300012201 | Vadose Zone Soil | MEPAATMSASPVSTLGRESAELRARRLAAARRRATALLAGVTVM |
| Ga0137362_103133711 | 3300012205 | Vadose Zone Soil | MSASPGPTLEREPAAVRARSLAAARRRATAVLAGVTVLFVAVTAVG |
| Ga0137360_107227891 | 3300012361 | Vadose Zone Soil | MEPAATMSASPTSTLGRESAEVRARRVAAARRRATGLLAG |
| Ga0137404_107580731 | 3300012929 | Vadose Zone Soil | MEPTAPLSASPVPAPGHEPAAQRARGLAAARRRATALLAGVTVLFVAVTVVGA |
| Ga0126375_102568181 | 3300012948 | Tropical Forest Soil | MKSAETMSASPVPSPAREPATLRARRLAAARRRATALL |
| Ga0164307_116977582 | 3300012987 | Soil | MEPTATMSASSALRAEPESAEVRARQLAAARRRATALLGAVTVLFVAVT |
| Ga0157370_115229681 | 3300013104 | Corn Rhizosphere | MEPTATMSASPAFRAEPESAEVRARQLAAARRRATAL |
| Ga0163162_118004222 | 3300013306 | Switchgrass Rhizosphere | MEPAATMSASPAFRAEPESAEVRTRQLAAARRRATALLAA |
| Ga0157376_109171341 | 3300014969 | Miscanthus Rhizosphere | MEPAVPMSASPLPASGHESAAQRARGLAAARRRAT |
| Ga0137412_106508332 | 3300015242 | Vadose Zone Soil | MEPAATTSASPASTVKRESLELRTRRLAAARRRATALLAAVTVLFIA |
| Ga0137403_105816821 | 3300015264 | Vadose Zone Soil | MEPTAPLSASPVPAPGHEPAAQRARGLAAARRRATALLAGVTVLFVAVTVVGAHGIL |
| Ga0132258_136863231 | 3300015371 | Arabidopsis Rhizosphere | MEPAVPTPPSPTSGSLALAPEREPVDLRVRRLAAARRRATALLAAVTVLFVAVTAAGAD |
| Ga0182036_112330802 | 3300016270 | Soil | MKSAETMSASPVPALQREPAALRARRLAAARRRAT |
| Ga0182041_101469883 | 3300016294 | Soil | MEPAATMSASPVSKLERESVELRTRRLAAARRRATALLGGVTVLFIAVTAAGVH |
| Ga0182033_106625642 | 3300016319 | Soil | MEPAETIPASPVPALKREPTALRARRLAAARRRATALLAAATALFVAVT |
| Ga0182033_118248162 | 3300016319 | Soil | MEPTATMSAAPVSKLERESLEVRTRRLAAARRRATA |
| Ga0182032_101997461 | 3300016357 | Soil | MSASPVPAPGHEPVALRTRRLAAARRRATALLAAVTALFVAVTAI |
| Ga0182037_103263481 | 3300016404 | Soil | MEPTATMSASPVSTFEREPTELRARRLAAARRRATALLAGATVLFLAVTAAGVHG |
| Ga0187812_10715911 | 3300017821 | Freshwater Sediment | MQPTATMSAASVPALERESLAVRRRRLAAARRRATAFLVGATGLFLGVTAAGV |
| Ga0187818_102523642 | 3300017823 | Freshwater Sediment | MEPAATTSAAPVSGLGREPADLRVRRLAAARRRATALLAGVTVVFVAVTVAGVHGTL |
| Ga0187807_10953491 | 3300017926 | Freshwater Sediment | MEPAGTMSASPAPALKRESLASRTHRLAAARRRATALLGAVTALFV |
| Ga0187807_11226931 | 3300017926 | Freshwater Sediment | MEPTATMPAPPVPALKRESAELRARRLATARRRATALLAGVT |
| Ga0187807_11987301 | 3300017926 | Freshwater Sediment | VEPTATTSAAPVSRIERESLELRTRRLAAARRRATALLGAVT |
| Ga0187806_12787571 | 3300017928 | Freshwater Sediment | MEPTATMPAPPVPALKRESAELRARRLAAARRRATALLAGVTLLFI |
