| Basic Information | |
|---|---|
| Family ID | F019049 |
| Family Type | Metagenome |
| Number of Sequences | 232 |
| Average Sequence Length | 39 residues |
| Representative Sequence | SGAAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK |
| Number of Associated Samples | 215 |
| Number of Associated Scaffolds | 232 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.76 % |
| % of genes near scaffold ends (potentially truncated) | 92.67 % |
| % of genes from short scaffolds (< 2000 bps) | 90.52 % |
| Associated GOLD sequencing projects | 207 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (8.621 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.103 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.845 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.08% β-sheet: 0.00% Coil/Unstructured: 56.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 232 Family Scaffolds |
|---|---|---|
| PF14236 | DUF4338 | 68.10 |
| PF03050 | DDE_Tnp_IS66 | 3.02 |
| PF13518 | HTH_28 | 0.86 |
| PF02518 | HATPase_c | 0.43 |
| PF00440 | TetR_N | 0.43 |
| PF07228 | SpoIIE | 0.43 |
| PF05717 | TnpB_IS66 | 0.43 |
| PF04389 | Peptidase_M28 | 0.43 |
| PF13751 | DDE_Tnp_1_6 | 0.43 |
| PF00266 | Aminotran_5 | 0.43 |
| PF02796 | HTH_7 | 0.43 |
| PF13360 | PQQ_2 | 0.43 |
| PF13466 | STAS_2 | 0.43 |
| PF02371 | Transposase_20 | 0.43 |
| PF00117 | GATase | 0.43 |
| PF03462 | PCRF | 0.43 |
| PF01695 | IstB_IS21 | 0.43 |
| PF00239 | Resolvase | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 232 Family Scaffolds |
|---|---|---|---|
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 3.45 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.43 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.43 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.43 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.50 % |
| Unclassified | root | N/A | 37.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10009839 | All Organisms → cellular organisms → Bacteria | 2635 | Open in IMG/M |
| 3300000955|JGI1027J12803_102513012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300002914|JGI25617J43924_10290957 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005332|Ga0066388_101142398 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300005439|Ga0070711_102002991 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005471|Ga0070698_100383046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1339 | Open in IMG/M |
| 3300005569|Ga0066705_10696761 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005577|Ga0068857_101515285 | Not Available | 654 | Open in IMG/M |
| 3300005577|Ga0068857_102081193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 557 | Open in IMG/M |
| 3300005602|Ga0070762_10145646 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300005614|Ga0068856_100423690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1351 | Open in IMG/M |
| 3300005617|Ga0068859_101601018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 719 | Open in IMG/M |
| 3300005921|Ga0070766_11317987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 500 | Open in IMG/M |
| 3300005949|Ga0066791_10105476 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006028|Ga0070717_11751011 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006041|Ga0075023_100528649 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006059|Ga0075017_101117706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300006086|Ga0075019_10288591 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300006163|Ga0070715_10065320 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300006638|Ga0075522_10010525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6182 | Open in IMG/M |
| 3300006642|Ga0075521_10399402 | Not Available | 669 | Open in IMG/M |
| 3300006894|Ga0079215_10194136 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300006954|Ga0079219_12039186 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300007004|Ga0079218_11192613 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300007004|Ga0079218_12559711 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300007517|Ga0105045_10742098 | Not Available | 669 | Open in IMG/M |
| 3300009012|Ga0066710_101841853 | Not Available | 910 | Open in IMG/M |
| 3300009029|Ga0066793_10430420 | Not Available | 757 | Open in IMG/M |
| 3300009143|Ga0099792_10158608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1253 | Open in IMG/M |
| 3300009148|Ga0105243_11153498 | Not Available | 786 | Open in IMG/M |
| 3300009156|Ga0111538_10070441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. SK-3 | 4452 | Open in IMG/M |
| 3300009161|Ga0114966_10001220 | All Organisms → cellular organisms → Bacteria | 23993 | Open in IMG/M |
| 3300009162|Ga0075423_11406822 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300009177|Ga0105248_13132024 | Not Available | 526 | Open in IMG/M |
| 3300009628|Ga0116125_1211881 | Not Available | 554 | Open in IMG/M |
| 3300009631|Ga0116115_1071959 | Not Available | 900 | Open in IMG/M |
| 3300009632|Ga0116102_1192752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300009633|Ga0116129_1032516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1718 | Open in IMG/M |
| 3300009645|Ga0116106_1297467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300009665|Ga0116135_1149135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 873 | Open in IMG/M |
| 3300009683|Ga0116224_10420980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300009764|Ga0116134_1143661 | Not Available | 845 | Open in IMG/M |
