| Basic Information | |
|---|---|
| Family ID | F019056 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 232 |
| Average Sequence Length | 38 residues |
| Representative Sequence | IAEWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Number of Associated Samples | 207 |
| Number of Associated Scaffolds | 232 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.93 % |
| % of genes near scaffold ends (potentially truncated) | 96.98 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 202 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.793 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.983 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.948 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 232 Family Scaffolds |
|---|---|---|
| PF01527 | HTH_Tnp_1 | 43.53 |
| PF13333 | rve_2 | 19.40 |
| PF13276 | HTH_21 | 12.93 |
| PF02371 | Transposase_20 | 0.86 |
| PF02518 | HATPase_c | 0.86 |
| PF01548 | DEDD_Tnp_IS110 | 0.86 |
| PF13772 | AIG2_2 | 0.43 |
| PF12833 | HTH_18 | 0.43 |
| PF01476 | LysM | 0.43 |
| PF07883 | Cupin_2 | 0.43 |
| PF13683 | rve_3 | 0.43 |
| PF07719 | TPR_2 | 0.43 |
| PF13274 | DUF4065 | 0.43 |
| PF13289 | SIR2_2 | 0.43 |
| PF00665 | rve | 0.43 |
| PF00118 | Cpn60_TCP1 | 0.43 |
| PF13579 | Glyco_trans_4_4 | 0.43 |
| PF05598 | DUF772 | 0.43 |
| PF14022 | DUF4238 | 0.43 |
| PF04392 | ABC_sub_bind | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 232 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.72 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.43 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.43 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.43 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.43 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.79 % |
| Unclassified | root | N/A | 11.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_10943056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300000787|JGI11643J11755_11389787 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300000858|JGI10213J12805_10010893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 697 | Open in IMG/M |
| 3300001176|JGI12655J13551_102471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → unclassified Nitrobacter → Nitrobacter sp. | 521 | Open in IMG/M |
| 3300001239|Draft_10455323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4642 | Open in IMG/M |
| 3300001447|JGI12529J15002_10043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → unclassified Nitrobacter → Nitrobacter sp. | 617 | Open in IMG/M |
| 3300001593|JGI12635J15846_10287959 | Not Available | 1034 | Open in IMG/M |
| 3300003372|JGI26336J50218_1003348 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300005332|Ga0066388_103438902 | Not Available | 808 | Open in IMG/M |
| 3300005332|Ga0066388_108637562 | Not Available | 506 | Open in IMG/M |
| 3300005471|Ga0070698_101096415 | Not Available | 745 | Open in IMG/M |
| 3300005610|Ga0070763_10039025 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
| 3300005764|Ga0066903_100664165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus silvae | 1826 | Open in IMG/M |
| 3300006034|Ga0066656_10741670 | Not Available | 630 | Open in IMG/M |
| 3300006055|Ga0097691_1019213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3005 | Open in IMG/M |
| 3300006102|Ga0075015_100206920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1047 | Open in IMG/M |
| 3300006580|Ga0074049_12975125 | Not Available | 582 | Open in IMG/M |
| 3300006606|Ga0074062_13026408 | Not Available | 593 | Open in IMG/M |
| 3300007258|Ga0099793_10719592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300009012|Ga0066710_100214263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2755 | Open in IMG/M |
| 3300009174|Ga0105241_12044665 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300009525|Ga0116220_10119587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1122 | Open in IMG/M |
| 3300009665|Ga0116135_1336584 | Not Available | 602 | Open in IMG/M |
| 3300009789|Ga0126307_11375027 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300010373|Ga0134128_12084784 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012198|Ga0137364_10359885 | Not Available | 1086 | Open in IMG/M |
| 3300012199|Ga0137383_10729086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300012201|Ga0137365_10529134 | Not Available | 866 | Open in IMG/M |
| 3300012205|Ga0137362_10062561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3062 | Open in IMG/M |
| 3300012208|Ga0137376_10601674 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300012208|Ga0137376_11699616 | Not Available | 522 | Open in IMG/M |
| 3300012929|Ga0137404_10618435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 975 | Open in IMG/M |
| 3300012989|Ga0164305_12136369 | Not Available | 514 | Open in IMG/M |
| 3300014654|Ga0181525_10321055 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300014969|Ga0157376_10644501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1059 | Open in IMG/M |
| 3300016294|Ga0182041_12041580 | Not Available | 534 | Open in IMG/M |
| 3300016319|Ga0182033_11491153 | Not Available | 610 | Open in IMG/M |
| 3300016319|Ga0182033_11795938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 556 | Open in IMG/M |
| 3300016341|Ga0182035_11322848 | Not Available | 646 | Open in IMG/M |
| 3300016371|Ga0182034_10073961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2349 | Open in IMG/M |
| 3300016371|Ga0182034_10898269 | Not Available | 762 | Open in IMG/M |
| 3300017939|Ga0187775_10393539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 571 | Open in IMG/M |
| 3300017973|Ga0187780_11184064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 560 | Open in IMG/M |
| 3300018073|Ga0184624_10174983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 951 | Open in IMG/M |
| 3300018432|Ga0190275_10015029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5854 | Open in IMG/M |
| 3300019789|Ga0137408_1136445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
| 3300019789|Ga0137408_1168086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1214 | Open in IMG/M |