| Ga0187809_100804581 | 3300017937 | Freshwater Sediment | MEPAATTSASAVPAVKRESLELRTRRLAVARRRATALLGA |
| Ga0187809_100948012 | 3300017937 | Freshwater Sediment | MEPAATMSASPAFRAEPESAEVRARQLAAARRRATALLGAVTVLFVAV |
| Ga0187809_101286141 | 3300017937 | Freshwater Sediment | MEPTATVSASPVPTVEREPAAVRARRLAAARRRATALLAGVTV |
| Ga0187808_101929721 | 3300017942 | Freshwater Sediment | METTATMSAAPVSTLGRESLAVRQRRLAAARRRATAFLVGATALFLA |
| Ga0187808_103655652 | 3300017942 | Freshwater Sediment | MEPTAAAPAAPMRTVERESLAVRTRRLAVARRRATAVLAGVTILFL |
| Ga0187819_108750901 | 3300017943 | Freshwater Sediment | MQPTATMSDAPVSALERESLAVRRRRLAAARRRASGLLAGVTVLFLAVTAAGAHGTFLG |
| Ga0187781_106375182 | 3300017972 | Tropical Peatland | MVSAAPVSTLEREPAALRVRRLAAARRRATALLAGVTALFVAVTAAGV |
| Ga0187781_114220102 | 3300017972 | Tropical Peatland | MEPTATMPASPVRAHEYEPVEVRTRRLAAARRRATA |
| Ga0187777_109432492 | 3300017974 | Tropical Peatland | MERAATISASPVTTLERESTALRTRRLAAARRRATG |
| Ga0187815_103169311 | 3300018001 | Freshwater Sediment | MEPIATMPASPLRTREHESVEERTRRLAAARLRATALLAA |
| Ga0187766_104226891 | 3300018058 | Tropical Peatland | MEPTATMSASPPPVLEREPATSRARSLAAARRRATALLAAVTALFVAVT |
| Ga0187772_114360312 | 3300018085 | Tropical Peatland | MESAATMSAAPVPRLQRESLAERKRRLAAARRRATAFLVGATALFLGVTA |
| Ga0210395_114361822 | 3300020582 | Soil | MEPAATTPASAVPGVKRESLELRTRRLAAARRRATAFLVAV |
| Ga0210404_108754231 | 3300021088 | Soil | MPATPSTALGRESAELRTRRLAAARRRATALLAAATVLFVV |
| Ga0210396_113774921 | 3300021180 | Soil | MEPAAATTAAPIRTAEHESVEVRTRRLAAARRRATALLGAVTV |
| Ga0210388_107597832 | 3300021181 | Soil | MEPAATTPASAVPGVKRESLELRTRRLAAARRRATAFLVAVTALFVGVTAAGA |
| Ga0210389_115332962 | 3300021404 | Soil | MEPTATMAAAPASSPDPESTEVRVRQLAAARRRAT |
| Ga0210386_110275712 | 3300021406 | Soil | MEPAATTSAAPASKVNRESLERRTQRLVAARRRATALLGAVTAL |
| Ga0210383_108971611 | 3300021407 | Soil | MEPTAATPAAPMRTVEHESVAMRTRRLVAARRRATALLGAVTIVFIAVTV |
| Ga0210410_104623731 | 3300021479 | Soil | MEPAATMPASPAPALERESTELRTRRLAAARRRASALLA |
| Ga0210409_115226802 | 3300021559 | Soil | MEPAATTSASPGPALERGPAALRARRLAAARRRATGLLVGVTVLFLAVTVVGAHGTFLGY |
| Ga0126371_115214681 | 3300021560 | Tropical Forest Soil | MQPAATTSASPGPALEREPAALRARRLAVARRRATGLLVGVTVLFLAVTA |
| Ga0126371_127840302 | 3300021560 | Tropical Forest Soil | VEPAAAMPASPMATIEREPVAVRERRLAAARRRATALLVGVTALFVAVTVA |
| Ga0213853_101378611 | 3300021861 | Watersheds | MEPAATMSASPVSGLGSEPPDVRVRRLAAARRRATALLAGVT |
