| Basic Information | |
|---|---|
| Family ID | F019083 |
| Family Type | Metagenome |
| Number of Sequences | 231 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MIIFWSILTTFESSSIFGGSWGSIENWLKPKTEPPSGNLACPNP |
| Number of Associated Samples | 3 |
| Number of Associated Scaffolds | 231 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 13.27 % |
| % of genes near scaffold ends (potentially truncated) | 13.85 % |
| % of genes from short scaffolds (< 2000 bps) | 32.03 % |
| Associated GOLD sequencing projects | 3 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (80.087 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (98.268 % of family members) |
| Environment Ontology (ENVO) | Unclassified (98.268 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (98.268 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 231 Family Scaffolds |
|---|---|---|
| PF00271 | Helicase_C | 0.87 |
| PF06320 | GCN5L1 | 0.43 |
| PF02210 | Laminin_G_2 | 0.43 |
| PF01479 | S4 | 0.43 |
| PF07678 | TED_complement | 0.43 |
| PF02145 | Rap_GAP | 0.43 |
| PF14931 | IFT20 | 0.43 |
| PF01237 | Oxysterol_BP | 0.43 |
| PF01744 | GLTT | 0.43 |
| PF00858 | ASC | 0.43 |
| PF03931 | Skp1_POZ | 0.43 |
| PF01150 | GDA1_CD39 | 0.43 |
| PF00626 | Gelsolin | 0.43 |
| PF00069 | Pkinase | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 231 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.73 |
| COG5371 | Nucleoside diphosphatase, GDA1/CD39 family | Nucleotide transport and metabolism [F] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 80.09 % |
| All Organisms | root | All Organisms | 19.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300008106|Ga0114339_1167589 | Not Available | 756 | Open in IMG/M |
| 3300008121|Ga0114356_1000167 | Not Available | 19769 | Open in IMG/M |
| 3300008121|Ga0114356_1000937 | Not Available | 11955 | Open in IMG/M |
| 3300008121|Ga0114356_1000952 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 11908 | Open in IMG/M |
| 3300008121|Ga0114356_1001151 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus | 11357 | Open in IMG/M |
| 3300008121|Ga0114356_1001783 | Not Available | 10156 | Open in IMG/M |
| 3300008121|Ga0114356_1002263 | Not Available | 11411 | Open in IMG/M |
| 3300008121|Ga0114356_1002477 | Not Available | 11413 | Open in IMG/M |
| 3300008121|Ga0114356_1002814 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | 10547 | Open in IMG/M |
| 3300008121|Ga0114356_1002856 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | 9043 | Open in IMG/M |
| 3300008121|Ga0114356_1003122 | Not Available | 8838 | Open in IMG/M |
| 3300008121|Ga0114356_1004768 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | 12759 | Open in IMG/M |
| 3300008121|Ga0114356_1005894 | Not Available | 7415 | Open in IMG/M |
| 3300008121|Ga0114356_1006187 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis | 11447 | Open in IMG/M |
| 3300008121|Ga0114356_1006189 | Not Available | 7812 | Open in IMG/M |
| 3300008121|Ga0114356_1007979 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 7467 | Open in IMG/M |
| 3300008121|Ga0114356_1008485 | Not Available | 10323 | Open in IMG/M |
| 3300008121|Ga0114356_1008537 | Not Available | 6680 | Open in IMG/M |
| 3300008121|Ga0114356_1008728 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex | 6633 | Open in IMG/M |
| 3300008121|Ga0114356_1008735 | Not Available | 7369 | Open in IMG/M |
| 3300008121|Ga0114356_1008897 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 6594 | Open in IMG/M |
| 3300008121|Ga0114356_1010211 | Not Available | 7092 | Open in IMG/M |
| 3300008121|Ga0114356_1010454 | Not Available | 6285 | Open in IMG/M |
| 3300008121|Ga0114356_1010655 | Not Available | 6247 | Open in IMG/M |
| 3300008121|Ga0114356_1013460 | Not Available | 9409 | Open in IMG/M |
| 3300008121|Ga0114356_1014391 | Not Available | 8912 | Open in IMG/M |
| 3300008121|Ga0114356_1014641 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea | 5651 | Open in IMG/M |
| 3300008121|Ga0114356_1014750 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 5638 | Open in IMG/M |
| 3300008121|Ga0114356_1016104 | Not Available | 5471 | Open in IMG/M |
| 3300008121|Ga0114356_1017386 | Not Available | 7982 | Open in IMG/M |
| 3300008121|Ga0114356_1017474 | Not Available | 5317 | Open in IMG/M |
| 3300008121|Ga0114356_1017827 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | 8562 | Open in IMG/M |
| 3300008121|Ga0114356_1018410 | All Organisms → cellular organisms → Eukaryota | 11053 | Open in IMG/M |
| 3300008121|Ga0114356_1020611 | Not Available | 5016 | Open in IMG/M |
| 3300008121|Ga0114356_1021323 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea | 8260 | Open in IMG/M |
| 3300008121|Ga0114356_1022766 | Not Available | 4846 | Open in IMG/M |
| 3300008121|Ga0114356_1022827 | Not Available | 4840 | Open in IMG/M |
| 3300008121|Ga0114356_1022898 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | 4833 | Open in IMG/M |
| 3300008121|Ga0114356_1023806 | Not Available | 4766 | Open in IMG/M |
| 3300008121|Ga0114356_1025562 | Not Available | 4640 | Open in IMG/M |
| 3300008121|Ga0114356_1026072 | Not Available | 4605 | Open in IMG/M |
| 3300008121|Ga0114356_1026118 | Not Available | 9630 | Open in IMG/M |
| 3300008121|Ga0114356_1026145 | Not Available | 4600 | Open in IMG/M |