| 3300009792|Ga0126374_10791104 | Not Available | 724 | Open in IMG/M |
| 3300009824|Ga0116219_10124297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1500 | Open in IMG/M |
| 3300009826|Ga0123355_10948511 | Not Available | 924 | Open in IMG/M |
| 3300009839|Ga0116223_10768696 | Not Available | 552 | Open in IMG/M |
| 3300010048|Ga0126373_13197665 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010343|Ga0074044_10387655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 915 | Open in IMG/M |
| 3300010360|Ga0126372_12162208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300010360|Ga0126372_12407798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300010373|Ga0134128_11362631 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300010379|Ga0136449_100468405 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
| 3300010379|Ga0136449_101493986 | Not Available | 1035 | Open in IMG/M |
| 3300010379|Ga0136449_103197428 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300010398|Ga0126383_11401635 | Not Available | 789 | Open in IMG/M |
| 3300011269|Ga0137392_10517903 | Not Available | 991 | Open in IMG/M |
| 3300011997|Ga0120162_1054877 | Not Available | 947 | Open in IMG/M |
| 3300012203|Ga0137399_10851446 | Not Available | 768 | Open in IMG/M |
| 3300012285|Ga0137370_10786414 | Not Available | 590 | Open in IMG/M |
| 3300012361|Ga0137360_11096698 | Not Available | 687 | Open in IMG/M |
| 3300012363|Ga0137390_11253924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300012469|Ga0150984_115237477 | Not Available | 722 | Open in IMG/M |
| 3300012527|Ga0136633_1309776 | Not Available | 570 | Open in IMG/M |
| 3300012533|Ga0138256_10620258 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300012668|Ga0157216_10244471 | Not Available | 837 | Open in IMG/M |
| 3300012912|Ga0157306_10084695 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300012938|Ga0162651_100041049 | Not Available | 708 | Open in IMG/M |
| 3300012944|Ga0137410_11437919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300012956|Ga0154020_10071861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3494 | Open in IMG/M |
| 3300012957|Ga0164303_10527656 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012958|Ga0164299_10077622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1654 | Open in IMG/M |
| 3300012971|Ga0126369_12926627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300013097|Ga0136639_10250236 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300014162|Ga0181538_10701260 | Not Available | 524 | Open in IMG/M |
| 3300014200|Ga0181526_10487090 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300014325|Ga0163163_13249566 | Not Available | 507 | Open in IMG/M |
| 3300014489|Ga0182018_10078407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1962 | Open in IMG/M |
| 3300014490|Ga0182010_10266066 | Not Available | 914 | Open in IMG/M |
| 3300014492|Ga0182013_10671389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300014493|Ga0182016_10266771 | Not Available | 1064 | Open in IMG/M |
| 3300014501|Ga0182024_11183822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300014502|Ga0182021_10819929 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300014638|Ga0181536_10006211 | All Organisms → cellular organisms → Bacteria | 12051 | Open in IMG/M |
| 3300014638|Ga0181536_10438209 | Not Available | 577 | Open in IMG/M |
| 3300015167|Ga0167661_1031943 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300015372|Ga0132256_102830767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300016270|Ga0182036_11062502 | Not Available | 669 | Open in IMG/M |
| 3300016270|Ga0182036_11706153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300016294|Ga0182041_10684501 | Not Available | 908 | Open in IMG/M |
| 3300016371|Ga0182034_10151237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1744 | Open in IMG/M |
| 3300017929|Ga0187849_1373227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300017946|Ga0187879_10556576 | Not Available | 637 | Open in IMG/M |
| 3300017961|Ga0187778_10628665 | Not Available | 721 | Open in IMG/M |
| 3300017973|Ga0187780_10984476 | Not Available | 614 | Open in IMG/M |
| 3300018008|Ga0187888_1024728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3081 | Open in IMG/M |
| 3300018014|Ga0187860_1308534 | Not Available | 611 | Open in IMG/M |
| 3300018024|Ga0187881_10193151 | Not Available | 869 | Open in IMG/M |
| 3300018033|Ga0187867_10185421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
| 3300018042|Ga0187871_10248631 | Not Available | 987 | Open in IMG/M |
| 3300018057|Ga0187858_10399769 | Not Available | 854 | Open in IMG/M |
| 3300018062|Ga0187784_10343903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1209 | Open in IMG/M |
| 3300018062|Ga0187784_10714517 | Not Available | 801 | Open in IMG/M |
| 3300018476|Ga0190274_13587148 | Not Available | 524 | Open in IMG/M |
| 3300019787|Ga0182031_1306218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1270 | Open in IMG/M |
| 3300019787|Ga0182031_1359251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2278 | Open in IMG/M |
| 3300020022|Ga0193733_1049549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300020221|Ga0194127_10371325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 950 | Open in IMG/M |
| 3300021405|Ga0210387_10340653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