| Ga0207699_114465972 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPAATMSASPAFRAEPESAEVRARQLAAARRRATALLGAVTVLFV |
| Ga0207671_115964602 | 3300025914 | Corn Rhizosphere | MEPAATTSASPVSKLERESMDLRVRRLAAARRRATALLGAVTIGFVVV |
| Ga0207693_105922962 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | METAATKPDSPATRLERQSLELRTQRLAAARRRATALLAAVSVVFIAVTA |
| Ga0207652_114573171 | 3300025921 | Corn Rhizosphere | MEPAASAAPVPRVKRESLEARKRRLVVARRRATALLGAVTVLFIVVTA |
| Ga0207646_107298001 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPTATMSASPAFRAEPESAEVRVRQLAAARRRAT |
| Ga0207646_110245651 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPAATMSASPVSGLGREPADVRVRRLAAARRRATALLAGVAVVFVAVTVAG |
| Ga0207700_104048302 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPTATMSASPAFRAEPESAEVRARQLAAARRRATALLAAVTVLFVAV |
| Ga0207664_101538401 | 3300025929 | Agricultural Soil | MEPAATTSASAVPAVKRESLELRTRRLAAARRRATALLGAVTALFIAVTAIGVHGT |
| Ga0207664_108093432 | 3300025929 | Agricultural Soil | MTTAVTTPAPGRESPELRVRRLVAARRRATALLAAVTVLFLVVTA |
| Ga0207664_108711341 | 3300025929 | Agricultural Soil | MEPATAMPASPVPTIQRESTALRKRRLAAARRRATALLVGATALFVGVT |
| Ga0207664_108808892 | 3300025929 | Agricultural Soil | MEPAATMSASPAFRAEPESAEVRARQLAAARRRATALLGAVTVLFVAVTV |
| Ga0209647_12356251 | 3300026319 | Grasslands Soil | MEPAATMSASPVTALERESAELRARRLAAARRRATALLAGVT |
| Ga0257146_10114433 | 3300026374 | Soil | MEPTATLSASPAFRAEPESTEVRARQLAAARRRATALLGAVT |
| Ga0208238_10108912 | 3300027072 | Forest Soil | MEPASTMSASPVSAPEHEPVELRARRLAAARRRATALLAAATVLFV |
| Ga0207943_1013981 | 3300027089 | Forest Soil | MEPASTMSASPVSAPEHEPVELRARRLAAARRRATALLAAATVVFVAVTVA |
| Ga0209421_10657331 | 3300027432 | Forest Soil | MEPAATTSAAPVAALERESPELRARRLAAARRRATAL |
| Ga0208324_10094814 | 3300027604 | Peatlands Soil | MEPTATMSAPPAPTLEREPAAVRARRLAAARRRATALL |
| Ga0209073_100709372 | 3300027765 | Agricultural Soil | MEPAATMSASPAFRAEPESAEVRARQLAAARRRATALL |
| Ga0209177_104064682 | 3300027775 | Agricultural Soil | MEPAETISGSPVPALGHEPVALRARRLAAARRRATALLAAVTALFV |
| Ga0209448_100136053 | 3300027783 | Bog Forest Soil | MEPAAATPAAPMRTVEYESVAVRTRRLAAARRRATAVLG |
| Ga0209274_105509592 | 3300027853 | Soil | MEPTATLPASSLRTTEHESVEVRTRRLAAARRRATALLAAVTVLFVAVT |
| Ga0209693_105089651 | 3300027855 | Soil | MEPAATMPASPAPALERESTELRTRRLAAARRRASALLAAVTALFVAV |
| Ga0209275_103575111 | 3300027884 | Soil | MASAPATTIKRESVESRTRRLAAARRRATALLGAVTVLFVV |