| 3300008121|Ga0114356_1028202 | Not Available | 4472 | Open in IMG/M |
| 3300008121|Ga0114356_1028818 | Not Available | 10008 | Open in IMG/M |
| 3300008121|Ga0114356_1029339 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus | 6060 | Open in IMG/M |
| 3300008121|Ga0114356_1033442 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis | 4180 | Open in IMG/M |
| 3300008121|Ga0114356_1034463 | Not Available | 5812 | Open in IMG/M |
| 3300008121|Ga0114356_1035703 | Not Available | 4070 | Open in IMG/M |
| 3300008121|Ga0114356_1035705 | Not Available | 4070 | Open in IMG/M |
| 3300008121|Ga0114356_1036654 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | 4026 | Open in IMG/M |
| 3300008121|Ga0114356_1038051 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus | 3963 | Open in IMG/M |
| 3300008121|Ga0114356_1038344 | Not Available | 6041 | Open in IMG/M |
| 3300008121|Ga0114356_1039487 | Not Available | 3901 | Open in IMG/M |
| 3300008121|Ga0114356_1040220 | Not Available | 3871 | Open in IMG/M |
| 3300008121|Ga0114356_1040641 | Not Available | 7109 | Open in IMG/M |
| 3300008121|Ga0114356_1041931 | Not Available | 3805 | Open in IMG/M |
| 3300008121|Ga0114356_1047639 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea | 4178 | Open in IMG/M |
| 3300008121|Ga0114356_1047785 | Not Available | 3587 | Open in IMG/M |
| 3300008121|Ga0114356_1048988 | Not Available | 3546 | Open in IMG/M |
| 3300008121|Ga0114356_1049630 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 5588 | Open in IMG/M |
| 3300008121|Ga0114356_1050521 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus | 3496 | Open in IMG/M |
| 3300008121|Ga0114356_1050589 | Not Available | 4673 | Open in IMG/M |
| 3300008121|Ga0114356_1052859 | Not Available | 3426 | Open in IMG/M |
| 3300008121|Ga0114356_1052926 | Not Available | 3424 | Open in IMG/M |
| 3300008121|Ga0114356_1054243 | Not Available | 3385 | Open in IMG/M |
| 3300008121|Ga0114356_1055354 | Not Available | 3352 | Open in IMG/M |
| 3300008121|Ga0114356_1056074 | Not Available | 3332 | Open in IMG/M |
| 3300008121|Ga0114356_1057158 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | 3302 | Open in IMG/M |
| 3300008121|Ga0114356_1057821 | Not Available | 3284 | Open in IMG/M |
| 3300008121|Ga0114356_1057920 | Not Available | 3281 | Open in IMG/M |
| 3300008121|Ga0114356_1060614 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus | 3212 | Open in IMG/M |
| 3300008121|Ga0114356_1061637 | Not Available | 4393 | Open in IMG/M |
| 3300008121|Ga0114356_1064428 | Not Available | 3116 | Open in IMG/M |
| 3300008121|Ga0114356_1065180 | Not Available | 3097 | Open in IMG/M |
| 3300008121|Ga0114356_1065322 | Not Available | 6351 | Open in IMG/M |
| 3300008121|Ga0114356_1067040 | Not Available | 5063 | Open in IMG/M |
| 3300008121|Ga0114356_1069009 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | 3629 | Open in IMG/M |
| 3300008121|Ga0114356_1069434 | Not Available | 6858 | Open in IMG/M |
| 3300008121|Ga0114356_1071015 | Not Available | 2965 | Open in IMG/M |
| 3300008121|Ga0114356_1073372 | Not Available | 2915 | Open in IMG/M |
| 3300008121|Ga0114356_1073563 | Not Available | 2911 | Open in IMG/M |
| 3300008121|Ga0114356_1075930 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea | 4213 | Open in IMG/M |
| 3300008121|Ga0114356_1076018 | Not Available | 2860 | Open in IMG/M |
| 3300008121|Ga0114356_1077903 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus | 2823 | Open in IMG/M |
| 3300008121|Ga0114356_1078303 | Not Available | 2815 | Open in IMG/M |
| 3300008121|Ga0114356_1078768 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus | 2806 | Open in IMG/M |
| 3300008121|Ga0114356_1079003 | Not Available | 2801 | Open in IMG/M |
| 3300008121|Ga0114356_1087126 | Not Available | 2654 | Open in IMG/M |
| 3300008121|Ga0114356_1087384 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus | 4004 | Open in IMG/M |
| 3300008121|Ga0114356_1091621 | Not Available | 3836 | Open in IMG/M |
| 3300008121|Ga0114356_1091784 | Not Available | 3951 | Open in IMG/M |
| 3300008121|Ga0114356_1092224 | Not Available | 3472 | Open in IMG/M |
| 3300008121|Ga0114356_1093571 | Not Available | 4445 | Open in IMG/M |
| 3300008121|Ga0114356_1095518 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | 2520 | Open in IMG/M |
| 3300008121|Ga0114356_1098360 | Not Available | 3284 | Open in IMG/M |
| 3300008121|Ga0114356_1101319 | Not Available | 2432 | Open in IMG/M |
| 3300008121|Ga0114356_1103642 | Not Available | 4503 | Open in IMG/M |
| 3300008121|Ga0114356_1104097 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis | 2392 | Open in IMG/M |
| 3300008121|Ga0114356_1105858 | Not Available | 2894 | Open in IMG/M |
| 3300008121|Ga0114356_1106670 | Not Available | 3454 | Open in IMG/M |
| 3300008121|Ga0114356_1109347 | Not Available | 2321 | Open in IMG/M |
| 3300008121|Ga0114356_1112823 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 3305 | Open in IMG/M |
| 3300008121|Ga0114356_1112975 | All Organisms → cellular organisms → Eukaryota | 3349 | Open in IMG/M |
| 3300008121|Ga0114356_1115383 | Not Available | 3706 | Open in IMG/M |
| 3300008121|Ga0114356_1118830 | Not Available | 3121 | Open in IMG/M |
| 3300008121|Ga0114356_1121668 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | 4492 | Open in IMG/M |