| 3300019789|Ga0137408_1245531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1566 | Open in IMG/M |
| 3300019789|Ga0137408_1294576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2203 | Open in IMG/M |
| 3300019789|Ga0137408_1294577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2164 | Open in IMG/M |
| 3300019869|Ga0193705_1024525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1307 | Open in IMG/M |
| 3300019884|Ga0193741_1036094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1276 | Open in IMG/M |
| 3300019889|Ga0193743_1199777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 636 | Open in IMG/M |
| 3300019997|Ga0193711_1008600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1285 | Open in IMG/M |
| 3300019999|Ga0193718_1027034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1275 | Open in IMG/M |
| 3300020002|Ga0193730_1044225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1288 | Open in IMG/M |
| 3300020002|Ga0193730_1044950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1277 | Open in IMG/M |
| 3300020016|Ga0193696_1062482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 975 | Open in IMG/M |
| 3300020193|Ga0194131_10382508 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300020582|Ga0210395_10185784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1557 | Open in IMG/M |
| 3300020582|Ga0210395_10909966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 653 | Open in IMG/M |
| 3300021178|Ga0210408_10262417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1376 | Open in IMG/M |
| 3300021181|Ga0210388_10358237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1282 | Open in IMG/M |
| 3300021339|Ga0193706_1043941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1272 | Open in IMG/M |
| 3300021363|Ga0193699_10082449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1283 | Open in IMG/M |
| 3300021405|Ga0210387_10300258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1412 | Open in IMG/M |
| 3300021405|Ga0210387_11256460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 641 | Open in IMG/M |
| 3300021407|Ga0210383_10407367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1173 | Open in IMG/M |
| 3300021432|Ga0210384_10373319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1284 | Open in IMG/M |
| 3300021474|Ga0210390_10291053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1383 | Open in IMG/M |
| 3300021474|Ga0210390_10552962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 967 | Open in IMG/M |
| 3300021476|Ga0187846_10329349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 630 | Open in IMG/M |
| 3300021479|Ga0210410_10154878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2043 | Open in IMG/M |
| 3300021951|Ga0222624_1421032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 728 | Open in IMG/M |
| 3300022557|Ga0212123_10622166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 677 | Open in IMG/M |
| 3300022563|Ga0212128_10401995 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 848 | Open in IMG/M |
| 3300022694|Ga0222623_10065884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1399 | Open in IMG/M |
| 3300022708|Ga0242670_1038646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 643 | Open in IMG/M |
| 3300022737|Ga0247747_1047919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 531 | Open in IMG/M |
| 3300022898|Ga0247745_1009766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1281 | Open in IMG/M |
| 3300022901|Ga0247788_1015915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1291 | Open in IMG/M |
| 3300023071|Ga0247752_1038069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 729 | Open in IMG/M |
| 3300024433|Ga0209986_10136676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1285 | Open in IMG/M |
| 3300025167|Ga0209642_10698140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 542 | Open in IMG/M |
| 3300025457|Ga0208850_1076672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 538 | Open in IMG/M |
| 3300025612|Ga0208691_1136443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 553 | Open in IMG/M |
| 3300025627|Ga0208220_1040559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1403 | Open in IMG/M |
| 3300025898|Ga0207692_10169056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1266 | Open in IMG/M |
| 3300025911|Ga0207654_11233694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 545 | Open in IMG/M |
| 3300025916|Ga0207663_10414842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1032 | Open in IMG/M |
| 3300025918|Ga0207662_11085634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 569 | Open in IMG/M |
| 3300025921|Ga0207652_10476539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1124 | Open in IMG/M |
| 3300025932|Ga0207690_10513436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 970 | Open in IMG/M |
| 3300025935|Ga0207709_11106427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 651 | Open in IMG/M |
| 3300025937|Ga0207669_10230662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1365 | Open in IMG/M |
| 3300025938|Ga0207704_11205081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 646 | Open in IMG/M |
| 3300025939|Ga0207665_10297411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1206 | Open in IMG/M |
| 3300025960|Ga0207651_10329779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1278 | Open in IMG/M |
| 3300025972|Ga0207668_11125530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 704 | Open in IMG/M |
| 3300026095|Ga0207676_10364298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1340 | Open in IMG/M |
| 3300026121|Ga0207683_10504030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1118 | Open in IMG/M |
| 3300026316|Ga0209155_1127756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 876 | Open in IMG/M |
| 3300026327|Ga0209266_1237729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 598 | Open in IMG/M |
| 3300026355|Ga0257149_1041170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 660 | Open in IMG/M |