| Ga0209006_106409902 | 3300027908 | Forest Soil | MSSTPVSAFQRESAELRVRRLAAARRRATALLAAVTAL |
| Ga0302221_101407971 | 3300028806 | Palsa | MEPAATVSASPVSALGHESAQLRARRLAAARRRATAVLAGVTV |
| Ga0302229_104528251 | 3300028879 | Palsa | MEPAAPRSASPVPAPGHESPALRARGLAVARRRASALLGAVTVLFVAVTVAGAHGIL |
| Ga0308309_107101792 | 3300028906 | Soil | MEPAATMSAAPVAAPEHEPPELRARRLAAARRRAT |
| Ga0311368_106023441 | 3300029882 | Palsa | MEPAAPMSTAPASAIKRESVELRTRRLAAARRRATALLGAVTILFV |
| Ga0311340_105372413 | 3300029943 | Palsa | MEPAAPTSAAPTATIKRESVELRTRRLAAARRRATALLGAVTVLFIV |
| Ga0311339_113490672 | 3300029999 | Palsa | MEPAAPRSASPVPAPGHESPALRARGLAVARRRASALLGAVTVLFVAV |
| Ga0311372_120372141 | 3300030520 | Palsa | MEPAAPMSASPASTINRESVESRTRRLAAARRRATALLG |
| Ga0311357_104624071 | 3300030524 | Palsa | MEPAATVSASPVSALGRESPQLRARRLAAARRRATAVLAGVTVVFV |
| Ga0311355_105421021 | 3300030580 | Palsa | VPAPGHESPAQRARGLTVARRRASALLGAVTVLFVAVT |
| Ga0302317_103657141 | 3300030677 | Palsa | MEPAETTTAAAVPRLKRESMELRVQRLAAARRRANA |
| Ga0302317_104581912 | 3300030677 | Palsa | MEPAAPMSTSPASTIKRESVELRTRRLVAARRRATALLGAVTILFIVVT |
| Ga0307482_10405351 | 3300030730 | Hardwood Forest Soil | MEPTTATAAAPMHTAEHESVAVRTRRLVAARRRATALLGA |
| Ga0302325_114286682 | 3300031234 | Palsa | MEPAAPMSTSPASTIKRESVELRTRRLAAARRRATALLG |
| Ga0302326_106332701 | 3300031525 | Palsa | MGPTAPRPASPVPAPGHESPAQRARGLTVARRRASALLGAVTV |
| Ga0302326_110981263 | 3300031525 | Palsa | MEPAETTTAAAVPRLKRESMELRVLRLAAARRRATALLAGVTALFIAVTAVGVHGTLL |
| Ga0318573_101848023 | 3300031564 | Soil | MEPAETMSASPVPALGHEPAALRARQLAAARRRATALLAAVTALFV |
| Ga0318573_103507911 | 3300031564 | Soil | MEPAATMPASPVSTFEREPTALRARRLAAARRRATALLGGVTVLF |
| Ga0318573_107706981 | 3300031564 | Soil | METTATMPAAPVSRLERESLAVRQRRLATARRRATALLIAVTA |
| Ga0318515_103269313 | 3300031572 | Soil | MQTTATMPAAPVSRLERESLAVRQRRLATARRRATALLIAVTALFLAVTAMR |
| Ga0310915_104786481 | 3300031573 | Soil | MEPAETIASPVPALKREPTALRARRLAAARRRATAL |
| Ga0318555_106403021 | 3300031640 | Soil | MEPAETIASPVPALKREPTALRARRLAAARRRATALLAAATARR |
| Ga0318542_103356891 | 3300031668 | Soil | MEPAETIPASPVPALKREPTALRARRLAAARRRATALLAAATALF |
| Ga0318561_103420191 | 3300031679 | Soil | MEPTATITAAPASSPEPESTAVRARQLAAARRRATALLGAVTVLF |
| Ga0310686_1020176362 | 3300031708 | Soil | MEPAETTTAAAVPRLKRESMELRVQRLAAARRRATALLAGVTALFI |
| Ga0310686_1026702412 | 3300031708 | Soil | MEPAAPMSTAPVAGPGHESLELRTRRLAAARRRATALLGAVT |