| 3300008121|Ga0114356_1127809 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea | 2101 | Open in IMG/M |
| 3300008121|Ga0114356_1130405 | Not Available | 4633 | Open in IMG/M |
| 3300008121|Ga0114356_1133863 | Not Available | 3990 | Open in IMG/M |
| 3300008121|Ga0114356_1134074 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2034 | Open in IMG/M |
| 3300008121|Ga0114356_1139147 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa | 3643 | Open in IMG/M |
| 3300008121|Ga0114356_1139755 | Not Available | 1977 | Open in IMG/M |
| 3300008121|Ga0114356_1141635 | Not Available | 1958 | Open in IMG/M |
| 3300008121|Ga0114356_1141832 | Not Available | 1957 | Open in IMG/M |
| 3300008121|Ga0114356_1142752 | Not Available | 1948 | Open in IMG/M |
| 3300008121|Ga0114356_1143060 | Not Available | 1945 | Open in IMG/M |
| 3300008121|Ga0114356_1147315 | Not Available | 1906 | Open in IMG/M |
| 3300008121|Ga0114356_1147508 | Not Available | 1904 | Open in IMG/M |
| 3300008121|Ga0114356_1149071 | Not Available | 1890 | Open in IMG/M |
| 3300008121|Ga0114356_1150642 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 2415 | Open in IMG/M |
| 3300008121|Ga0114356_1152909 | Not Available | 1856 | Open in IMG/M |
| 3300008121|Ga0114356_1155198 | Not Available | 1835 | Open in IMG/M |
| 3300008121|Ga0114356_1158823 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda | 2595 | Open in IMG/M |
| 3300008121|Ga0114356_1160237 | Not Available | 1792 | Open in IMG/M |
| 3300008121|Ga0114356_1162269 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea | 1775 | Open in IMG/M |
| 3300008121|Ga0114356_1166818 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea | 3130 | Open in IMG/M |
| 3300008121|Ga0114356_1167961 | Not Available | 1729 | Open in IMG/M |
| 3300008121|Ga0114356_1169164 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus | 2208 | Open in IMG/M |
| 3300008121|Ga0114356_1173893 | Not Available | 3153 | Open in IMG/M |
| 3300008121|Ga0114356_1178602 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 2237 | Open in IMG/M |
| 3300008121|Ga0114356_1184652 | Not Available | 1607 | Open in IMG/M |
| 3300008121|Ga0114356_1185485 | Not Available | 1601 | Open in IMG/M |
| 3300008121|Ga0114356_1186898 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis | 2670 | Open in IMG/M |
| 3300008121|Ga0114356_1187382 | Not Available | 1588 | Open in IMG/M |
| 3300008121|Ga0114356_1190259 | Not Available | 1569 | Open in IMG/M |
| 3300008121|Ga0114356_1196738 | Not Available | 1527 | Open in IMG/M |
| 3300008121|Ga0114356_1196899 | Not Available | 2801 | Open in IMG/M |
| 3300008121|Ga0114356_1199759 | Not Available | 1508 | Open in IMG/M |
| 3300008121|Ga0114356_1199768 | Not Available | 1508 | Open in IMG/M |
| 3300008121|Ga0114356_1200826 | Not Available | 1501 | Open in IMG/M |
| 3300008121|Ga0114356_1207081 | Not Available | 2180 | Open in IMG/M |
| 3300008121|Ga0114356_1208179 | Not Available | 1456 | Open in IMG/M |
| 3300008121|Ga0114356_1211774 | Not Available | 1435 | Open in IMG/M |
| 3300008121|Ga0114356_1220806 | Not Available | 1384 | Open in IMG/M |
| 3300008121|Ga0114356_1222689 | Not Available | 1374 | Open in IMG/M |
| 3300008121|Ga0114356_1232796 | Not Available | 1321 | Open in IMG/M |
| 3300008121|Ga0114356_1239679 | Not Available | 1287 | Open in IMG/M |
| 3300008121|Ga0114356_1249315 | Not Available | 1242 | Open in IMG/M |
| 3300008121|Ga0114356_1251937 | Not Available | 1658 | Open in IMG/M |
| 3300008121|Ga0114356_1252319 | Not Available | 2376 | Open in IMG/M |
| 3300008121|Ga0114356_1256705 | Not Available | 2319 | Open in IMG/M |
| 3300008121|Ga0114356_1258523 | Not Available | 1200 | Open in IMG/M |
| 3300008121|Ga0114356_1264601 | Not Available | 1174 | Open in IMG/M |
| 3300008121|Ga0114356_1269429 | Not Available | 1155 | Open in IMG/M |
| 3300008121|Ga0114356_1272765 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | 1141 | Open in IMG/M |
| 3300008121|Ga0114356_1273509 | Not Available | 1138 | Open in IMG/M |
| 3300008121|Ga0114356_1275639 | Not Available | 1130 | Open in IMG/M |
| 3300008121|Ga0114356_1282917 | Not Available | 1101 | Open in IMG/M |
| 3300008121|Ga0114356_1285852 | Not Available | 1090 | Open in IMG/M |
| 3300008121|Ga0114356_1289039 | Not Available | 1078 | Open in IMG/M |
| 3300008121|Ga0114356_1300335 | Not Available | 1038 | Open in IMG/M |
| 3300008121|Ga0114356_1303060 | Not Available | 1029 | Open in IMG/M |
| 3300008121|Ga0114356_1318656 | Not Available | 977 | Open in IMG/M |
| 3300008121|Ga0114356_1321551 | Not Available | 968 | Open in IMG/M |
| 3300008121|Ga0114356_1321850 | Not Available | 1802 | Open in IMG/M |
| 3300008121|Ga0114356_1322604 | Not Available | 965 | Open in IMG/M |
| 3300008121|Ga0114356_1323239 | Not Available | 963 | Open in IMG/M |
| 3300008121|Ga0114356_1323264 | Not Available | 963 | Open in IMG/M |
| 3300008121|Ga0114356_1324212 | Not Available | 960 | Open in IMG/M |
| 3300008121|Ga0114356_1336705 | Not Available | 923 | Open in IMG/M |
| 3300008121|Ga0114356_1337550 | Not Available | 920 | Open in IMG/M |
| 3300008121|Ga0114356_1349106 | Not Available | 888 | Open in IMG/M |
| 3300008121|Ga0114356_1350933 | Not Available | 1502 | Open in IMG/M |