| 3300026475|Ga0257147_1006626 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300026475|Ga0257147_1009525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1271 | Open in IMG/M |
| 3300026475|Ga0257147_1013949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1086 | Open in IMG/M |
| 3300026489|Ga0257160_1009122 | Not Available | 1381 | Open in IMG/M |
| 3300026490|Ga0257153_1022979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1280 | Open in IMG/M |
| 3300026494|Ga0257159_1014223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1268 | Open in IMG/M |
| 3300026523|Ga0209808_1080662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1404 | Open in IMG/M |
| 3300026889|Ga0207745_1000918 | Not Available | 4174 | Open in IMG/M |
| 3300027031|Ga0208986_1007698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1001 | Open in IMG/M |
| 3300027070|Ga0208365_1042894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 604 | Open in IMG/M |
| 3300027090|Ga0208604_1024972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300027424|Ga0209984_1065661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 539 | Open in IMG/M |
| 3300027496|Ga0208987_1008699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1665 | Open in IMG/M |
| 3300027524|Ga0208998_1051853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 669 | Open in IMG/M |
| 3300027567|Ga0209115_1032029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1190 | Open in IMG/M |
| 3300027583|Ga0209527_1058072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 872 | Open in IMG/M |
| 3300027643|Ga0209076_1048215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1205 | Open in IMG/M |
| 3300027676|Ga0209333_1148719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 630 | Open in IMG/M |
| 3300027843|Ga0209798_10125492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1296 | Open in IMG/M |
| 3300027854|Ga0209517_10345956 | Not Available | 853 | Open in IMG/M |
| 3300027873|Ga0209814_10155372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 982 | Open in IMG/M |
| 3300027879|Ga0209169_10118917 | Not Available | 1370 | Open in IMG/M |
| 3300027880|Ga0209481_10345682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 758 | Open in IMG/M |
| 3300027895|Ga0209624_10071388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2240 | Open in IMG/M |
| 3300027903|Ga0209488_10111075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2059 | Open in IMG/M |
| 3300027905|Ga0209415_10732073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 702 | Open in IMG/M |
| 3300027909|Ga0209382_10297899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1819 | Open in IMG/M |
| 3300027909|Ga0209382_10770351 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300027979|Ga0209705_10146385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1266 | Open in IMG/M |
| 3300028023|Ga0265357_1000477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2341 | Open in IMG/M |
| 3300028381|Ga0268264_11585948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 665 | Open in IMG/M |
| 3300028679|Ga0302169_10065127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 856 | Open in IMG/M |
| 3300028712|Ga0307285_10006965 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300028714|Ga0307309_10020318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1285 | Open in IMG/M |
| 3300028717|Ga0307298_10164672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 647 | Open in IMG/M |
| 3300028719|Ga0307301_10050755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1276 | Open in IMG/M |
| 3300028747|Ga0302219_10074876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1269 | Open in IMG/M |
| 3300028771|Ga0307320_10434147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 528 | Open in IMG/M |
| 3300028774|Ga0302208_10189897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 507 | Open in IMG/M |
| 3300028791|Ga0307290_10070254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1270 | Open in IMG/M |
| 3300028798|Ga0302222_10087001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1249 | Open in IMG/M |
| 3300028809|Ga0247824_10695407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 619 | Open in IMG/M |
| 3300028824|Ga0307310_10512002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 605 | Open in IMG/M |
| 3300028863|Ga0302218_10055493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1243 | Open in IMG/M |
| 3300028906|Ga0308309_11259693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 636 | Open in IMG/M |
| 3300029910|Ga0311369_10121081 | All Organisms → cellular organisms → Bacteria | 2585 | Open in IMG/M |
| 3300029943|Ga0311340_10477808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1120 | Open in IMG/M |
| 3300029943|Ga0311340_10972772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 699 | Open in IMG/M |
| 3300029952|Ga0311346_10597459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 990 | Open in IMG/M |
| 3300030007|Ga0311338_11059409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 782 | Open in IMG/M |
| 3300030707|Ga0310038_10403749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 594 | Open in IMG/M |
| 3300030739|Ga0302311_10257710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1288 | Open in IMG/M |
| 3300030851|Ga0075380_11121024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 548 | Open in IMG/M |
| 3300031028|Ga0302180_10030071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3405 | Open in IMG/M |
| 3300031152|Ga0307501_10111685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 703 | Open in IMG/M |
| 3300031199|Ga0307495_10008910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1415 | Open in IMG/M |
| 3300031226|Ga0307497_10132079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1015 | Open in IMG/M |
| 3300031241|Ga0265325_10094390 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300031242|Ga0265329_10072426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1090 | Open in IMG/M |
| 3300031249|Ga0265339_10130631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1284 | Open in IMG/M |