| Ga0310686_1051155752 | 3300031708 | Soil | MSASPVARIERESVELRTRRRAAARRRATILLGAVTALFV |
| Ga0318496_104393102 | 3300031713 | Soil | MAAPASSLEPESAAVRTRQLAAARRRATALLAGVTVLFVV |
| Ga0318500_103022951 | 3300031724 | Soil | MEPAATMSAAPVSQLERESLELRTRRLAAARRRATALLGGVTVLFVVVT |
| Ga0306918_106919661 | 3300031744 | Soil | MEPTATMAAAPVSKLERESLEQRTRALAAARRRATAL |
| Ga0318502_101189091 | 3300031747 | Soil | METTATMPTAPVSRIERESLAVRQRRLTAARRRATALLLAVTA |
| Ga0318494_107884421 | 3300031751 | Soil | MESTAAMSAAPVTTVERESLAVRQRRLAAARRRATA |
| Ga0318554_108669982 | 3300031765 | Soil | MEPATAVPASPVPTLQRESTAVRARRLAAARRRATAILVGRRRC |
| Ga0318508_12054042 | 3300031780 | Soil | MEPTATMSASPVSTFEREPTELRARRLAAARRRATALLAGATVLFLAVTAAGVHGTF |
| Ga0318508_12159492 | 3300031780 | Soil | MEPTATMSASPASSLEPESAAVRARQLAAARRRAT |
| Ga0318547_106069711 | 3300031781 | Soil | MDTTETMSAAPAPALRRESVALRTRQLAAARRRATALLAAVTALVV |
| Ga0318547_106776272 | 3300031781 | Soil | MEPTAAISASPLPALERESTAVRARRLAAARRRATALLVAEEGPM |
| Ga0318552_103015953 | 3300031782 | Soil | MEPTATITAAPASSPEPESTAERARQLAAARRRATALLGAVT |
| Ga0318529_102226241 | 3300031792 | Soil | MEPAATMSAAPVSQLERESLELRTRRLAAARRRATALLGGVT |
| Ga0318548_102191302 | 3300031793 | Soil | MEPAAVMTASPVPALERESAAMRARRLAAARRRATALLIGVTALFVAV |
| Ga0318548_102791742 | 3300031793 | Soil | MEPTAAISASPLPALERESTAVRARRLAAARRRATALLIAVTG |
| Ga0318557_103924743 | 3300031795 | Soil | MQTTATMPAAPVSRLERESLAVRQRRLATARRRATALLIAVTALFL |
| Ga0318576_105455872 | 3300031796 | Soil | MEPAETMSASPVPALGHEPAALRARQLAAARRRATALLAAVTARG |
| Ga0318550_103255392 | 3300031797 | Soil | MEPTATMSASPVSTFEREPTELRARRLAAARRRATALLAGATVLFLAVT |
| Ga0318550_104023742 | 3300031797 | Soil | MEPTATMAAAPVSKLERESLEQRTRALAAARRRATALLGAVTVLFVVVTAVG |
| Ga0318565_100185471 | 3300031799 | Soil | METTATMPTAPVSRIERESLAVRQRRLTAARRRATALLLAVTALFV |
| Ga0318565_100715954 | 3300031799 | Soil | MQTTATMPAAPVSRLERESLAVRQRRLAVARRRATALLVAVTALFVT |
| Ga0318565_104479742 | 3300031799 | Soil | MESTATISAAPVSTLERESLAVRQRRLAAARRRATALLVAVSGLFL |
| Ga0318565_106495502 | 3300031799 | Soil | MEPAVTMSATPVPTLEREPAALRARRLAAARRRATALLGG |
| Ga0318567_100466481 | 3300031821 | Soil | MEPAAVMTASPVPALERESAAMRARRLAAARRRATALLI |
| Ga0318567_101516731 | 3300031821 | Soil | MEPIATMSASPVSTFEREPTELRARRLAAARRRATALLAGAT |
| Ga0318564_102305373 | 3300031831 | Soil | MSASPVPALQREPAALRARRLAAARRRATALLAAV |