| 3300008121|Ga0114356_1358362 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 864 | Open in IMG/M |
| 3300008121|Ga0114356_1358536 | Not Available | 864 | Open in IMG/M |
| 3300008121|Ga0114356_1367343 | Not Available | 841 | Open in IMG/M |
| 3300008121|Ga0114356_1369646 | Not Available | 836 | Open in IMG/M |
| 3300008121|Ga0114356_1390172 | Not Available | 788 | Open in IMG/M |
| 3300008121|Ga0114356_1391807 | Not Available | 785 | Open in IMG/M |
| 3300008121|Ga0114356_1402666 | Not Available | 761 | Open in IMG/M |
| 3300008121|Ga0114356_1433680 | Not Available | 700 | Open in IMG/M |
| 3300008121|Ga0114356_1461045 | Not Available | 652 | Open in IMG/M |
| 3300008121|Ga0114356_1469723 | Not Available | 638 | Open in IMG/M |
| 3300008121|Ga0114356_1491363 | Not Available | 605 | Open in IMG/M |
| 3300008121|Ga0114356_1516448 | Not Available | 568 | Open in IMG/M |
| 3300008121|Ga0114356_1519631 | Not Available | 564 | Open in IMG/M |
| 3300008121|Ga0114356_1542164 | Not Available | 534 | Open in IMG/M |
| 3300008121|Ga0114356_1544588 | Not Available | 531 | Open in IMG/M |
| 3300008121|Ga0114356_1552341 | Not Available | 522 | Open in IMG/M |
| 3300008121|Ga0114356_1555311 | Not Available | 520 | Open in IMG/M |
| 3300008121|Ga0114356_1572061 | Not Available | 504 | Open in IMG/M |
| 3300028027|Ga0247722_10080793 | Not Available | 1219 | Open in IMG/M |
| 3300028027|Ga0247722_10262826 | Not Available | 597 | Open in IMG/M |
| 3300028027|Ga0247722_10277577 | Not Available | 577 | Open in IMG/M |
| 3300028027|Ga0247722_10312796 | Not Available | 535 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 98.27% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300008106 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTR | Environmental | Open in IMG/M |
| 3300008121 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-100-LTR | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0114339_11214192 | 3300008106 | Freshwater, Plankton | MIISGLILNTFESSSNFGESWGGSKNWLKPKIEPPLGNLACPNM* |
| Ga0114339_11675892 | 3300008106 | Freshwater, Plankton | MIVFGLILTTFELSSIFGGSWGSIENWLKPKTKPL* |
| Ga0114356_10001676 | 3300008121 | Freshwater, Plankton | MIIFVSIVTTFESSSIFGDSWGSIEIWLKPNTKPPSENLACPNL* |
| Ga0114356_10009376 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFEFSSIFGGNWGSFENWLEHKIGPPSGNLACPNPSIALNLTIE* |
| Ga0114356_10009525 | 3300008121 | Freshwater, Plankton | MVIFGSILTTFELSSIFGGSWGSIENWLEPKIKTPSRNLACQNL* |
| Ga0114356_10011513 | 3300008121 | Freshwater, Plankton | MIMFGLILTTLEFSIIFGGSWENIENWLEPKTKTPSGN* |
| Ga0114356_10017832 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFELSIIFEGCWGSIENWLKPKIEPTSGNLACPNP* |
| Ga0114356_10020168 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESSSIFGASWGSIENWLNPKTEPPLGNLA* |
| Ga0114356_10022635 | 3300008121 | Freshwater, Plankton | MIIFGSILTTLESSSIFGGSWGSIENWLEPKTKPPSINLDCPNL* |
| Ga0114356_100247711 | 3300008121 | Freshwater, Plankton | MIIFGSILITFESTGIFGGNWGIIENWLEPKTKPPSGNLA* |
| Ga0114356_10028145 | 3300008121 | Freshwater, Plankton | MDLEKRSKIVIFGLILTTFELSKIFGGSWGSIENWLEPKIKPPFGNLACPNL* |
| Ga0114356_10028562 | 3300008121 | Freshwater, Plankton | MIIFGTIFTTFESSRIIGDSYGSIENWLETKTEPPSENLAFRNP* |
| Ga0114356_10031222 | 3300008121 | Freshwater, Plankton | MIIFGPILTVFELSRILGGSWGSVENWLESKTEALSGNLACPNP* |
| Ga0114356_10047681 | 3300008121 | Freshwater, Plankton | MIIFWSILTTFELSIIFGGRWGRTENWLNPKTKQPSGNLACPIP* |
| Ga0114356_10058945 | 3300008121 | Freshwater, Plankton | VIIFGSILTTFESSSIFGGSWGSIENWLEPNMAPPSGNLACPNL* |
| Ga0114356_10061877 | 3300008121 | Freshwater, Plankton | MIIFGFILTTFESSIISGGSWGSVEIWLEPETKPLSGNLAFQNP* |
| Ga0114356_10061893 | 3300008121 | Freshwater, Plankton | MYYFFTYNLLIFATFESSSIFGGSWGSIENWLEPKIKPPSGNLACPNL* |
| Ga0114356_10079794 | 3300008121 | Freshwater, Plankton | MIILGSFLTTSELISIFEGSSGGVENWLEPKTEPPLGYLACPNL* |
| Ga0114356_10084852 | 3300008121 | Freshwater, Plankton | MIILGSILTPFEASSIIGGSWDSIENWLKPKSKPPSGNLVYPNL* |
| Ga0114356_10085373 | 3300008121 | Freshwater, Plankton | MFIFGLILTTIELSIIFGGSRGRIENWLELKTAPPSGNLACPNL* |
| Ga0114356_10087286 | 3300008121 | Freshwater, Plankton | MIIFESILTTFELSSIFGGSWGSIENSLEPKTKPTPEN* |
| Ga0114356_10087352 | 3300008121 | Freshwater, Plankton | MIIFWSILTTYESSTIFGGSWDSIENWFEPKTEPP* |
| Ga0114356_10088972 | 3300008121 | Freshwater, Plankton | MIIFGSIITTFETSIIFGGSWDSIENWLEPKTKPPLGNLACPNP* |
| Ga0114356_10094462 | 3300008121 | Freshwater, Plankton | MIIFGFILTTLESSNIFGGSWGSIENLLKPKTETSSGNFASPNLYVQTSLI* |
| Ga0114356_10095903 | 3300008121 | Freshwater, Plankton | MLTPFEASMIFWCSWGSVENWLEPKAEPPSENLARPNP* |
| Ga0114356_10102113 | 3300008121 | Freshwater, Plankton | MIFFGSILTTFKSGSIFEGSWGSIENWLEPKTQPP* |
| Ga0114356_10104542 | 3300008121 | Freshwater, Plankton | MSDDFFGPILTTFESSSIFEGSWGCIENWLEPKTKPPLGNLACPNL* |
| Ga0114356_10106554 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFESISIFGGSLGSIENCLEPKTEPPSKNLACPNA* |
| Ga0114356_10115157 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESRNIFGGSWGSIENWLEPKIEPPLGNLACPNL* |
| Ga0114356_10120784 | 3300008121 | Freshwater, Plankton | MIIFGPILTTFKLSIVYRGSWGSIENWLEPKTKPPSGNLACSNP* |
| Ga0114356_10124591 | 3300008121 | Freshwater, Plankton | MIIFGLIVTTFESSSILGGSRGSIEKELKPKTKPPLGNLACPNP* |
| Ga0114356_10132803 | 3300008121 | Freshwater, Plankton | MIIFGSIFTTKEIFGGSWGSIEKWLEPKTKPPLVNLACPNPRNARSVQTLEYHKKF* |