| 3300021424|Ga0194117_10209213 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300021475|Ga0210392_10666084 | Not Available | 774 | Open in IMG/M |
| 3300021478|Ga0210402_11893654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300021560|Ga0126371_12181916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300022213|Ga0224500_10129998 | Not Available | 948 | Open in IMG/M |
| 3300022516|Ga0224542_1018485 | Not Available | 891 | Open in IMG/M |
| 3300022861|Ga0224528_1021334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1501 | Open in IMG/M |
| 3300023088|Ga0224555_1218318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300023259|Ga0224551_1031683 | Not Available | 911 | Open in IMG/M |
| 3300024181|Ga0247693_1056270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300025461|Ga0208851_1045284 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300025495|Ga0207932_1097776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 583 | Open in IMG/M |
| 3300025604|Ga0207930_1083153 | Not Available | 748 | Open in IMG/M |
| 3300025725|Ga0209638_1043825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1882 | Open in IMG/M |
| 3300025912|Ga0207707_10204741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1720 | Open in IMG/M |
| 3300025913|Ga0207695_11206457 | Not Available | 637 | Open in IMG/M |
| 3300025915|Ga0207693_10102185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2248 | Open in IMG/M |
| 3300025925|Ga0207650_10597152 | Not Available | 928 | Open in IMG/M |
| 3300025926|Ga0207659_10393663 | Not Available | 1158 | Open in IMG/M |
| 3300025936|Ga0207670_10126585 | All Organisms → cellular organisms → Bacteria | 1865 | Open in IMG/M |
| 3300025949|Ga0207667_11943988 | Not Available | 549 | Open in IMG/M |
| 3300026023|Ga0207677_11861129 | Not Available | 559 | Open in IMG/M |
| 3300026088|Ga0207641_10444299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
| 3300026095|Ga0207676_12571687 | Not Available | 505 | Open in IMG/M |
| 3300026217|Ga0209871_1016901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1356 | Open in IMG/M |
| 3300026332|Ga0209803_1062572 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300026371|Ga0257179_1037934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300026451|Ga0247845_1014064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1318 | Open in IMG/M |
| 3300026494|Ga0257159_1063105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300026499|Ga0257181_1005622 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300026514|Ga0257168_1069300 | Not Available | 778 | Open in IMG/M |
| 3300026538|Ga0209056_10065837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3139 | Open in IMG/M |
| 3300026551|Ga0209648_10442550 | Not Available | 814 | Open in IMG/M |
| 3300026551|Ga0209648_10449056 | Not Available | 802 | Open in IMG/M |
| 3300026728|Ga0208069_100408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
| 3300026879|Ga0207763_1003872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1681 | Open in IMG/M |
| 3300026890|Ga0207781_1001543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3051 | Open in IMG/M |
| 3300027326|Ga0209731_1018276 | Not Available | 964 | Open in IMG/M |
| 3300027516|Ga0207761_1086033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300027587|Ga0209220_1004186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3866 | Open in IMG/M |
| 3300027618|Ga0208736_1101358 | Not Available | 691 | Open in IMG/M |
| 3300027676|Ga0209333_1103024 | Not Available | 777 | Open in IMG/M |
| 3300027680|Ga0207826_1069407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 971 | Open in IMG/M |
| 3300027770|Ga0209086_10000738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 27523 | Open in IMG/M |
| 3300027770|Ga0209086_10013743 | All Organisms → cellular organisms → Bacteria | 5337 | Open in IMG/M |
| 3300027842|Ga0209580_10296501 | Not Available | 805 | Open in IMG/M |
| 3300027854|Ga0209517_10325180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300027874|Ga0209465_10561727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300027875|Ga0209283_10192964 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300027895|Ga0209624_10124199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1696 | Open in IMG/M |
| 3300027905|Ga0209415_10829729 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300027910|Ga0209583_10204023 | Not Available | 846 | Open in IMG/M |
| (restricted) 3300027970|Ga0247837_1147316 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300028381|Ga0268264_11339834 | Not Available | 726 | Open in IMG/M |
| 3300028762|Ga0302202_10282393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 808 | Open in IMG/M |
| 3300028788|Ga0302189_10125478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1133 | Open in IMG/M |
| 3300028792|Ga0307504_10037542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1320 | Open in IMG/M |
| 3300028798|Ga0302222_10021572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2638 | Open in IMG/M |
| 3300028798|Ga0302222_10335725 | Not Available | 589 | Open in IMG/M |
| 3300028798|Ga0302222_10381133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300028859|Ga0302265_1124686 | Not Available | 813 | Open in IMG/M |
| 3300028871|Ga0302230_10144764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 933 | Open in IMG/M |
| 3300028873|Ga0302197_10136596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1194 | Open in IMG/M |