| 3300031360|Ga0307444_1103752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 875 | Open in IMG/M |
| 3300031366|Ga0307506_10018415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1697 | Open in IMG/M |
| 3300031474|Ga0170818_102388497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 778 | Open in IMG/M |
| 3300031525|Ga0302326_10876702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1280 | Open in IMG/M |
| 3300031525|Ga0302326_12410501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 663 | Open in IMG/M |
| 3300031544|Ga0318534_10032963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2837 | Open in IMG/M |
| 3300031546|Ga0318538_10019623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2991 | Open in IMG/M |
| 3300031561|Ga0318528_10025361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2874 | Open in IMG/M |
| 3300031564|Ga0318573_10128457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1318 | Open in IMG/M |
| 3300031572|Ga0318515_10021292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3065 | Open in IMG/M |
| 3300031653|Ga0315550_1077909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1463 | Open in IMG/M |
| 3300031682|Ga0318560_10445028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 701 | Open in IMG/M |
| 3300031711|Ga0265314_10179007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1272 | Open in IMG/M |
| 3300031711|Ga0265314_10179841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1268 | Open in IMG/M |
| 3300031712|Ga0265342_10159281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1248 | Open in IMG/M |
| 3300031713|Ga0318496_10132402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1353 | Open in IMG/M |
| 3300031719|Ga0306917_11545735 | Not Available | 510 | Open in IMG/M |
| 3300031736|Ga0318501_10125349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1303 | Open in IMG/M |
| 3300031740|Ga0307468_100307330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1155 | Open in IMG/M |
| 3300031744|Ga0306918_10177951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1590 | Open in IMG/M |
| 3300031748|Ga0318492_10118897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1312 | Open in IMG/M |
| 3300031751|Ga0318494_10637223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 623 | Open in IMG/M |
| 3300031763|Ga0318537_10070038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1284 | Open in IMG/M |
| 3300031778|Ga0318498_10100406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1311 | Open in IMG/M |
| 3300031782|Ga0318552_10018213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3070 | Open in IMG/M |
| 3300031792|Ga0318529_10095077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1340 | Open in IMG/M |
| 3300031805|Ga0318497_10151412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1269 | Open in IMG/M |
| 3300031820|Ga0307473_10148420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1329 | Open in IMG/M |
| 3300031821|Ga0318567_10149622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1290 | Open in IMG/M |
| 3300031832|Ga0318499_10065387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1375 | Open in IMG/M |
| 3300031833|Ga0310917_10152925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1523 | Open in IMG/M |
| 3300031833|Ga0310917_10763598 | Not Available | 653 | Open in IMG/M |
| 3300031845|Ga0318511_10088456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1303 | Open in IMG/M |
| 3300031846|Ga0318512_10023218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2586 | Open in IMG/M |
| 3300031859|Ga0318527_10076313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1350 | Open in IMG/M |
| 3300031890|Ga0306925_10029119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5609 | Open in IMG/M |
| 3300031890|Ga0306925_10259988 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
| 3300031893|Ga0318536_10131421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1267 | Open in IMG/M |
| 3300031896|Ga0318551_10081741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1692 | Open in IMG/M |
| 3300031897|Ga0318520_10030217 | Not Available | 2699 | Open in IMG/M |
| 3300031912|Ga0306921_10556783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1329 | Open in IMG/M |
| 3300031912|Ga0306921_12000750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 617 | Open in IMG/M |
| 3300031912|Ga0306921_12594371 | Not Available | 523 | Open in IMG/M |
| 3300031945|Ga0310913_10187424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1442 | Open in IMG/M |
| 3300031946|Ga0310910_11587430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 500 | Open in IMG/M |
| 3300031981|Ga0318531_10016656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2872 | Open in IMG/M |
| 3300032009|Ga0318563_10069853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1824 | Open in IMG/M |
| 3300032010|Ga0318569_10016530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2898 | Open in IMG/M |
| 3300032013|Ga0310906_10767377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 679 | Open in IMG/M |
| 3300032041|Ga0318549_10098123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1274 | Open in IMG/M |
| 3300032061|Ga0315540_10124514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1166 | Open in IMG/M |
| 3300032064|Ga0318510_10344276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 627 | Open in IMG/M |
| 3300032089|Ga0318525_10133170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1273 | Open in IMG/M |
| 3300032089|Ga0318525_10720593 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032090|Ga0318518_10019717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2957 | Open in IMG/M |
| 3300032180|Ga0307471_100598280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1261 | Open in IMG/M |
| 3300032180|Ga0307471_100716905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1165 | Open in IMG/M |
| 3300033004|Ga0335084_10474509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1286 | Open in IMG/M |
| 3300033158|Ga0335077_10497828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1289 | Open in IMG/M |