| Ga0114356_10134603 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESSSIFGGSWGTIENWLDPETKPPSGNLACPDL* |
| Ga0114356_10143915 | 3300008121 | Freshwater, Plankton | MIIFGSILTNSESSIFGCSWGSIENWLEPKTKPPSGNLACLNP* |
| Ga0114356_10146411 | 3300008121 | Freshwater, Plankton | MIIFGLILMSFESSSIYGGSWGSIENWLEPKIEPT* |
| Ga0114356_10147502 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFELSSIFGGSWGSIENWLKPKIEPSSGNLACPNL* |
| Ga0114356_10159122 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESRSAFGGSWGSNKNLLEPKTKQPLGNLACPNP* |
| Ga0114356_10161041 | 3300008121 | Freshwater, Plankton | MIILKSILTTFELSSIFGGSWGIIENWLEPIIKTPLGNLACPNL* |
| Ga0114356_10173863 | 3300008121 | Freshwater, Plankton | MVIFGLILTTFELSSIFGGSWGSSENRLEPKIKPLSGNSACPNLPNAL* |
| Ga0114356_10174741 | 3300008121 | Freshwater, Plankton | MKQDDYFGLILTTFELIIIFKGSRGSNENWLKLKTKPPSGNSACPYP* |
| Ga0114356_10178274 | 3300008121 | Freshwater, Plankton | MIILRSILTTFESSSIFEGSWGSFENWLEPKIKPPSGNVACSNP* |
| Ga0114356_10184104 | 3300008121 | Freshwater, Plankton | MIIFGSILITLEPSSIFGGSWGSIENWLEPKTELPSGNLARPNL* |
| Ga0114356_10206111 | 3300008121 | Freshwater, Plankton | MIILGLILTTFEWSSIFGGSWGSIENWLKPKTEPPSGNLACPNW* |
| Ga0114356_10213232 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFELGIIFGGIWGSIENWLEPKTKPPSGNSACPNP* |
| Ga0114356_10218913 | 3300008121 | Freshwater, Plankton | MIVFGSAILITFESSSISGGSWGSIENWLEPKTEPPLGNLACPHL* |
| Ga0114356_10222619 | 3300008121 | Freshwater, Plankton | SKMIIFTSILTTFEFSSTFGGSWGSNENWLGPKTKPPIFKI* |
| Ga0114356_102255516 | 3300008121 | Freshwater, Plankton | MIIFGSILTAFELSSIFGGCWGSIENWLEPKIKPSMGNLACPKL* |
| Ga0114356_10227661 | 3300008121 | Freshwater, Plankton | MILTSFKLSIVFGGSWGSTENWLEPKNKPPSGNLACPNL* |
| Ga0114356_10228272 | 3300008121 | Freshwater, Plankton | MIIFGSTLTTFESSVIFIGTCWGSFKDWLEPKTEPPSGNLACPNP* |
| Ga0114356_10228982 | 3300008121 | Freshwater, Plankton | MIIFWSILVIFESSILFGGSWGSIENWLVPKTDPPSGNLACPNP* |
| Ga0114356_10233701 | 3300008121 | Freshwater, Plankton | MIIFESILTSLKSSSVSESSWGSIENCLVPKTNPPTENLACPNP* |
| Ga0114356_10238064 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFEMSRIFGGSWGSIENWLEPKTEPPLGYLACPNP* |
| Ga0114356_10255622 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFELSSIFGGSWGSIENWLEPKIKSPSGNLACPNL* |
| Ga0114356_10260721 | 3300008121 | Freshwater, Plankton | FETSIIFGDSWGSIENWLDPKTEPPSGNLACPNPRNAL* |
| Ga0114356_10261181 | 3300008121 | Freshwater, Plankton | LTTFESSSIFGGSWGGIENWLKPKTEPPSGNLACPNP* |
| Ga0114356_10261451 | 3300008121 | Freshwater, Plankton | MIFFGSILTTFELSRIFGVNWGNIENWLEPKTKPPLGNLACPNL* |
| Ga0114356_10275072 | 3300008121 | Freshwater, Plankton | MDLDSQSEMIIFGSILTTFESSRSSIFGDSWGIIKNWLEPKTEPPLGNLACPNP* |
| Ga0114356_10282021 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFEMSIIFGGSWGSIENWLEPKTEPPLGNLACPNP* |
| Ga0114356_10284382 | 3300008121 | Freshwater, Plankton | IFTTFELSSIFGGSWGSNENWLKPKIEPPLGNLACPNL* |
| Ga0114356_10288181 | 3300008121 | Freshwater, Plankton | MIILGLILTTFESSRIFGGSWGSFKNWLELKTEPLSGNLACPNR* |
| Ga0114356_10293392 | 3300008121 | Freshwater, Plankton | MTIFGSILTPFESGIIFGGSWGSIENWLEPKSEPPSGNLSCQNP* |
| Ga0114356_10308023 | 3300008121 | Freshwater, Plankton | MIIFESVLTTFELGSIFGGIWGSIENWLQHKIEPPLGNLACPNL* |
| Ga0114356_10334422 | 3300008121 | Freshwater, Plankton | MIIFESILTSFELSSVFGGSLGSIENRFEPKTKPSSGNLACPNL* |
| Ga0114356_10344632 | 3300008121 | Freshwater, Plankton | MDLDKQCEMIIYGSILTTIESSSIFGGSWGSIENWLEPNIESPSGNIACPNP* |
| Ga0114356_10357034 | 3300008121 | Freshwater, Plankton | MIIFGLILTPFESSSIFGGSWGCIENWLEPKIEPTL* |
| Ga0114356_10357052 | 3300008121 | Freshwater, Plankton | MGLDERIEMIIFELILTTFKLSVIFRGSLDSSDNWLEPKIKPPSANLAGPNL* |
| Ga0114356_10366543 | 3300008121 | Freshwater, Plankton | MIIFGLILTTLESSTIFGGSRDSIENWLEPKKKPSSGNLACPHP* |
| Ga0114356_10380515 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESSSIFGGSLESIENWLEPKTKPLSGNLACPNP* |
| Ga0114356_10383447 | 3300008121 | Freshwater, Plankton | MIIFGLIFTTCELRIIFGDSWGIIENWLKPKIEPPSGNFACSNL* |
| Ga0114356_10394871 | 3300008121 | Freshwater, Plankton | MIIFWLILTTFESSSIFGGNWGSIENWLEPKNKTPLVNLACPNP* |
| Ga0114356_10402201 | 3300008121 | Freshwater, Plankton | MIIFWSILTTFESSSIFGGSWGSIENWLKPKTEPPSGNLACPNP* |
| Ga0114356_10406413 | 3300008121 | Freshwater, Plankton | MIIFESNLAIFKSSIIFGGSWGSIENWLKPKTEPPSGNLACPNQ* |
| Ga0114356_10419312 | 3300008121 | Freshwater, Plankton | MMIIFELILTTFKSSVILRRSWDSCENWFELKIDPPSGILACQNP* |
| Ga0114356_10476394 | 3300008121 | Freshwater, Plankton | MIIFGSALTTFEPGIIFGGIWGSMENWLEPKIEPPSGNLACPNL* |
| Ga0114356_10477855 | 3300008121 | Freshwater, Plankton | MIILGSIFTTFELSNIFGGSWGSIDNWLEPKTKPKLREW* |
| Ga0114356_10489881 | 3300008121 | Freshwater, Plankton | MIIFGFILTTFELSCIFGGSWGITENWLELKIKPPSGNLAG* |
| Ga0114356_10496303 | 3300008121 | Freshwater, Plankton | MIVFGLFLTTFESSSIFEGGWSSIENWLKPETEPRSGTLACTKP* |
| Ga0114356_10505211 | 3300008121 | Freshwater, Plankton | VNRDDFLGPILTTFELSSILEGSWGSIENWLEPKTKPPSGI* |
| Ga0114356_10505893 | 3300008121 | Freshwater, Plankton | MIILGLILATFESSSIFGGSWGSIENWLESKTEPPSGNLACPNWSNAL* |
| Ga0114356_10528592 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFKLSSIFGGSSGSIENWLEPKTEQPSGYLACPNP* |
| Ga0114356_10529262 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESIRIFGGSWDSIENWLEPKTKPPWGNLAGPNL* |