| Ga0310917_107647011 | 3300031833 | Soil | MEPTATMSASPASSLEPESAAVRTRQLAAARRRATA |
| Ga0310904_108163601 | 3300031854 | Soil | MEPAATMSASPAFRAEPESAEVRARQLAAARRRATAL |
| Ga0318495_104539232 | 3300031860 | Soil | MEPTAAISASPLPALERESTAVRARRLAAARRRATALLVAVTGL |
| Ga0306925_105179241 | 3300031890 | Soil | MEPTATITATPATSLEPESAAVRRRQLAAARRRATALLAGVTVL |
| Ga0306925_115950101 | 3300031890 | Soil | MESTAAMSAAPVTTVERESLAVRQRRLAAARRRAT |
| Ga0306925_122302832 | 3300031890 | Soil | MEPAETMSASPVPALKRESVAMRARRLAAARRRATALLAGVA |
| Ga0318536_103953991 | 3300031893 | Soil | MEPTATITATPATSLEPESAAVRRRQLAAARRRATALLA |
| Ga0318522_100621371 | 3300031894 | Soil | METTATMPTAPVSRIERESLAVRQRRLTAARRRATALLLAVTALFVVVTAI |
| Ga0318520_106573462 | 3300031897 | Soil | MEPAAVMTASPVPALERESAAMRARRLAAARRRATALLIGVTA |
| Ga0318520_106972021 | 3300031897 | Soil | MEPTAAISASPLPALERESTAVRARRLAAARRRATALLVAVTG |
| Ga0318520_107293732 | 3300031897 | Soil | MEPTATMAAAPVSKLERESLEQRTRALAAARRRATALLGAVTVLFVAVT |
| Ga0318520_107332251 | 3300031897 | Soil | MEPTATMSASPVSTFEREPTELRARRLTAARRRATALLAGATVLFLAVTAAGVHG |
| Ga0306923_109821761 | 3300031910 | Soil | MKSAETMSASPVPALQREPAALRARRLAAARRRATALL |
| Ga0310912_112894902 | 3300031941 | Soil | MEPTETMSAPPVPALRRESLALRTRQLTVARRRATALLAAVTA |
| Ga0310912_114779972 | 3300031941 | Soil | MEPTATLSAAPVSRLERESLAVRQRRLAAARRRATALLAAVTGLFIAVTAAG |
| Ga0310909_112127951 | 3300031947 | Soil | MEPAETMSAPPLRTVNREPVALRARRLAAARRRATALLAAVTALFVAV |
| Ga0306926_104805641 | 3300031954 | Soil | MEPTATMSASPASSLEPESAAVRARQLAAARRRATA |
| Ga0306926_111490911 | 3300031954 | Soil | MQTTATMPAAPVSRLERESLAVRQRRLAAARRRATALHIVVTALFLAVTAA |
| Ga0306926_123053352 | 3300031954 | Soil | MKSAETMSASPVPALQREPAALRARRLAAARRRATALLA |
| Ga0307479_103798361 | 3300031962 | Hardwood Forest Soil | MEPTATTPAAPMRTVERESLAVRTRRLAAARRRATAVLGGVTIV |
| Ga0318562_103839001 | 3300032008 | Soil | MEPAATMSAAPVSQLERESVELRTRRLAAARRRATALLAGVTVLFIV |
| Ga0318562_108888312 | 3300032008 | Soil | MSAAPASSLEPESVEVRTRQLAAARRRATALLAGVTVLFVA |
| Ga0318563_100816691 | 3300032009 | Soil | MQTTATMPAAPVSRLERESLAVRQRRLAAARRRATALLIVVTALFLA |
| Ga0318563_102447621 | 3300032009 | Soil | MEPTATITATPATSLEPESAAVRRRQRAAARRRATALLAGVTVLFIA |
| Ga0318549_103875382 | 3300032041 | Soil | MAAPASSVEPESVAVRTRQLAAARRRATALLAGVTVLFV |
| Ga0318549_104964981 | 3300032041 | Soil | MQTTATMPAAPVSRLERESLAVRQRRLAAARRRATAFLVGATALFFAVTAVGAHGTF |
| Ga0318545_102384382 | 3300032042 | Soil | MEPTETMSAPPVPALRRESLALRTRRLTVARRRATALLAAVTALFIAVTAVGVH |