| 3300028874|Ga0302155_10088686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1384 | Open in IMG/M |
| 3300028882|Ga0302154_10414997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300028906|Ga0308309_11357331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300029882|Ga0311368_10565924 | Not Available | 806 | Open in IMG/M |
| 3300029883|Ga0311327_10435614 | Not Available | 816 | Open in IMG/M |
| 3300029907|Ga0311329_10941564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300029911|Ga0311361_10644960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300029917|Ga0311326_10651595 | Not Available | 503 | Open in IMG/M |
| 3300029951|Ga0311371_11994050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300029986|Ga0302188_10184813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300029992|Ga0302276_10162812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1076 | Open in IMG/M |
| 3300030020|Ga0311344_10412224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300030041|Ga0302274_10500208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300030225|Ga0302196_10195865 | Not Available | 1007 | Open in IMG/M |
| 3300030339|Ga0311360_11192620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300030499|Ga0268259_10088469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300030518|Ga0302275_10005530 | All Organisms → cellular organisms → Bacteria | 12146 | Open in IMG/M |
| 3300030519|Ga0302193_10649643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300030618|Ga0311354_11706123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 550 | Open in IMG/M |
| 3300030677|Ga0302317_10284855 | Not Available | 742 | Open in IMG/M |
| 3300030693|Ga0302313_10154275 | Not Available | 936 | Open in IMG/M |
| 3300031234|Ga0302325_12706800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300031238|Ga0265332_10093507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1270 | Open in IMG/M |
| 3300031259|Ga0302187_10279874 | Not Available | 828 | Open in IMG/M |
| 3300031261|Ga0302140_10709653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300031525|Ga0302326_11094065 | Not Available | 1108 | Open in IMG/M |
| 3300031544|Ga0318534_10300261 | Not Available | 925 | Open in IMG/M |
| 3300031546|Ga0318538_10122033 | Not Available | 1361 | Open in IMG/M |
| 3300031573|Ga0310915_10933066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300031670|Ga0307374_10253033 | Not Available | 1175 | Open in IMG/M |
| 3300031681|Ga0318572_10227567 | Not Available | 1094 | Open in IMG/M |
| 3300031718|Ga0307474_11230594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300031719|Ga0306917_10176230 | Not Available | 1605 | Open in IMG/M |
| 3300031719|Ga0306917_11225095 | Not Available | 582 | Open in IMG/M |
| 3300031770|Ga0318521_10390794 | Not Available | 828 | Open in IMG/M |
| 3300031793|Ga0318548_10069854 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300031798|Ga0318523_10291073 | Not Available | 815 | Open in IMG/M |
| 3300031890|Ga0306925_10929923 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300031912|Ga0306921_10795230 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300031941|Ga0310912_10011613 | All Organisms → cellular organisms → Bacteria | 5587 | Open in IMG/M |
| 3300031946|Ga0310910_10035531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3424 | Open in IMG/M |
| 3300031954|Ga0306926_10351963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1821 | Open in IMG/M |
| 3300031962|Ga0307479_11077949 | Not Available | 770 | Open in IMG/M |
| 3300032066|Ga0318514_10583837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300032116|Ga0315903_10819810 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300032160|Ga0311301_11901552 | Not Available | 701 | Open in IMG/M |
| 3300032783|Ga0335079_10900174 | Not Available | 909 | Open in IMG/M |
| 3300032805|Ga0335078_10398803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1807 | Open in IMG/M |
| 3300032898|Ga0335072_11367304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300033158|Ga0335077_10123285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3009 | Open in IMG/M |
| 3300033158|Ga0335077_10130500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 2908 | Open in IMG/M |
| 3300033158|Ga0335077_11131807 | Not Available | 771 | Open in IMG/M |
| 3300033289|Ga0310914_10884997 | Not Available | 792 | Open in IMG/M |
| 3300033290|Ga0318519_10701281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300033412|Ga0310810_10058017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4699 | Open in IMG/M |
| 3300033480|Ga0316620_11562336 | Not Available | 653 | Open in IMG/M |
| 3300033513|Ga0316628_100527602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1528 | Open in IMG/M |
| 3300033513|Ga0316628_101053181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1081 | Open in IMG/M |
| 3300033818|Ga0334804_069331 | Not Available | 968 | Open in IMG/M |
| 3300033829|Ga0334854_093030 | Not Available | 721 | Open in IMG/M |
| 3300034820|Ga0373959_0174327 | Not Available | 556 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.62% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 8.62% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.02% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.02% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.16% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.29% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.86% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.86% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.43% |
| Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 0.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.43% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.43% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.43% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.43% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.43% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.43% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.43% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.43% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.43% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.43% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.43% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.43% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.43% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.43% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.43% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.43% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005949 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007517 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011997 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_18M | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013097 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ859 (21.06) | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022516 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 30-34 | Environmental | Open in IMG/M |
| 3300022861 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T25 | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026451 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T-25 | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026728 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN412 (SPAdes) | Environmental | Open in IMG/M |
| 3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027618 | Polar desert microbial communities from Antarctic Dry Valleys - UQ255 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028859 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030225 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100098391 | 3300000597 | Forest Soil | QPAKKLEAYEAQLLLAAGDVSRVRAAPMWRRVDGPN* |
| JGI1027J12803_1025130121 | 3300000955 | Soil | EATGATKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK* |
| JGI25617J43924_102909571 | 3300002914 | Grasslands Soil | QASEPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK* |
| Ga0066388_1011423981 | 3300005332 | Tropical Forest Soil | ESDRPAKPLEAYAVQVLMAAGDVSRVRAAPMWRRVGAPRV* |
| Ga0070711_1020029912 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FQWWPEASGASKPLEAYEAQLLLVAGDVSRVHAAPMWRRVNAGR* |
| Ga0070698_1003830461 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RFVWRPEATGTTKSLEAYEAQLLMAAGDLSRVRAAPMWRRVSALK* |
| Ga0066705_106967612 | 3300005569 | Soil | ATKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK* |
| Ga0068857_1015152851 | 3300005577 | Corn Rhizosphere | PAKPLEAYEAHLLMAAGDVSRVRAAPMWRRVGRLK* |
| Ga0068857_1020811932 | 3300005577 | Corn Rhizosphere | WWPEATGTTKPLEAYEAQLLMAAGDVSRLRAAPMWRRVGVLK* |
| Ga0070762_101456463 | 3300005602 | Soil | AKPLEAYEAQLLMAAGDVSRVRAAPMWRRVSVLK* |
| Ga0068856_1004236901 | 3300005614 | Corn Rhizosphere | ESNSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVS* |
| Ga0068859_1016010182 | 3300005617 | Switchgrass Rhizosphere | SDAPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNTLK* |
| Ga0070766_113179872 | 3300005921 | Soil | GAAKPLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK* |
| Ga0066791_101054761 | 3300005949 | Soil | TSKPLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK* |
| Ga0070717_117510111 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QGRFAWWPESSSAAERLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK* |
| Ga0075023_1005286491 | 3300006041 | Watersheds | EASEAAKPLEAYEAQLLLAAGDVSRVRAAPMWRRVTALK* |
| Ga0075017_1011177061 | 3300006059 | Watersheds | TEATKPLEAYEAQLLMVAGDLSRVKAAPMWRPVNAPK* |
| Ga0075019_102885912 | 3300006086 | Watersheds | SGAAKSLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK* |
| Ga0070715_100653203 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GTTKSLEAYEAQLLMAAGDLSRVRAAPMWRRVSALK* |
| Ga0075522_100105251 | 3300006638 | Arctic Peat Soil | WWPESSSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSEVK* |
| Ga0075521_103994022 | 3300006642 | Arctic Peat Soil | NSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSELA* |
| Ga0079215_101941361 | 3300006894 | Agricultural Soil | EPAKSLEAYEAQLLMAAGDVSRARAAPMWRRVNGPK* |
| Ga0079219_120391861 | 3300006954 | Agricultural Soil | SGNSPGKPLEAYEAQLLLAAGDVSRVRAAPMWRRVNTAR* |
| Ga0079218_111926132 | 3300007004 | Agricultural Soil | VWWPEATGTTKPLEAYEAQLLMAAGDLSKVRAAPMWRRVGVLK* |
| Ga0079218_125597112 | 3300007004 | Agricultural Soil | WPESDAPAKPLEAYEAQMLMAAGDVSRVRVAPMWPRVNTLK* |
| Ga0105045_107420983 | 3300007517 | Freshwater | WPESGNVAKQLEAYQALLLFAAGDVAGVRAAPMWRRVNALK* |
| Ga0066710_1018418531 | 3300009012 | Grasslands Soil | IWWPEASEPTKSLEAFEVQLLMAAGDVSRVRAAPMWRRVKALK |
| Ga0066793_104304202 | 3300009029 | Prmafrost Soil | DAAAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNPTK* |
| Ga0099792_101586081 | 3300009143 | Vadose Zone Soil | TTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVSALK* |
| Ga0105243_111534981 | 3300009148 | Miscanthus Rhizosphere | PEASGPTKPLEAYEAQLLMGAGDLSRVMAAPMWRRVGVLK* |