| Ga0114356_10542434 | 3300008121 | Freshwater, Plankton | MIIFGSMLTTFESTIIFEGSWGSIENSLEPETKPPSGNLACPSL* |
| Ga0114356_10553542 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESSSIFGGSWVSIENWLKPKTKPP |
| Ga0114356_10560741 | 3300008121 | Freshwater, Plankton | MIIFGLLLTTFQSSSIFEGSWGSIENWLEPETKPPSENLACPNL* |
| Ga0114356_10567982 | 3300008121 | Freshwater, Plankton | MIIFESILISFKPSLIFGGSWGCTENWLEPKTEPPLGNLACPNM* |
| Ga0114356_10571581 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESISILRGSWGRIENWLKPKTEPPSGNLACQNM* |
| Ga0114356_10578212 | 3300008121 | Freshwater, Plankton | MKRDDYYWVILTTFELSSIFQGSWGSIENWLKPKIEPSSGNLALPNL* |
| Ga0114356_10579204 | 3300008121 | Freshwater, Plankton | MIMFGLILTTFELSVIFGGSWGSIENWLEPKIEPSSGNLARPNW* |
| Ga0114356_10606144 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFESSSIFGGSWGSIENWLEPKIEPPSGILACPNL* |
| Ga0114356_10616371 | 3300008121 | Freshwater, Plankton | MIIFGSKLTKFELGIIFGGSWGSIENWLKPKTKQPSGNLACPNP* |
| Ga0114356_10619704 | 3300008121 | Freshwater, Plankton | MIISGLILTTFESGSNFGESWGGSKNWLKPKIEPPLGNLACPNM* |
| Ga0114356_10644281 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFKLSSIFGGSLGSIENWLEPKIEPSSGNLACPNL* |
| Ga0114356_10651802 | 3300008121 | Freshwater, Plankton | MIVFESIFTTFESSSIFGGSWGSIENWLKPKTEPPSGNLACPNP* |
| Ga0114356_10653221 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFELSSIFGGSWGSIEDWLEPKTEPPLGKLACPEL* |
| Ga0114356_10670402 | 3300008121 | Freshwater, Plankton | MIIFGFVLTTFELSSILGGSWGSIENWLEPKIESPLGNLACPNL* |
| Ga0114356_10686482 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFKSSIIFESSWGSIQNWLDPKTESPLENLACPNA* |
| Ga0114356_10690094 | 3300008121 | Freshwater, Plankton | MIIFESILTTFELSSIFEGSWGIIENWLKLKTEQPL* |
| Ga0114356_10694344 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFELSSIFGSSWGSIENWLEHKIGPPSGNFGCPDL* |
| Ga0114356_10710152 | 3300008121 | Freshwater, Plankton | MIIFESILTTFELSIIFGGRWGSIENWLEPKIEPPSGNIACPNM* |
| Ga0114356_10733724 | 3300008121 | Freshwater, Plankton | MIIFGSILSPFELSSIFGGSWGSTENWLESKIEPPSGNLA |
| Ga0114356_10735632 | 3300008121 | Freshwater, Plankton | MIIFGLLLTIIESSSIFGGSWGCIENLLEPKTKLPS |
| Ga0114356_10759302 | 3300008121 | Freshwater, Plankton | MIILGMILTTFESSSIFGGSWGSIENWLEPKTEPPLGNLACPNR* |
| Ga0114356_10760184 | 3300008121 | Freshwater, Plankton | MIIFESILTTFELSSIFGGRWGSIENWLKPKIEPSSGNLACPNL* |
| Ga0114356_10779034 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFVESSIIFGGSWGSIENWLDPEAEPPAGNLACPNP* |
| Ga0114356_10783032 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFQLGSIFGGSWGNIENWHKPKTKPPQARLNL* |
| Ga0114356_10787683 | 3300008121 | Freshwater, Plankton | MIILGSIMTTFELSSIFGGSWGILKNRLRPKTKPTLGNLACPNP* |
| Ga0114356_10790032 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFELSIIFGGSWGSIENWLKLKTEPPSGNLACPNS* |
| Ga0114356_10790992 | 3300008121 | Freshwater, Plankton | MIILGSILTTFESSSIFGGSWGSIENCLEPKTVPPSGNLACPNP* |
| Ga0114356_10819083 | 3300008121 | Freshwater, Plankton | MIVFGLILTTFESRSFFGGSWKNIENWIEPKTEPPLGILACTNQ* |
| Ga0114356_10871261 | 3300008121 | Freshwater, Plankton | LLTTFEWSTIFGGSRGSIENWLEPKIEPPSENFACQNP* |
| Ga0114356_10873844 | 3300008121 | Freshwater, Plankton | MIIFGSILSTFELSSIFGGSWGSIENWLEPKIKPPSGNFACLNLRNAL* |
| Ga0114356_10916211 | 3300008121 | Freshwater, Plankton | MVIFELILTLTLFKSSIIFGGSWGNCLNWLEPKIDPISGNLACPNL* |
| Ga0114356_10917841 | 3300008121 | Freshwater, Plankton | MNIFGSILTTFESSIIFGGGWGSIENWFEPKTEPPTINLAYPNP* |
| Ga0114356_10922242 | 3300008121 | Freshwater, Plankton | MIIFVLILTSFELSNIFGGSLGRIENWLKLKNKPPSGNLACPNL* |
| Ga0114356_10935711 | 3300008121 | Freshwater, Plankton | MIIFELILTHFKSSIIFGGSWGSSVNWLELKIEPPS |
| Ga0114356_10955181 | 3300008121 | Freshwater, Plankton | MIIFGLIFTTYELSSIIGGSWGSIENWFEPKTEPPPGNLACPNP* |
| Ga0114356_10959203 | 3300008121 | Freshwater, Plankton | MIIFGPIFTTSELSIIFEGSEGSTENWLEPKTKPPKGNLACPNLLNAL* |
| Ga0114356_10977912 | 3300008121 | Freshwater, Plankton | MIIFGLILTIFELSSIFRGNWDSNENWLELSTKPPLGYLACPNL* |
| Ga0114356_10983603 | 3300008121 | Freshwater, Plankton | LLIFESILTSFKTSIIFGGSLGIAENWLEPKTKQPSGNLACPNL* |
| Ga0114356_11001442 | 3300008121 | Freshwater, Plankton | MIIFGSILTAFEASFNLEGSWDSTKNWLKPKTEPPSGNLAFPNP* |
| Ga0114356_11013191 | 3300008121 | Freshwater, Plankton | MIIFWLILTTFELSSIFGGNWGSFENWLESKIKPPLGN* |
| Ga0114356_11036422 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFELSIIFGGSWGSIENWLEPKTEPPSENSACPYP* |
| Ga0114356_11040971 | 3300008121 | Freshwater, Plankton | MIIFGSMLNTFNGALFLSWGLSWSSIENWLKPKTEPPSGNLDCPNP* |
| Ga0114356_11049321 | 3300008121 | Freshwater, Plankton | MIIFVSILTTFESSNIFGGSWGSIENWLDLKTKTPSENLVCPDL* |
| Ga0114356_11058581 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFEWSNIFWGSWGSIENWLKPKIEPK* |
| Ga0114356_11064973 | 3300008121 | Freshwater, Plankton | MIIFGSILTAFEVKLFFGGSWGSIVNWLEPKTKPPSGNI* |
| Ga0114356_11066703 | 3300008121 | Freshwater, Plankton | MIIFGKILTVFESSSIFGGSWGSIENWLEPKTEPPSGYLACPNP* |
| Ga0114356_11093471 | 3300008121 | Freshwater, Plankton | MIIVGSILTTFEFSSIFGGNWGSIENWLEPKTEPPSEN* |
| Ga0114356_11128234 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESGSIYGGSWDSIENFLEPKTKPPSGNLACLNL* |
| Ga0114356_11129753 | 3300008121 | Freshwater, Plankton | MLNFWSILTTFELSIIFKGSWGNIENWLKPKTEQPSGNLPCPNL* |
| Ga0114356_11153833 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFEVSSIFGGSWGSIENWLEPKIKPASGNLAYPNL* |