| 3300033290|Ga0318519_10355022 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300033290|Ga0318519_10918437 | Not Available | 541 | Open in IMG/M |
| 3300033412|Ga0310810_10463106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1278 | Open in IMG/M |
| 3300033475|Ga0310811_10479065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1315 | Open in IMG/M |
| 3300033513|Ga0316628_100743985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1289 | Open in IMG/M |
| 3300034115|Ga0364945_0040863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1274 | Open in IMG/M |
| 3300034124|Ga0370483_0074907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1093 | Open in IMG/M |
| 3300034195|Ga0370501_0050562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1320 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.74% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.72% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.86% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.43% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.43% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.43% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.43% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.43% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.43% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.43% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.43% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.43% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.43% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.43% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.43% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.43% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.43% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.43% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.43% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.43% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.43% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300001176 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 | Environmental | Open in IMG/M |
| 3300001239 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001447 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN95 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300003372 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026889 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 57 (SPAdes) | Environmental | Open in IMG/M |
| 3300027031 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027524 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028774 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030851 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031360 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-40 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031653 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_109430561 | 3300000363 | Soil | APGSEDAELDDTELGVLMVPEVRHGEAEVYTRAQA* |
| JGI11643J11755_113897872 | 3300000787 | Soil | VRTFWPALSSEDTELGVFTGPEVRHGEAEVHARVQA |
| JGI10213J12805_100108933 | 3300000858 | Soil | AAYVHPVWAAAGSKDTELGVKMEPEVGHGATEIYP* |
| JGI12655J13551_1024711 | 3300001176 | Forest Soil | TEWPAPGSADTELGVLMEPEVSHGEAEVYTRVQA* |
| Draft_104553233 | 3300001239 | Hydrocarbon Resource Environments | MSRQGLTARNPVWPAPGFEDTKLGVLMEPEVRHGTSEVYTRVQA* |
| JGI12529J15002_100433 | 3300001447 | Forest Soil | IKWLRRLEVSDWPAPGSEDTELGVLMELEVRHGAAEVYA* |
| JGI12635J15846_102879593 | 3300001593 | Forest Soil | MRWYVADGGCNVWPAPGSADTELGVLMDLEVGHGETKIYA |
| JGI26336J50218_10033481 | 3300003372 | Bog Forest Soil | SGPKKITVWPAPGSADTELGVFMGPEVSHGETKVYAGVQA* |
| Ga0066388_1034389023 | 3300005332 | Tropical Forest Soil | MELWPAPGSEDTELGVLMELEVGHGETEVYAGVQA*GCAPDQG |
| Ga0066388_1086375622 | 3300005332 | Tropical Forest Soil | MNRKQRRAAAWPAPGSEDTELGVLMELEVGHGETEVHAGVQA* |
| Ga0070698_1010964151 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VIGAARGEAQVIWPAPGSEDTELGVLMELEVGHGETEVYA |
| Ga0070763_100390251 | 3300005610 | Soil | MRSFDWPAPGSADTELGVLMELEVGHGETEVYARVQA |
| Ga0066903_1006641652 | 3300005764 | Tropical Forest Soil | MLEQRPLKIVRWPAPGSEDAELGVLMEPEVGHGETEVYPRVQA* |
| Ga0066656_107416702 | 3300006034 | Soil | PLIPKLAEWPAPGSKDIELGVKMEPEVGHGATKIYPRVQA* |
| Ga0097691_10192136 | 3300006055 | Arctic Peat Soil | MAGRAKWPAPGSEDTKLGVLMEREVRHGAAEVYAGVQA |
| Ga0075015_1002069203 | 3300006102 | Watersheds | AVWPAPGSEDTELGVLMELEVGQGETKVYAAVQA* |
| Ga0074049_129751251 | 3300006580 | Soil | MPQLTSRLSIWPAPGFEDTELGVLMELEVGHGETEVY |
| Ga0074062_130264081 | 3300006606 | Soil | MPNLKGVNWPAPGSEDTELGVLMELEVGHGETEVY |
| Ga0099793_107195922 | 3300007258 | Vadose Zone Soil | DEPLSDWPAPGSEDTELGVMMEQEVGHGETEIYTRVQA* |
| Ga0066710_1002142636 | 3300009012 | Grasslands Soil | GCLPHWPAPGSEDTELGVLMELEVGRGKTEVHARVQA |
| Ga0105241_120446651 | 3300009174 | Corn Rhizosphere | WPAPGSEDTELGVLMELEVGHGETEVYARVQTLACTRFG* |
| Ga0116220_101195871 | 3300009525 | Peatlands Soil | AVPRAFEEAMWPAAGSTDTQLGVLMELEVDHGKATVYARVQA* |
| Ga0116135_13365841 | 3300009665 | Peatland | GVNRWSLWPAPGSGNTDFGVFIGPEVRHGETTFYAGVQA* |
| Ga0126307_113750271 | 3300009789 | Serpentine Soil | MPLQRRAQTRCWPAPGFEDTELGVFMEPEVGHGEAEV |
| Ga0134128_120847842 | 3300010373 | Terrestrial Soil | VIAWPAPGSEDTDLGVLMEPGGGGRAKTEVYTRVQA* |
| Ga0137364_103598851 | 3300012198 | Vadose Zone Soil | MASRAIRWPAPGSEDTELGVLMELEVGHGETEVYPRVQA |
| Ga0137383_107290862 | 3300012199 | Vadose Zone Soil | LLEPVEAVWPAPGSEDTELGVLMELEVCHGETEAYPRVQA* |
| Ga0137365_105291341 | 3300012201 | Vadose Zone Soil | RKCTRGGALGLWPAPGSEDTELGVLMELEVGHGETEVYPRVQA* |
| Ga0137362_100625611 | 3300012205 | Vadose Zone Soil | MDTYQFTPWPAPGSEDTELGVLMEPEVGHGETEVYA |
| Ga0137376_106016744 | 3300012208 | Vadose Zone Soil | AVWPAPGSEDTELGVLMELEVGHGETEVHAGVQA* |
| Ga0137376_116996162 | 3300012208 | Vadose Zone Soil | VVALVDTIWSAHGSEDTESGVLMELEVGHGETEVYPRVQ |
| Ga0137404_106184351 | 3300012929 | Vadose Zone Soil | RPFWPAPGSEDTELGVLMELEVCHGETEVYPRVQA* |
| Ga0164305_121363691 | 3300012989 | Soil | MTLRPVMLVWPAPGSEDTELGVLMELEVGHGETEVY |
| Ga0181525_103210551 | 3300014654 | Bog | MQVGEIYIWPAPGSEDTELGVLMEPEVDHGKAEVYARVQA* |