| Ga0111538_100704417 | 3300009156 | Populus Rhizosphere | MWWPEATGTTKPLEAYEAQLLMAAGDVSRVRAAPMWRRVGVLK* |
| Ga0114966_1000122020 | 3300009161 | Freshwater Lake | WWPESDNAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNTLQ* |
| Ga0075423_114068223 | 3300009162 | Populus Rhizosphere | MWWPEATGTTKPLEAYEAQLLMAAGYVSRVRAAPMWRRVGVLK* |
| Ga0105248_131320241 | 3300009177 | Switchgrass Rhizosphere | ATGPTKPLEAYEAQLLMAAGDLSKVRAAPMWRRVGVLK* |
| Ga0116125_12118811 | 3300009628 | Peatland | AAAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNAIK* |
| Ga0116115_10719591 | 3300009631 | Peatland | QVAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK* |
| Ga0116102_11927521 | 3300009632 | Peatland | LPESDAAAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNPIK* |
| Ga0116129_10325163 | 3300009633 | Peatland | EAAKPLESYEAQLLMAAGDVSRVRAAPMWRRVNVLK* |
| Ga0116106_12974672 | 3300009645 | Peatland | PEATGPAKPLEAYEAQLLLAAGDLSRVRAAPMWRRVRVLK* |
| Ga0116135_11491351 | 3300009665 | Peatland | WWPESTNAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVSVPK* |
| Ga0116224_104209802 | 3300009683 | Peatlands Soil | TEPTKPLEAYEAQLLMAAGDLSRVKAAPMWRRVNTPK* |
| Ga0116134_11436611 | 3300009764 | Peatland | SQVAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK* |
| Ga0126374_107911042 | 3300009792 | Tropical Forest Soil | PEADTPAKRLESYEAQLLLAAGDVSRVRAAPMWRRVNGTQLVNS* |
| Ga0116219_101242971 | 3300009824 | Peatlands Soil | ATGPTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK* |
| Ga0123355_109485111 | 3300009826 | Termite Gut | QPAKKLEAYEAQLLLAAGDVSRVRAAPMWRRVNGPD* |
| Ga0116223_107686961 | 3300009839 | Peatlands Soil | WWPEASGPAKPLEAYEVQLLMAAGDVSRVRAAPMWRRVSGPK* |
| Ga0126373_131976652 | 3300010048 | Tropical Forest Soil | AKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALR* |
| Ga0074044_103876552 | 3300010343 | Bog Forest Soil | WWPEATGPAKGLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK* |
| Ga0126372_121622082 | 3300010360 | Tropical Forest Soil | EAVEPAKPLEAYEAQLLMAAGDLSRLRAAPMWRRVNARK* |
| Ga0126372_124077981 | 3300010360 | Tropical Forest Soil | ATSLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK* |
| Ga0134128_113626311 | 3300010373 | Terrestrial Soil | KWWPEASGPAKSLEAYEAQLLMAAGDVSRVRAAPMWRRVNG* |
| Ga0136449_1004684054 | 3300010379 | Peatlands Soil | WPEGIEATKPLEAYEAQLLMVAGDLSRVKAAPMWRPVNAPK* |
| Ga0136449_1014939862 | 3300010379 | Peatlands Soil | GPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK* |
| Ga0136449_1031974282 | 3300010379 | Peatlands Soil | VWWPEGTGATKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK* |
| Ga0126383_114016351 | 3300010398 | Tropical Forest Soil | TWWPEAVEPAKPLEAYEVQLLMAAGDLSRVRAAPMWRRVTARK* |
| Ga0137392_105179032 | 3300011269 | Vadose Zone Soil | EASGAAKAIEAYEAHLLMAAGDVSQVRAAPMWRRVSAGK* |
| Ga0120162_10548771 | 3300011997 | Permafrost | RQESTSAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK* |
| Ga0137399_108514462 | 3300012203 | Vadose Zone Soil | PAKSLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK* |
| Ga0137370_107864141 | 3300012285 | Vadose Zone Soil | IESAKPLEAYEAQLLMAAGDLSGVRAAPMWHRVTARK* |
| Ga0137360_110966982 | 3300012361 | Vadose Zone Soil | QPAKLLEAYEVHLLMAAGDVSRVRAAPMWRRVNALK* |
| Ga0137390_112539241 | 3300012363 | Vadose Zone Soil | ATGTTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK* |
| Ga0150984_1152374773 | 3300012469 | Avena Fatua Rhizosphere | RFQWWPEASGASKPLEAYEARLLLATGDVTGVHVAPL* |
| Ga0136633_13097762 | 3300012527 | Polar Desert Sand | GDAAKQLEAYEALLLFAAGDVERVRAAPMWRRVNALK* |
| Ga0138256_106202582 | 3300012533 | Active Sludge | WPESDHAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNALK* |
| Ga0157216_102444711 | 3300012668 | Glacier Forefield Soil | WWPESGNAAQQLEAYEALLLFAAGDVARVRAAPMWRRVNALK* |
| Ga0157306_100846952 | 3300012912 | Soil | MWWPEATGTTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK* |
| Ga0162651_1000410492 | 3300012938 | Soil | EAGGATKPLEAYEAQLLMAAGGVSRVRAAPMWRRINALK* |
| Ga0137410_114379191 | 3300012944 | Vadose Zone Soil | ATGPTKSLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK* |
| Ga0154020_100718611 | 3300012956 | Active Sludge | AAKQLEAYEALLLFAAGDVARVRAAPMWRRVNVLK* |
| Ga0164303_105276561 | 3300012957 | Soil | GPAKGLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK* |
| Ga0164299_100776221 | 3300012958 | Soil | EPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVTARK* |
| Ga0126369_129266273 | 3300012971 | Tropical Forest Soil | PEASSAAKSLEAYEAQLLMAAGDVSRVRAAPMWRRVNG* |
| Ga0136639_102502361 | 3300013097 | Polar Desert Sand | KGRFIWWPESGNVAKQLEAYQALLLFAAGDVAGVRAPPMWRRVNALK* |
| Ga0181538_107012602 | 3300014162 | Bog | EAAGPTKPLEAYEAQLLMAAGDLSKVRAAPMWRRVGVLK* |
| Ga0181526_104870901 | 3300014200 | Bog | EASEPAKPLEAYEAHLLMAAGDVSRVRAAPMWRRVGRLK* |
| Ga0163163_132495661 | 3300014325 | Switchgrass Rhizosphere | ESETPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK* |
| Ga0182018_100784073 | 3300014489 | Palsa | AKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK* |
| Ga0182010_102660661 | 3300014490 | Fen | SSAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVSVLK* |
| Ga0182013_106713891 | 3300014492 | Bog | PESTSPAKALEAYEAQLLMVAGDVSRVRAAPMWRRVSELK* |
| Ga0182016_102667712 | 3300014493 | Bog | SISAAKPLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK* |
| Ga0182024_111838222 | 3300014501 | Permafrost | WWPEANSPAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSEVK* |
| Ga0182021_108199291 | 3300014502 | Fen | SSAAKQLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK* |