| Ga0318556_101476471 | 3300032043 | Soil | MKSAETMSASPVPALQREPAALRARRLAAARRRATALLAAVT |
| Ga0318556_102256131 | 3300032043 | Soil | MEPTATITATPATSLEPESAAVRRRQLAAARRRATALLAGVTVLF |
| Ga0318558_102170681 | 3300032044 | Soil | MEPATAVPASPVPTLQRESTAVRARRLAAARRRATALLVGATAVFVAV |
| Ga0318570_100090901 | 3300032054 | Soil | MEPAATMSASPVPAPGHEPVALRTRRLAAARRRATALLAAVTALFVA |
| Ga0318575_101722783 | 3300032055 | Soil | MEPAETIASPVPALKREPTALRARRLAAARRRATALLAAATALFV |
| Ga0318510_102559782 | 3300032064 | Soil | MEPTATISAAPVSRLERESLAVRQGRLAAARRRATALLAAVA |
| Ga0318513_103138632 | 3300032065 | Soil | MEPAETMSASPVPALKRESVAMRARRLAAARRRATAL |
| Ga0318524_101281294 | 3300032067 | Soil | MEPTATITAAPASSPEPESTAERARQLAAARRRATALLGAVTVL |
| Ga0318553_102972561 | 3300032068 | Soil | MEPTATMSASPASSLEPESAAVRARQLAAARRRATALLAGV |
| Ga0308173_109948262 | 3300032074 | Soil | MEPAVPTPAGQVAASEHEPVELRVRRLAAARRRATALLAAVTALF |
| Ga0306924_110781962 | 3300032076 | Soil | MEPATAMSASPVTTLQRESTAVRVRRLAAARRRATALLLGATALFVGVTAV |
| Ga0306924_116423802 | 3300032076 | Soil | MEPTATMAAARASSPEPDPESVAVRTRQLAAARRRATALLGGVTVLFVA |
| Ga0318518_100439324 | 3300032090 | Soil | MEPTETMSAPPVPALRRESLALRTRQLTVARRRATALLAAVTALFI |
| Ga0318518_103989162 | 3300032090 | Soil | MAAPASSLEPESAAVRTRQLAAARRRATALLAGVTVLFVAV |
| Ga0318577_101588321 | 3300032091 | Soil | MEPAETIASPVPALKREPTALRARRLAAARRRATALL |
| Ga0311301_101096706 | 3300032160 | Peatlands Soil | MSESPVSTLEREPAAVRARRLAAARRRATALLAGVTVLF |
| Ga0306920_1002122995 | 3300032261 | Soil | METTATMPAAPVSTLQREPLAVRRRRLAAARRRATAFL |
| Ga0335085_121384941 | 3300032770 | Soil | MEPAATMSASPVSTLEREPAAVRARRLAAARRRATALLAGVAVLFIAV |
| Ga0335082_105925812 | 3300032782 | Soil | MEPTATMSASPVATVERESAAVRARRLAAARRRATA |
| Ga0335078_117454852 | 3300032805 | Soil | MEPADLATPALTRESAELRTRRLAAARRRATALLVAVTALFVAV |
| Ga0335078_126005582 | 3300032805 | Soil | MEPAATMSASPVSALEHESVAVRARRLAAARRRATALLGGVTVLF |
| Ga0335069_117554051 | 3300032893 | Soil | MEPAATTSASPVSRLERESMEQRVRRLAAARRRATA |
| Ga0335074_102701894 | 3300032895 | Soil | MEPATQMTAAPVSGPGHESIELRSRRLAAARRRATALL |
| Ga0335077_111949091 | 3300033158 | Soil | MEPTATMPASPVATVEREPAELRARRLAAARRRATALLA |
| Ga0370483_0258813_1_138 | 3300034124 | Untreated Peat Soil | MSASPVPAPGHEPAAVRARGLAAARRRATALLGAVTVLFVAVTVPG |
| Ga0370514_107250_582_713 | 3300034199 | Untreated Peat Soil | MEPTATVPAAPIRTVEHESPAVRARRLAAARRRATALLGAVTVL |
| ⦗Top⦘ |