| Ga0157376_106445011 | 3300014969 | Miscanthus Rhizosphere | TSSVWPAPGSEDTELGVLMEPEVGHGETEIYAGVQA* |
| Ga0182041_120415801 | 3300016294 | Soil | MARQMERIIWPAPGFEDTELGVLMELEVGHGETEVY |
| Ga0182033_114911532 | 3300016319 | Soil | MFCGRRATWPAPGSEDTELGVLMEPEVGHGETEVYA |
| Ga0182033_117959381 | 3300016319 | Soil | DLTFDWPAPGSEDTELGVFMGPEVSHGATKVHAGIQA |
| Ga0182035_113228481 | 3300016341 | Soil | MARQMERIIWPAPGFEDTELGVLMELEVGHGETEVYARVQA |
| Ga0182034_100739614 | 3300016371 | Soil | MEVWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0182034_108982691 | 3300016371 | Soil | MVRPPTITPWPAPGSEDTELGVLMELEVGHGETEVYARV |
| Ga0187775_103935393 | 3300017939 | Tropical Peatland | SVLMIWPAPGSEDTELGVTMGPEVGHGEAEVHARV |
| Ga0187780_111840642 | 3300017973 | Tropical Peatland | FAETIYWPAPGFEDTELGVLMEPEVSHGKTTVYAGVQA |
| Ga0184624_101749831 | 3300018073 | Groundwater Sediment | ADIDQIAVANWPAPGSVDTELGVLMELEVRYGEASVYAGVQA |
| Ga0190275_100150296 | 3300018432 | Soil | MLRIGFSISTWPAPGSEDTELGVLMELEVDHGEAEVYA |
| Ga0137408_11364451 | 3300019789 | Vadose Zone Soil | WPAPGSEDTEPGSEDTELGVLMELEVGHGETEVYPRVQA |
| Ga0137408_11680861 | 3300019789 | Vadose Zone Soil | FDKAGWPAPGSEDTELGVLMELEVGHGETEVYPRVQA |
| Ga0137408_12455311 | 3300019789 | Vadose Zone Soil | WPAPGSEDTEFEDTELGVLMELEVGHGETEVYPRVQA |
| Ga0137408_12945764 | 3300019789 | Vadose Zone Soil | PKELQRKSADWPAPGSEDTELGVLMELEVGHGETEVYPRVQA |
| Ga0137408_12945771 | 3300019789 | Vadose Zone Soil | ACTRFRGQPGSEDTELGVLMELEVGHGETEVYPRVQA |
| Ga0193705_10245251 | 3300019869 | Soil | DGDILSKARLPWPAPGSEDTELGVLMELEVGHGETEVYAGVQA |
| Ga0193741_10360941 | 3300019884 | Soil | PSKEIENWAAAGSEDTELGVLMEPEVDHGEAEVYTRVQA |
| Ga0193743_11997771 | 3300019889 | Soil | NEVVWPAPGSEDTELGVLMEQEVGHGATEVYAGVQA |
| Ga0193711_10086001 | 3300019997 | Soil | ALEKLKEGRYKWPAPGSADTELGVLMEPEVCHGETEVYPRVQA |
| Ga0193718_10270341 | 3300019999 | Soil | AVELMLNWPAPGSEDTELGVLMELEVGHGETEVYAGVQA |
| Ga0193730_10442251 | 3300020002 | Soil | FNEICESWPAPGSEDTELGVLMELEVGHGETEVYAGVQA |
| Ga0193730_10449503 | 3300020002 | Soil | ATDAWPAPGSEDTELGVLMEPEVRHGETTVYAGVQA |
| Ga0193696_10624823 | 3300020016 | Soil | INIDEWPAPGSEDTELGVLMELEVRHGEASVYAGVQA |
| Ga0194131_103825081 | 3300020193 | Freshwater Lake | VSAFRINSDRWPAAGSEDTKLGVNMELEVDHGATE |
| Ga0210407_101338621 | 3300020579 | Soil | CEDLYRIALNIWPAPGSADTELGVLMEPEVCHGETEVYT |
| Ga0210395_101857841 | 3300020582 | Soil | RALAWPAPGFTDTELGVLMEPEVDHGEAEVYARVQA |
| Ga0210395_109099663 | 3300020582 | Soil | DVGAVWPAPGSEDTELDVFMGPEVSHGETKVYARVQA |
| Ga0210408_102624173 | 3300021178 | Soil | QTVWPAPGSEDTELGALMELEVGHGETEVYPRVQA |
| Ga0210388_103582371 | 3300021181 | Soil | YEASYWPAPGSEDTELGVFMGPEVSHGEAKVYAGVQA |
| Ga0193706_10439411 | 3300021339 | Soil | GILITKALKWPAPGSEDTELGVLMEPEVRHGEAKVYARVQA |
| Ga0193699_100824493 | 3300021363 | Soil | CAFQDWAAAGFEDTELGVNMEPEVCHGTSKVYARVQA |
| Ga0210387_103002584 | 3300021405 | Soil | GEGTVTTVWPAPGSEDTELGVLMELEVRHGETEVYP |
| Ga0210387_112564601 | 3300021405 | Soil | IVGLIVGDAVWPAPGFTDTELGVLMGPEVDHGEAEVYAGIQA |
| Ga0210383_104073673 | 3300021407 | Soil | AAGLVMVEYLRKQIDWPAPGSEDTELGVLMELEVGHGETEVHAGVQA |
| Ga0210384_103733193 | 3300021432 | Soil | DEVSGVYWPAPGSEDTELGVLMELEVGHGETEVHAGVQA |
| Ga0210390_102910534 | 3300021474 | Soil | VSRDWPAPGSADTELGVLMDLEVGHGETKIYAGVQA |
| Ga0210390_105529623 | 3300021474 | Soil | MKWPFWPAPGFTDTELGVLMEPEVDHGEAEVYARVQA |
| Ga0187846_103293493 | 3300021476 | Biofilm | NDLEWPAPGSEDTELGVLMELEVGHGETEVYARVQA |
| Ga0210410_101548784 | 3300021479 | Soil | RMIAWPAPSSEDTELGVLMGPEVGHGETKVYAGVQA |
| Ga0222624_14210321 | 3300021951 | Groundwater Sediment | SEQCKTYLWPAPGSEDTELGVLMEPEVGHGETEVYAGVQA |
| Ga0212123_106221661 | 3300022557 | Iron-Sulfur Acid Spring | PKTMTEWPAPGSADTELGVLMEPEVCHGETEVYTRVQA |
| Ga0212128_104019951 | 3300022563 | Thermal Springs | MSHLRSSGWAAAGFKDTELGVWMKPEVDHGATEVYAGVQA |
| Ga0222623_100658841 | 3300022694 | Groundwater Sediment | HQGDQYHSGAWPAPGFEDTELGVLMEPEVGHGETEVYAGVQA |
| Ga0242670_10386463 | 3300022708 | Soil | PAWLKLSKDRWPAPGSEDTELGVLMEPEVGHGETEVHARVQA |
| Ga0247747_10479193 | 3300022737 | Soil | KISVWPAPGSEDTELGVLMELEVGHGETEVHPGIQA |
| Ga0247745_10097663 | 3300022898 | Soil | DRQSVQCGLWPAPGSEDTELGVLMEPEVRHGEAEVHA |
| Ga0247788_10159151 | 3300022901 | Soil | FNSFMSIWPAPGSEDTELGVLMELEVGHGETEVHPGIQA |
| Ga0247752_10380691 | 3300023071 | Soil | LAKMDKAWPAPGSEDTKFGVKMGPEVGHAEAEVYAGVQD |
| Ga0209986_101366761 | 3300024433 | Deep Subsurface | AERIVWPTPGSEDTELGVLMEPEVDHGTTEVYTRVQA |
| Ga0209642_106981401 | 3300025167 | Soil | EINREEIWPAPGSEDTELGVLMEPEVDHGTTEVYTRVQA |
| Ga0208850_10766721 | 3300025457 | Arctic Peat Soil | ESMLAQSFGAWPAPGSEDTELGVLMEPEVRHGEAEVYTRVQA |
| Ga0208691_11364433 | 3300025612 | Peatland | RNFGHWPAPGSADTELGVLMDLEVGHGETKIYAGVQA |
| Ga0208220_10405591 | 3300025627 | Arctic Peat Soil | TKPSSDIQAHWSAPGFEDTELGVFMEPEVSHGETKIYARVQA |
| Ga0207692_101690561 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KSDLVRWPAPGSEDTELGVLMEVEVGHGEAEVYARVQA |
| Ga0207654_112336941 | 3300025911 | Corn Rhizosphere | LLFGLWPAPGSEDTELGVLMEPEVGHGETEVYAGVQA |
| Ga0207663_104148421 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MITSEQCKTYLWPAPGSEDTELGVLMEPEVGHGETEVYSGVQA |
| Ga0207662_110856341 | 3300025918 | Switchgrass Rhizosphere | SHLCEALWPAPGSEDTELGVLMELEVGHGETEVYARVQA |
| Ga0207652_104765391 | 3300025921 | Corn Rhizosphere | MWNGLWPAPGSEDTKFGVRMGPEVGHGASEVYAGVQ |
| Ga0207690_105134361 | 3300025932 | Corn Rhizosphere | EIAVWPAPGSKDTELGVLMEPEVGDGETQIYAGVQA |
| Ga0207709_111064271 | 3300025935 | Miscanthus Rhizosphere | GIQKSSVWPAPGSEDTELGVLMEPEVRHGEAEVHA |
| Ga0207669_102306623 | 3300025937 | Miscanthus Rhizosphere | KKNTWPAPGSEDTELGVLMELEVGHGETEVYARVQT |
| Ga0207704_112050813 | 3300025938 | Miscanthus Rhizosphere | DAGLQWPAPGSKDTELGVLMEPEVGDGETQIYAGVQA |
| Ga0207665_102974114 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VYSGSQNAGYGLWPAPGSEDTDLGVLMEPEVDHGETEVYPRVQA |
| Ga0207651_103297793 | 3300025960 | Switchgrass Rhizosphere | SDDNIRDWPAPGSEDTELGVLMEPEVRHGEAEVYA |
| Ga0207668_111255301 | 3300025972 | Switchgrass Rhizosphere | DIQEWPAPGSKDTELGVLMEPEVGDGETQIYAGVQA |