| Ga0114356_11171721 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFELSNIFGGSWGSIENWLEPKTKQSSGNLACPNP* |
| Ga0114356_11188304 | 3300008121 | Freshwater, Plankton | MIIFGSNLTTFELSSIFGGSWGSIENWIELKAEPPAQNLACPNP* |
| Ga0114356_11216684 | 3300008121 | Freshwater, Plankton | MIIFGLILPTFELGIIFGGSWGSIENWLEPKTKPPSGN* |
| Ga0114356_11278093 | 3300008121 | Freshwater, Plankton | MIIFWSILITFELSIIFGGNWGSIENWFEPKAKPPSGNLACPNP* |
| Ga0114356_11304051 | 3300008121 | Freshwater, Plankton | MIVFGSILTRFEWSSIFGGRWGSIENWLEPKTEPTLEYSACQNL* |
| Ga0114356_11338633 | 3300008121 | Freshwater, Plankton | MIIFWLILTTFKSNNIFGGSWGSIENWLEPKTEPPMGNLACPNP* |
| Ga0114356_11340741 | 3300008121 | Freshwater, Plankton | MIIFGPVLTPFESSSTFGGSWGIIENWLGPKTEPPLENLASSNL* |
| Ga0114356_11391473 | 3300008121 | Freshwater, Plankton | MIIFESIVTTFELSSVFRGSWGNIENWLESKNKPPSGNIACPNP* |
| Ga0114356_11397551 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESGSIFGGSFGSIENWLKPKTEPPSGNLACPNP* |
| Ga0114356_11416352 | 3300008121 | Freshwater, Plankton | MIIFGLILNTLESCSIFGGSWASIENWLEPKIELPSGNLACPNIVKLSVSFN* |
| Ga0114356_11418321 | 3300008121 | Freshwater, Plankton | TTFKLSSIFGGSWCSFENWLEPKTEPPSENLACPNP* |
| Ga0114356_11420843 | 3300008121 | Freshwater, Plankton | MIIFGSIFTTFELSSIFGGSWGSIENWFKPKIEPPSENLACPNP* |
| Ga0114356_11427522 | 3300008121 | Freshwater, Plankton | MIIFGVIMANFELSCIFGGSWGSIENWLEPKTEPQSANSACPNP* |
| Ga0114356_11430602 | 3300008121 | Freshwater, Plankton | MIIYGSILTTFELSSIFGGSWESIENWLELKTKPPSENLNYPNP* |
| Ga0114356_11452071 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFELSSFLEAAGAVLKNWLKPKTEPPSGDLAWPNL* |
| Ga0114356_11473151 | 3300008121 | Freshwater, Plankton | FELSSIFGGSWGSIENWLEPKIKPPLGNLACLNL* |
| Ga0114356_11475082 | 3300008121 | Freshwater, Plankton | MIILGSILTTFESSSIFGGSWGSIENWLDPKIEPPSGNLACPNL* |
| Ga0114356_11490711 | 3300008121 | Freshwater, Plankton | MIILGSILTTFESSSIFEGSWGSIKNWLEPKIEPASGNLACQNL* |
| Ga0114356_11506421 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFELSSIFGGSWGSIESWHEHKIKPPSGNLACPNL* |
| Ga0114356_11529091 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESSSIFGGSWGNIENCFEPKTEPPMGKLGVPNPLNAVCR* |
| Ga0114356_11551981 | 3300008121 | Freshwater, Plankton | FILTTFESSSLFGGSWGSIENWLELKTEPPSGNLACKNQ* |
| Ga0114356_11588232 | 3300008121 | Freshwater, Plankton | MIIFGSILTALESSSIFRGSWGSIENWVEPKNKPTSGYLACPNL* |
| Ga0114356_11602371 | 3300008121 | Freshwater, Plankton | MIIIGSILTTFDSRSIFGGSWGSTEDWLEPKTKPPSGNLACPNL* |
| Ga0114356_11622692 | 3300008121 | Freshwater, Plankton | MIIFGLILATFELSRIFGGSWGSIENWLKLKTGPPSGNFACSNP* |
| Ga0114356_11668183 | 3300008121 | Freshwater, Plankton | MIIFGSILTTLELSSILGGSSWGSIENWLEPKTKHPLGNLGYPNP* |
| Ga0114356_11679612 | 3300008121 | Freshwater, Plankton | MVIFGLILTTNESSSIFGGSWGSFENWLEPNTKLALGNLACPNP* |
| Ga0114356_11691641 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFELSSIVGGSWGSIENWLEPNIEPPSGNLACPNP* |
| Ga0114356_11738932 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESSSIFGGSWISIENWLEPQTKPPLGNLACPNL* |
| Ga0114356_11786022 | 3300008121 | Freshwater, Plankton | MIIFGLILTTLESSIIFGGSKGSIENWLEPKTKPPSRNLACPQ* |
| Ga0114356_11846522 | 3300008121 | Freshwater, Plankton | MIIFVWILATFESLNIFGGSWGSIENWLEPKTKPPWGNLACQN* |
| Ga0114356_11854851 | 3300008121 | Freshwater, Plankton | MIIIWLLLTIIESSSVFGGSWGSIENWLEPKTKLPSGNLACPNP* |
| Ga0114356_11868982 | 3300008121 | Freshwater, Plankton | MIIFGSLLTIFESSSSFGGSLGSIENWLENKTKPPSGNLASPNP* |
| Ga0114356_11873821 | 3300008121 | Freshwater, Plankton | MIIFGTILTTFEMSIIFGGSWGNIENWLEPKNKPPSGNLACPNL* |
| Ga0114356_11902593 | 3300008121 | Freshwater, Plankton | MIIFGVNFESSSIFGGILGSIENWLEPKTDPPSGN* |
| Ga0114356_11967383 | 3300008121 | Freshwater, Plankton | MIIFGSILTTSESSSIFGGSWGSIENWLEPKIEPSSGNLACPNP* |
| Ga0114356_11968993 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESSSIFEGSWGRIENWLEPNTKPPLGN* |
| Ga0114356_11997591 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFELSIIFRGSWDSIENWLKPKTKPPSGNLVCPNP* |
| Ga0114356_11997681 | 3300008121 | Freshwater, Plankton | MFIFGLILMTFELSSIFGGSWGSIENWLEPKIEPT* |
| Ga0114356_12008261 | 3300008121 | Freshwater, Plankton | MIIFGSILTFFANFELSIIFRGSWGSIENWLEPKTKPPQENLACPNL* |
| Ga0114356_12055871 | 3300008121 | Freshwater, Plankton | MIILGFILTTFESSSIFGGSLGSIEKWLEPKTEPPSGNLACPNRRNAL* |
| Ga0114356_12070812 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFELSSIFGAIENWLEPNTKPPSVNFAFPNP* |
| Ga0114356_12081792 | 3300008121 | Freshwater, Plankton | MVIFGSILMIFELSSIFGGSWGSIENWLEPKIKPQTGNLAFTNL* |
| Ga0114356_12117742 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFKSSSIFGGSWSSIENWLKPKTKPPF* |
| Ga0114356_12146582 | 3300008121 | Freshwater, Plankton | MIIFGSILTIFESSNIFGGSWGSNENWLKPKTKPPLGS* |
| Ga0114356_12208061 | 3300008121 | Freshwater, Plankton | MLVFESILTTFELSIIFGGSCASIENSLKPKTEPPSGNL |
| Ga0114356_12226892 | 3300008121 | Freshwater, Plankton | MIIFESILTTFESISVFGGSGGSIENWLEPKTKPT* |
| Ga0114356_12327963 | 3300008121 | Freshwater, Plankton | MIIFWSILTTLEPISIFGGSWGSIENWLKPKTKPPSG |
| Ga0114356_12396791 | 3300008121 | Freshwater, Plankton | MIIFVSILTTFEMSIIFGGSRGSIENWLEPKTEPPLGNLACPN |
| Ga0114356_12448171 | 3300008121 | Freshwater, Plankton | MIIFGSNLTTFESSIISGGSWGSIENRLENKTKPPSGNLAFPNL* |
| Ga0114356_12493152 | 3300008121 | Freshwater, Plankton | MIIFGDDLTTFESSSISGGSWGNIENWLELQTKSPLGNLACPIP* |