| Ga0207676_103642981 | 3300026095 | Switchgrass Rhizosphere | ALATWPAPGSKDTELGVLMEPEVGDGETQIYAGVQA |
| Ga0207683_105040301 | 3300026121 | Miscanthus Rhizosphere | LEEGYTWPAPGSKDTELGVLMEPEVGDGETQIYAGVQA |
| Ga0209155_11277563 | 3300026316 | Soil | PEKGSSVTYGDTDDWPAPGFKDTELGVSMEPEVGHGETEVYPRV |
| Ga0209266_12377291 | 3300026327 | Soil | PFQLTAAIWPAPGSEDTELGVLMELEVCHGETEVYPRVQA |
| Ga0257149_10411701 | 3300026355 | Soil | ANDVVWPAAGSADTELGVMMEPEVCHGEAEVYTRVQA |
| Ga0257147_10066264 | 3300026475 | Soil | FFKAKDWPAPGSEDTELGVLMELEVGHGETEVYARV |
| Ga0257147_10095253 | 3300026475 | Soil | VVGWDGWPAPGSEDTELGVLMEPEVGHGETEVYAGVQA |
| Ga0257147_10139493 | 3300026475 | Soil | HDDWPAPGSEDTELGVLMELEVGHGETEVYTRVQA |
| Ga0257160_10091224 | 3300026489 | Soil | CDYHEWPAPGSEDTELGVLMELEVGHGETEVYARV |
| Ga0257153_10229793 | 3300026490 | Soil | SNLDEWPAPGSEDTELGVLMELEVGHGETEVYARV |
| Ga0257159_10142231 | 3300026494 | Soil | PKDTAAWPASGSEDTELGVLMELEVGHGETEVYPRVQA |
| Ga0209808_10806621 | 3300026523 | Soil | ISSSEPWMPQWPAPGSEDTELGVLMELEVGHGEMEVYPRVQA |
| Ga0207745_100091810 | 3300026889 | Tropical Forest Soil | FADVVWPAPGSEDTKFGVTMGPEVGHAEAEVYAGVQA |
| Ga0208986_10076983 | 3300027031 | Forest Soil | LFNRLQRAFWPAPGSEDTELGVLMELEVRHGEAEVYP |
| Ga0208365_10428941 | 3300027070 | Forest Soil | ATFSHWPAPGSEDTELGVFMGPEVSHGETKVYAGVQA |
| Ga0208604_10249721 | 3300027090 | Forest Soil | VAEWPAPGSEDTELGVFMEPEVSHGKTKVYTRVQA |
| Ga0209984_10656613 | 3300027424 | Arabidopsis Thaliana Rhizosphere | SVSKFEDWPAPGSEDTELGVLMGPEVRHGEAEVHARVQA |
| Ga0208987_10086994 | 3300027496 | Forest Soil | THFHRPKTSSWPAPGSEDTELGVLMELEVRHGEAEVYP |
| Ga0208998_10518531 | 3300027524 | Forest Soil | DELKESETARQDVWPAPGSEDTEFGVLMEPEVRHGEAEVYAGVQA |
| Ga0209115_10320291 | 3300027567 | Forest Soil | GLSVWPAPGSADTELGVLMDLEVGHGETKIYAGVQA |
| Ga0209527_10580723 | 3300027583 | Forest Soil | FQCMGDVLMRGEFWPAPGSADTELGVLMEPEVCHGETEVYTGVQA |
| Ga0209076_10482151 | 3300027643 | Vadose Zone Soil | LSDWPAPGSEDTELGVMMEQEVGHGETEIYTRVQA |
| Ga0209333_11487191 | 3300027676 | Forest Soil | ANGLIGWPAPGSEDTELGVFMGPEVSHGETTVYTRVQV |
| Ga0209798_101254923 | 3300027843 | Wetland Sediment | NSYSEIENWPAPGSEDTELGVLMEPEVGHGEAEVYTRVQA |
| Ga0209517_103459562 | 3300027854 | Peatlands Soil | DVVRVIAVQWPAPGSEETELGIFMGSEVGHGETKIHTGVQA |
| Ga0209814_101553723 | 3300027873 | Populus Rhizosphere | ASLAEIWPAPGSEDTELGVLMELEVGHGETEVYPRVQA |
| Ga0209169_101189174 | 3300027879 | Soil | KVACTAVMAHWPAPGFTDTELGVLMGPEVDHGEAEVYAGIQA |
| Ga0209481_103456823 | 3300027880 | Populus Rhizosphere | DRKKKDPIWPAPGSEDTELGVLMELEVGHGATEVHAGVQA |
| Ga0209624_100713881 | 3300027895 | Forest Soil | SCEWPAPGSADTELGVLMDLEVGHGETKIYAGVQA |
| Ga0209488_101110751 | 3300027903 | Vadose Zone Soil | ALALIVWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0209415_107320731 | 3300027905 | Peatlands Soil | FFFSGLGQWPAPGSEDTELGVLMEPEVGHGETEVYTRVQA |
| Ga0209382_102978991 | 3300027909 | Populus Rhizosphere | AKFLLSGTSRIFAPWPAPGSEDTELGVLMELEVGHGETEVYPRVQA |
| Ga0209382_107703511 | 3300027909 | Populus Rhizosphere | MSIATGFALWPAPGSEDTELGVFMGPEVSHGETKVYAGVQA |
| Ga0209705_101463853 | 3300027979 | Freshwater Sediment | LSPEIWPAPGSEDTELGVLMELEVGHGETEVYAGVQA |
| Ga0265357_10004775 | 3300028023 | Rhizosphere | FNQTEIWPAPGSADTELGVLMEPEVCHGETEVYTRVQA |
| Ga0268264_115859481 | 3300028381 | Switchgrass Rhizosphere | LALASAVWPAPGSEDTELGVLMELEVRHGEAEVHA |
| Ga0302169_100651271 | 3300028679 | Fen | ENTAWPAPGSEDTELGVLMELEVCHGATEVYARVQA |
| Ga0307285_100069656 | 3300028712 | Soil | RDGVYWPAPGSEDTELGVLMELEVGHGETEVYPRVQA |
| Ga0307309_100203181 | 3300028714 | Soil | PGSNYWPAPGSEDTELGVLMELEVGHGETEVYAGVQA |
| Ga0307298_101646721 | 3300028717 | Soil | EVFRDAESYYWPAPGSEDTELGVLMEPEVGHGETEVYAGVQA |
| Ga0307301_100507553 | 3300028719 | Soil | HPHEIWPAPGFEDTELGVLMEPEVGHGETEVYAGVQA |
| Ga0302219_100748763 | 3300028747 | Palsa | TEQSTNWPAPGSADTELGVLMEPEVSHGEAEVYTRVQA |
| Ga0307320_104341471 | 3300028771 | Soil | FSEMLSLDIGAIWPAPGSEDTELGVLMELEVGHGETEVYAGVQA |
| Ga0302208_101898973 | 3300028774 | Fen | ELSVWPAPGSEDTELGVLMELEVCHGATEVYARVQA |
| Ga0307290_100702543 | 3300028791 | Soil | HYFGWPAPGSEDTELGVLMELEVGHGETEVYAGVQA |
| Ga0302222_100870011 | 3300028798 | Palsa | LIEWPAPGSADTELGVLMEPEVDHGETEVYPRVQA |
| Ga0247824_106954073 | 3300028809 | Soil | FQFGYEFLGDPSRWPAPGSEDTELGVLMELEVGHGETEVYAGVQA |
| Ga0307310_105120021 | 3300028824 | Soil | LLSPPVRFWPAPGSEDTELGVLMELEVRHGEASVYAGVQA |
| Ga0302218_100554931 | 3300028863 | Palsa | FEVWPAPGFEDTELGVLLEPEVAHGEAEVYAGVQA |
| Ga0308309_112596933 | 3300028906 | Soil | SVLELDWPAPGSEDTELGVLMELEVGHGETEVYAGVQA |
| Ga0311369_101210811 | 3300029910 | Palsa | YDDATSTEQSTNWPAPGSADTELGVLMEPEVSHGEAEVYTRVQA |
| Ga0311340_104778081 | 3300029943 | Palsa | TGWHYFYATLDVWPAPGFEDTELGVLLEPEVAHGEAEVYAGVQA |
| Ga0311340_109727723 | 3300029943 | Palsa | AVTASRVWPAPGSADTELGVLMEPEVSHGEAEVYARVQA |
| Ga0311346_105974591 | 3300029952 | Bog | KSAKWPAPGFTDTELGVLMEPEVDHGEAEVYEGVQA |
| Ga0311338_110594093 | 3300030007 | Palsa | ELFARDFLWPAPGFTDTELGVLMEPEVDHGEAEVYTRVQA |
| Ga0310038_104037491 | 3300030707 | Peatlands Soil | MSTLWPAPGSADTELGVLMEPEVCHGETEVYTRVQA |
| Ga0302311_102577101 | 3300030739 | Palsa | KGVRLQFLDWPAPGFTDTELGVLMEPEVGHGETEVYTGVQA |
| Ga0075380_111210243 | 3300030851 | Soil | KYDDQWPAPGSEDTELGVFMELEVSHGKTTVYTRVQA |
| Ga0302180_100300711 | 3300031028 | Palsa | RSGPEGWPAPGSADTELGVLMEPEVSHGEAEVYTRVQA |
| Ga0307501_101116851 | 3300031152 | Soil | STKWPAPGSEDTELGVLMELEVDHGETEVHARVQA |
| Ga0307495_100089101 | 3300031199 | Soil | TFDVAFGEWPAAGSEDTELGVLMELEVCHGETEVYTRVQA |
| Ga0307497_101320793 | 3300031226 | Soil | REIVSLFVTKWPAPGSADTELGVLMEPEVSHGKAEVYTRVQA |
| Ga0265325_100943904 | 3300031241 | Rhizosphere | PKKWPAPGSEDTKFGVTMGPEVRHGEAEVHAGVQA |
| Ga0265329_100724261 | 3300031242 | Rhizosphere | LSFLSDNSFGDLGEWPAPGSEDTKLGVLMEPEVRHGKTEVYTRVQA |
| Ga0265339_101306313 | 3300031249 | Rhizosphere | KAVYWPAPGSEDTELGVLMEPEVGHGETEIYAGVQA |
| Ga0307444_11037523 | 3300031360 | Salt Marsh | LAEWPAPGSEDTKFGVTMGPEVQYGGKATVYPRVQA |
| Ga0307506_100184154 | 3300031366 | Soil | PLLTNYMEWPAPGSEDTELGVLMELEVGHGETEVYARVQA |
| Ga0170818_1023884973 | 3300031474 | Forest Soil | AAIDYVLWPAPGSEDTELGVLMELEVDHGETKVYARVQA |
| Ga0302326_108767023 | 3300031525 | Palsa | RQAPADRGLKIIEWPAAGSEDTELGVNMEPEVDHGTKEVYARVQA |
| Ga0302326_124105011 | 3300031525 | Palsa | YLIFKQWPAPGSADTELGVLMEPEVSHGEAEVYARVQA |
| Ga0318534_100329634 | 3300031544 | Soil | VPYEFSREGKLFWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0318538_100196231 | 3300031546 | Soil | LINSMTLWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0318528_100253614 | 3300031561 | Soil | KLFWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0318573_101284573 | 3300031564 | Soil | RTIVPWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0318515_100212926 | 3300031572 | Soil | AGLWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0315550_10779094 | 3300031653 | Salt Marsh Sediment | DRAPLWPAPGSEDTELGVLMELEVRHGEAKVYTRVQT |
| Ga0318560_104450281 | 3300031682 | Soil | SLNIAIWPAPGSEDTELGVLMELEVGHGETEVYARVQA |
| Ga0265314_101790073 | 3300031711 | Rhizosphere | NQKAVYWPAPGSEDTELGVLMEPEVGHGETEIYAGVQA |
| Ga0265314_101798413 | 3300031711 | Rhizosphere | KADNFAHWPAPGSEDTELGVLMELEVGHGEASVYAGVQA |
| Ga0265342_101592813 | 3300031712 | Rhizosphere | FALQENFSNQKAVYWPAPGSEDTELGVLMEPEVGHGETEIYAGVQA |
| Ga0318496_101324024 | 3300031713 | Soil | TDKWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0306917_115457352 | 3300031719 | Soil | MALAASRRFSCWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0318501_101253491 | 3300031736 | Soil | TIVPWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0307468_1003073303 | 3300031740 | Hardwood Forest Soil | SVSVLDLRHPEWPAPGSEDTELGVLMELEVGHGETEVHAGVQA |
| Ga0306918_101779514 | 3300031744 | Soil | KDVAIALNWPAPGSEDTELGVLMELEVGHGETEVYARVQA |
| Ga0318492_101188971 | 3300031748 | Soil | LSLFLRRIKWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0318494_106372233 | 3300031751 | Soil | YRLAEWPAPGSEDTELGVLMELEVCHGETEVYPRVQA |
| Ga0318537_100700381 | 3300031763 | Soil | AIGKIAEWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0318498_101004061 | 3300031778 | Soil | LRSVAKWMWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0318552_100182131 | 3300031782 | Soil | SLAWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0318529_100950771 | 3300031792 | Soil | GVVWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0318497_101514121 | 3300031805 | Soil | KTDKWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0307473_101484204 | 3300031820 | Hardwood Forest Soil | LEAIWPAPGSEDTELGVLMELEVGHGETEVYARVQA |
| Ga0318567_101496221 | 3300031821 | Soil | IGKIAEWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0318499_100653873 | 3300031832 | Soil | VTAFWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0310917_101529251 | 3300031833 | Soil | LWAEAVWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0310917_107635981 | 3300031833 | Soil | GKRKKAVWPAPGSEDTELGVLMEPEVGHGETKVYPRVQA |
| Ga0318511_100884563 | 3300031845 | Soil | LEVGIWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0318512_100232184 | 3300031846 | Soil | RGAYWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0318527_100763133 | 3300031859 | Soil | IRLLERKADWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0306925_100291191 | 3300031890 | Soil | MTLWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0306925_102599883 | 3300031890 | Soil | MSWKIPAWPAPGSEDTELGVLMEPEVGHGETEVYAG |
| Ga0318536_101314213 | 3300031893 | Soil | IAEWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0318551_100817411 | 3300031896 | Soil | ERPQPREAIGKIAEWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0318520_100302171 | 3300031897 | Soil | MAQLWNRCDWPAPGSEDTELGVLMEPEVGHGETEVYP |
| Ga0306921_105567833 | 3300031912 | Soil | CEITATNIHFNWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0306921_120007501 | 3300031912 | Soil | NAHRIPVLVPEEWPARGSEDTELGVLMEREVGHGETEVHPRV |
| Ga0306921_125943711 | 3300031912 | Soil | MARQMERIIWPAPGFEDTELGVLMELEVGHGETEVYARVQ |
| Ga0310913_101874241 | 3300031945 | Soil | MKETRSLPRTIVPWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0310910_115874302 | 3300031946 | Soil | MPTYKKTIWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0318531_100166564 | 3300031981 | Soil | RFFGWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0318563_100698534 | 3300032009 | Soil | YLRHWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0318569_100165304 | 3300032010 | Soil | IAGLWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0310906_107673773 | 3300032013 | Soil | FKFQAAYWPAPGSEDPELGVSMEPEVDHGEAEVYARVQA |
| Ga0318549_100981231 | 3300032041 | Soil | SSSAYWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0315540_101245143 | 3300032061 | Salt Marsh Sediment | VGPDYWPAPGSEDTKFGVTMGPEVGHGEAEVYTRVQA |
| Ga0318510_103442761 | 3300032064 | Soil | SKSFWPAPGSEDTELGVLMEPEVGHGETEVYPRVQV |
| Ga0318525_101331703 | 3300032089 | Soil | GFFGRRPIWPAPGSEDTELGVLMEPEVGHGETEVYARVQA |
| Ga0318525_107205933 | 3300032089 | Soil | SKKAVWPAPGSEDTELRCLMEREADHGETEVYAGVQA |
| Ga0318518_100197174 | 3300032090 | Soil | LNCAQYLAAFWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA |
| Ga0307471_1005982803 | 3300032180 | Hardwood Forest Soil | VVEGWPAAGSEDTELGVLMEPEVGHGETEVYAGVQA |
| Ga0307471_1007169051 | 3300032180 | Hardwood Forest Soil | AIRGTSPWPAPGSEDTELGVLMELEVGHGETEVYTRVQA |
| Ga0335084_104745093 | 3300033004 | Soil | VMGDKWAAAGFVDTKLGVNMEPEVGHGTTEVYARVQA |
| Ga0335077_104978281 | 3300033158 | Soil | SLQLLAVWPAPGSEDTKFGVTMGPEVGHGEAEVYAGVQA |
| Ga0318519_103550221 | 3300033290 | Soil | MSWKIPAWPAPGSEDTELGVLMEPEVGHGETEVYAGVQ |
| Ga0318519_109184371 | 3300033290 | Soil | MARQMERIIWPAPGFEDTELGVLMELEVGHGETEV |
| Ga0310810_104631063 | 3300033412 | Soil | SSSVWPAPGSEDTELGVFMGLEVGHGEAAIYARVQA |
| Ga0310811_104790651 | 3300033475 | Soil | LVRESLKVWPAPGSEDTELGVLMEPEVRHGEAEVYA |
| Ga0316628_1007439854 | 3300033513 | Soil | NKLVWHWPAPGSEDTKFGVTMGPEVGHGEAEVYAGVQA |
| Ga0364945_0040863_1_108 | 3300034115 | Sediment | KDKWAAAGFVDTELGVNMEPEVGHGTTEVYARVQA |
| Ga0370483_0074907_3_131 | 3300034124 | Untreated Peat Soil | AISVLLSFSDWPAPGFTDTELGVLMEPEVDHGEAEVYARVQA |
| Ga0370501_0050562_2_136 | 3300034195 | Untreated Peat Soil | SSFQVYYARHCFWPAPGSEDTELGVLMELEVRHGAASVYAGVQA |
| ⦗Top⦘ |