| Ga0114356_12519371 | 3300008121 | Freshwater, Plankton | YFLAILTTFELSSIFGGSWGSIGNWLKPKTEPPSRTLV* |
| Ga0114356_12523191 | 3300008121 | Freshwater, Plankton | MIIYGSNLTAFELSVIFGGSWVSIENWLELKTKPPSGNLACPNP* |
| Ga0114356_12567052 | 3300008121 | Freshwater, Plankton | MIILGSILTTFASSNIFGDSWGSNENWLETKIKQPSGNLVCRDL* |
| Ga0114356_12585231 | 3300008121 | Freshwater, Plankton | ILTTFESSSIFGGSWGNIENWLKHKTEPPRENLACPNL* |
| Ga0114356_12646011 | 3300008121 | Freshwater, Plankton | MEIIIFGWILTTFESSIIFGGSWGSIENWLEPKTKPPSGNLACPNL* |
| Ga0114356_12694291 | 3300008121 | Freshwater, Plankton | MIIFVSILTTFEFSSILGGIWGSIENWLEPKTEPSSGNLACPNP* |
| Ga0114356_12727651 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFEPSISFGDSWVGNENWLKPKTEPPSGNLACPNPWNTL* |
| Ga0114356_12735091 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFESSRIFGGSWGSIENWLEPKTKPPS* |
| Ga0114356_12756391 | 3300008121 | Freshwater, Plankton | MDLDYQSQKIIFESILTTFESSSIFGGSWGSIENWLKPKTKQPPSENLACQNL* |
| Ga0114356_12829171 | 3300008121 | Freshwater, Plankton | LILTIFESSSIFGGSWDSIENWLESKTEPPSGNLACPNR* |
| Ga0114356_12858522 | 3300008121 | Freshwater, Plankton | MIIFGSILATFELSIIFGGSWGSIEFLLEPKTDPPSGNIACPNP* |
| Ga0114356_12890391 | 3300008121 | Freshwater, Plankton | MIIFGSTLTTFELSSIFFGSWGSIENWLEPKIKPPSGNLAYPNL* |
| Ga0114356_13003353 | 3300008121 | Freshwater, Plankton | ILSTFELSSICGGSLGSIENWLEPKTKSTSGNLACPNL* |
| Ga0114356_13030601 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFESSTIFGGGWSSIENWLKPEAEPPSGNLTCCPKL* |
| Ga0114356_13098492 | 3300008121 | Freshwater, Plankton | MLTTSELSIIFRGSWGSIENWLEPQAEPPSGNLACPNPRNALK* |
| Ga0114356_13186561 | 3300008121 | Freshwater, Plankton | MMIDFESILPFFEPSSIFKGSWGNIESWLEPKTKPPSGNLACQNP* |
| Ga0114356_13215511 | 3300008121 | Freshwater, Plankton | MIIFGSILTAFELSSIFEGSWGIIENWLKLKTEQPLGNLACPNP* |
| Ga0114356_13218501 | 3300008121 | Freshwater, Plankton | MNQESSIIFGDSWGSIENWLKPKTEPPLGNLASPNL* |
| Ga0114356_13226041 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFELSSIFGGSWGSIENWLEPKMEPSSGNLACPNL* |
| Ga0114356_13232391 | 3300008121 | Freshwater, Plankton | MIIFVSILTTFESSSIFEGSWGRIENWLEPNTKPPLGNLACPNM* |
| Ga0114356_13232642 | 3300008121 | Freshwater, Plankton | MIIFVSICTTFGSSSIFGGSWGSIENWLEPKIEPALENLACPHL* |
| Ga0114356_13242121 | 3300008121 | Freshwater, Plankton | EIIIFGSILITFELSSIFGGSWGSIENWLEPKIEPPLGNLVSPNL* |
| Ga0114356_13367051 | 3300008121 | Freshwater, Plankton | FFISFKQSIIFGGSLGSTENWLEPKPKPPSGNLACPNM* |
| Ga0114356_13375501 | 3300008121 | Freshwater, Plankton | DDYFFFWWILTTFELSSTFGGSWGKIKNWLEPKSQISLGNLAYPNP* |
| Ga0114356_13491061 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFKMSSIFGGSWGSIENWLEPKIKPPSGNLACPKL* |
| Ga0114356_13509331 | 3300008121 | Freshwater, Plankton | MINFGSILTIFESLSIFGSSLGSIENWLEPKIKPPLENLDSPNL* |
| Ga0114356_13583621 | 3300008121 | Freshwater, Plankton | MIIYGSNLTTFKSRRIFGGSWGSIENGLEPKTEPPSGNLACQNP* |
| Ga0114356_13585361 | 3300008121 | Freshwater, Plankton | MIIFGSILSTFELSSSFGGSWGNIENWLEPKTKPPSGNLACPNL* |
| Ga0114356_13673432 | 3300008121 | Freshwater, Plankton | MIVFGLILTTFESISIFGDRWGSIENWLEPKTEPP |
| Ga0114356_13696461 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFKLSSIFGGSWGSIENWLEPKTKPPSGNLAYPNP* |
| Ga0114356_13849611 | 3300008121 | Freshwater, Plankton | MIIFGSILTIFESSIIFDAAGAVLKNWLNPKTKLPLGNLASPNL* |
| Ga0114356_13901721 | 3300008121 | Freshwater, Plankton | MIILGSILTTFESSSIFGGSWGSIEDWLKPKIESTLGN |
| Ga0114356_13918072 | 3300008121 | Freshwater, Plankton | MIIFGTTFTTFESSIIYGGSWGSIENWFEPKTEPSLGNLACPNP* |
| Ga0114356_14026661 | 3300008121 | Freshwater, Plankton | MIIFWPILTTFESSSISESSWGSVENWLQPKTEPQSGNLECPNP* |
| Ga0114356_14336801 | 3300008121 | Freshwater, Plankton | MIILESILTAFESSSIFGGSWGSIENWLKPKIEPK |
| Ga0114356_14610451 | 3300008121 | Freshwater, Plankton | MIIFGSILTTFELSIIFGGSWGSIENWLEPKIEPPSGNIACPN |
| Ga0114356_14697231 | 3300008121 | Freshwater, Plankton | LTTFESSSIFGDSWGSFDNWLEPKTDPPSGNLACPDR* |
| Ga0114356_14913631 | 3300008121 | Freshwater, Plankton | LIFELILTTFKPSFIFKGSWGSIENWLKPKTEPPSGNLACPIL* |
| Ga0114356_15164481 | 3300008121 | Freshwater, Plankton | MIIFGSLLTTFESSIIFGGRWGSIENWLKPKTKQPKGNLACPNL* |
| Ga0114356_15196311 | 3300008121 | Freshwater, Plankton | MIIFESILATFKPSIIFRGSWGSIENWLEPKSEPPSGNLACPNP* |
| Ga0114356_15421642 | 3300008121 | Freshwater, Plankton | MIIFGLILTTYELSSIFGGSWGSIENWLEPKIKPTLGNLA* |
| Ga0114356_15439792 | 3300008121 | Freshwater, Plankton | MIVFGLILTTFESRSFFGGSWKNIENWIKPKTKPPLGILACTNQ* |
| Ga0114356_15445881 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFESSFIFEGSWGCIENCREPKTKSPLGNLACPNLRN* |
| Ga0114356_15523411 | 3300008121 | Freshwater, Plankton | MIIFGLILTTFELSIIFGGSWGSIEFWLEPKTDPPSGNIARPNP* |
| Ga0114356_15553111 | 3300008121 | Freshwater, Plankton | IIFGSIMTTFELSSNFGGSWGSIENWVEPKTEPPSGNLACPNP* |
| Ga0114356_15720611 | 3300008121 | Freshwater, Plankton | IIFGSIMTTFELSSNFGGSWGSIENWVEPKTEPPSGN* |
| Ga0247722_100807932 | 3300028027 | Deep Subsurface Sediment | MSILTTFELSSIFGGNWGRIENWLEPKTEPSSGNLACPNP |
| Ga0247722_102628261 | 3300028027 | Deep Subsurface Sediment | MIIFVSILTTFKLSVIFRSSWGSSVNWLEPKTEPS |
| Ga0247722_102775772 | 3300028027 | Deep Subsurface Sediment | MIILGLILTTFESSSIFGGSWGSIENWLEPKIDPPSGN |
| Ga0247722_103127961 | 3300028027 | Deep Subsurface Sediment | GILTTFESSSIFCRWGNIENWLKPENEPPLGNLACP |
| ⦗Top⦘ |