| Ga0181536_1000621115 | 3300014638 | Bog | EGTEATKPLEAYEAQLLMVAGDLSRVKAAPMWRPVNAPK* |
| Ga0181536_104382091 | 3300014638 | Bog | APAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNTIK* |
| Ga0167661_10319431 | 3300015167 | Glacier Forefield Soil | DKPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVTALK* |
| Ga0132256_1028307672 | 3300015372 | Arabidopsis Rhizosphere | PEASGPTKPLEAYEAQLLMAAGDLSRVRAVPMWRRVGVLK* |
| Ga0182036_110625021 | 3300016270 | Soil | PAKRLEAYEAQLLLAAGDVSRVRAAPMWRRVNGPN |
| Ga0182036_117061532 | 3300016270 | Soil | WWPEADVPTKRLESYEAHLLLAAGDVSRVHAAPMWKRVDGTQLANP |
| Ga0182041_106845011 | 3300016294 | Soil | WPEAAEATKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNTPN |
| Ga0182034_101512371 | 3300016371 | Soil | MVAEAAEATKPLEANEAQLLMAAGDPSRVRAAPMWRRVNAPK |
| Ga0187849_13732272 | 3300017929 | Peatland | EATGPTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK |
| Ga0187879_105565762 | 3300017946 | Peatland | AAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNAMK |
| Ga0187778_106286652 | 3300017961 | Tropical Peatland | WWPQAEQPAKRLESYEAQLLLAAGDVSRVRAAPVWRRVNEPK |
| Ga0187780_109844761 | 3300017973 | Tropical Peatland | PTKGLEAYEAQLLMAAGDVSRVCAAPMWRRVNTIK |
| Ga0187888_10247284 | 3300018008 | Peatland | VWWPEASEAAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK |
| Ga0187860_13085342 | 3300018014 | Peatland | SDAPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNTIK |
| Ga0187881_101931511 | 3300018024 | Peatland | PESDAAAKALEAYEAQLLMAAGDLSRVRAAPMWRRVNAIK |
| Ga0187867_101854211 | 3300018033 | Peatland | VWWPEATGPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK |
| Ga0187871_102486311 | 3300018042 | Peatland | AAKQLEAYEAQLLMVAGDVSRVCAAPMWRRVSVLK |
| Ga0187858_103997691 | 3300018057 | Peatland | ATGPTKPLEAYEAQLLLAAGDLSRVRAAPMWRRVRVLK |
| Ga0187784_103439031 | 3300018062 | Tropical Peatland | ESDAPAKPLEAYEAQLLMAAGDHPHLRAAAMWRRVNALR |
| Ga0187784_107145172 | 3300018062 | Tropical Peatland | DKPTKRLESYEAQLLLAAGDVSRVRAAPMWRRVNGPN |
| Ga0190274_135871482 | 3300018476 | Soil | IWWPESGSAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNVLK |
| Ga0182031_13062183 | 3300019787 | Bog | PAKPLEAYEAQLLLAAGDLSRVRAAPMWRRVRVLK |
| Ga0182031_13592511 | 3300019787 | Bog | VWPKSSSAAKPLEAYEAQLLMVAGDVSRVRAAPMWRRVSVLK |
| Ga0193733_10495493 | 3300020022 | Soil | SGAAKALEAYEAQLLMAAGDVSRVRAAPMWRRVNVQK |
| Ga0194127_103713253 | 3300020221 | Freshwater Lake | VWWPAPESTGHAAKPLEAYEAQLLLAAGDLSRVRAAPMWRRVRALK |
| Ga0210387_103406531 | 3300021405 | Soil | EGSGAAKPLEAYEAQLLMAAGDVSRVRVAPMWRRVNVLK |
| Ga0194117_102092131 | 3300021424 | Freshwater Lake | NDAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNALK |
| Ga0210392_106660841 | 3300021475 | Soil | VGWPESSEPAKPLEAYEAQLLMAAGDIARVRAAPMWRRVNVLK |
| Ga0210402_118936542 | 3300021478 | Soil | AAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSEQK |
| Ga0126371_121819161 | 3300021560 | Tropical Forest Soil | EGATKGLEAYEVQLLMAAGDVSRVRAAPMWRRVNAPK |
| Ga0224500_101299981 | 3300022213 | Sediment | EAAKPLEAYEAQLLLAAGDVSRVRAAPMWRRVTALK |
| Ga0224542_10184851 | 3300022516 | Soil | SSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK |
| Ga0224528_10213345 | 3300022861 | Soil | FTCWPESSSAAKALEAYEAQLLMVAGDVSRVRAAPMWRRVSELK |
| Ga0224555_12183181 | 3300023088 | Soil | ESGSAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVNELK |
| Ga0224551_10316831 | 3300023259 | Soil | PQASEPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK |
| Ga0247693_10562702 | 3300024181 | Soil | WPEGTEATKPLEAYEAQLLMAAGDLSRVKAAPMWRRVNAPK |
| Ga0208851_10452842 | 3300025461 | Arctic Peat Soil | PTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK |
| Ga0207932_10977761 | 3300025495 | Arctic Peat Soil | TWWPESATAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVSVLK |
| Ga0207930_10831532 | 3300025604 | Arctic Peat Soil | PEATGATKPLEAYEAQLLMAAGDLSRVRVAPMWRRVGVPK |
| Ga0209638_10438253 | 3300025725 | Arctic Peat Soil | VWWPEGSAAAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK |
| Ga0207707_102047413 | 3300025912 | Corn Rhizosphere | EPTKPLEAYEAQLLMAAGDLSRVKAAPMWRRVNTPK |
| Ga0207695_112064571 | 3300025913 | Corn Rhizosphere | SEPAKLLEAYEAQLLIVAGDVSRVRAAPMWRPVNTLK |
| Ga0207693_101021853 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ATEPTKLLDAYEAQLLMAAGDLSRVRAAPMWRRVNTPK |
| Ga0207650_105971521 | 3300025925 | Switchgrass Rhizosphere | MVAGSEPAKPLEAYEAHLLMAAGDVSRVRAAPMWRRVGRLK |
| Ga0207659_103936633 | 3300025926 | Miscanthus Rhizosphere | WPEATGTTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK |
| Ga0207670_101265852 | 3300025936 | Switchgrass Rhizosphere | MWWPEATGTTKPLEAYEAQLLMAAGDVSRVRAAPMWRRVGVLK |
| Ga0207667_119439881 | 3300025949 | Corn Rhizosphere | PAKPLEAYEANLLMAAGGISRVRAAPMWRRVGRLK |
| Ga0207677_118611292 | 3300026023 | Miscanthus Rhizosphere | ASGPAKSLEAYEAQLLMAAGDVSRVRAAPMWRRVNG |
| Ga0207641_104442993 | 3300026088 | Switchgrass Rhizosphere | SGPTKPLEAYEAQLLVAAGDLSRVRAAPMWRRVGVLK |
| Ga0207676_125716871 | 3300026095 | Switchgrass Rhizosphere | WPESDAPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNTLK |
| Ga0209871_10169011 | 3300026217 | Permafrost Soil | EATGTTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK |
| Ga0209803_10625721 | 3300026332 | Soil | EPAKPLEAYEAHLLMAAGDVSRVRAAPMWRRVGRLK |
| Ga0257179_10379341 | 3300026371 | Soil | SGAAKSLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK |
| Ga0247845_10140643 | 3300026451 | Soil | WWPESSSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK |
| Ga0257159_10631052 | 3300026494 | Soil | GSGPARALEAYEAQLLMAAGDVSRVRAAPMWRRVSVLK |
| Ga0257181_10056221 | 3300026499 | Soil | SEPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVGVLK |
| Ga0257168_10693002 | 3300026514 | Soil | PEGSGAAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK |
| Ga0209056_100658374 | 3300026538 | Soil | GTTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK |
| Ga0209648_104425501 | 3300026551 | Grasslands Soil | GSGAAKSLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK |
| Ga0209648_104490562 | 3300026551 | Grasslands Soil | QASEPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK |
| Ga0208069_1004081 | 3300026728 | Soil | TTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK |
| Ga0207763_10038721 | 3300026879 | Tropical Forest Soil | PAKPLEAYEAQLLMAAGDVSRLRAAPMWRRVNALK |
| Ga0207781_10015433 | 3300026890 | Tropical Forest Soil | MVPESEAPAKPLESYEAQLLMAAGDVSRLRAAPMWRRVNALK |
| Ga0209731_10182762 | 3300027326 | Forest Soil | WWPEASEAAKRLETYEAQLLMAAGDVSRVRAAPMWRRVEAPP |
| Ga0207761_10860331 | 3300027516 | Tropical Forest Soil | SSAAKALEAYEAQLLMVAGDVSRVRAAPMWRRVSALG |
| Ga0209220_10041865 | 3300027587 | Forest Soil | PAKPLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK |
| Ga0208736_11013582 | 3300027618 | Polar Desert | ATAPAKPLEAYEVQLLMAAGDVSRVRAAPMWRRVNALK |
| Ga0209333_11030241 | 3300027676 | Forest Soil | AAKPLESYEAQLLMAAGDVSRVRAAPMWRRVNVLK |
| Ga0207826_10694072 | 3300027680 | Tropical Forest Soil | VQRKIHMVPESEAPAKPLEAYEAQLLMAAGDVSRLRAAPMWRRVNALK |
| Ga0209086_1000073823 | 3300027770 | Freshwater Lake | WWPESDNAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNTLQ |
| Ga0209086_100137436 | 3300027770 | Freshwater Lake | WPESDNAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNTLK |
| Ga0209580_102965011 | 3300027842 | Surface Soil | GTEATKPLEAYEAQLLMVAGDLSRVKAAPMWRPVNTPK |
| Ga0209517_103251801 | 3300027854 | Peatlands Soil | GPAKPLEAYEVQLLMAAGDVSRVRAAPMWRRVSGPK |
| Ga0209465_105617272 | 3300027874 | Tropical Forest Soil | PAKALEAYEAHLLMAAGDVSRVRAAPMWRRVGALK |
| Ga0209283_101929641 | 3300027875 | Vadose Zone Soil | PAKGLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK |
| Ga0209624_101241991 | 3300027895 | Forest Soil | AGAAQSLEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK |
| Ga0209415_108297291 | 3300027905 | Peatlands Soil | EANGRTKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK |
| Ga0209583_102040232 | 3300027910 | Watersheds | MSHSDHAEAAKPLEAYEAQLLLAAGDVSRVRAAPMWRRVTALK |
| (restricted) Ga0247837_11473162 | 3300027970 | Freshwater | SDHAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNTLK |
| Ga0268264_113398341 | 3300028381 | Switchgrass Rhizosphere | SEPAKPLEAYEAHLLMAAGDVSRVRAAPMWRRVGRLK |
| Ga0302202_102823932 | 3300028762 | Bog | FTWWPESISAAKPLEAYEAQLLMVAGDVSRVRAAPMWRRVNELK |
| Ga0302189_101254783 | 3300028788 | Bog | SAAKALEAYDAQLLMVAGDVSRVRAAPMWRRVSVLK |
| Ga0307504_100375421 | 3300028792 | Soil | PAKLLEAYEAHLLMAAGDVSRVRAAPMWRRVNAPK |
| Ga0302222_100215721 | 3300028798 | Palsa | AWWPESSSSAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK |
| Ga0302222_103357251 | 3300028798 | Palsa | PAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNPIK |
| Ga0302222_103811331 | 3300028798 | Palsa | WWPEGSGAAKSLEAYEAQLLMAAGDVSRVRAAPMGRRVNVLK |
| Ga0302265_11246862 | 3300028859 | Bog | AAKQLEAYEAQLLMVAGDASRISAAPMWRRVSVLK |
| Ga0302230_101447641 | 3300028871 | Palsa | GAAKSLEAYEAQLLMAAGDVSRVRAAPMWRRVNVLK |
| Ga0302197_101365963 | 3300028873 | Bog | RFAWWPESTSAAKQLEAYEAQLLMVAGDVSRIKAAPMWRRVSALR |
| Ga0302155_100886863 | 3300028874 | Bog | WPESSSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSELK |
| Ga0302154_104149971 | 3300028882 | Bog | KGRFTCWPESGSAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSEPK |
| Ga0308309_113573312 | 3300028906 | Soil | SGAAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK |
| Ga0311368_105659241 | 3300029882 | Palsa | SDAAAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNPTK |
| Ga0311327_104356142 | 3300029883 | Bog | AAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVNELK |
| Ga0311329_109415642 | 3300029907 | Bog | WWPESASAAKQLEAYEAQLLMVAGDASRISAAPMWRRVSVLK |
| Ga0311361_106449601 | 3300029911 | Bog | SQGRFAWWPESASAAKQLEAYEAQLLMVAGDASRISAAPMWRRVSMLK |
| Ga0311326_106515952 | 3300029917 | Bog | SAAKQLEAYEAQLLMVAGDASRISAAPMWRRVSMLK |
| Ga0311371_119940502 | 3300029951 | Palsa | TWWPESSSVATQLEAYEAQLLMVAGDVSRVRAAPMWRRVNALK |
| Ga0302188_101848131 | 3300029986 | Bog | AWWPESASAVKQLEAYEAQLLMVAGDASRISAAPMWRRVSVLK |
| Ga0302276_101628121 | 3300029992 | Bog | WPESSSAAKALEAYEAQLLMVAGDVSRVRAAPMWRRVSELK |
| Ga0311344_104122241 | 3300030020 | Bog | EATSPAKALEAYEAQLLMVAGDVSRVHAAPMWRRVSVLK |
| Ga0302274_105002082 | 3300030041 | Bog | VWWPEGSEAAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVSALK |
| Ga0302196_101958652 | 3300030225 | Bog | EASSPAKRLEAYEAQLLMVAGDVSRVCAAPMWRRVS |
| Ga0311360_111926201 | 3300030339 | Bog | AANQLESYEAQLLMAAGDVSRVRAAPMWRRVNALK |
| Ga0268259_100884692 | 3300030499 | Agave | VWWPEGNGPAKPLEAYEAQLLMAAGDISRVRAAPMWRRVNTLQ |
| Ga0302275_100055301 | 3300030518 | Bog | RFTCWPESGTAAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSEPK |
| Ga0302193_106496431 | 3300030519 | Bog | STSAAKQLEAYEAQLLMVAGDVARVRAAPMWRRVSALK |
| Ga0311354_117061231 | 3300030618 | Palsa | TSAAKQLEAYEAQLLMVAGDVSRVRAAPMWRRVNELK |
| Ga0302317_102848551 | 3300030677 | Palsa | WPESDAPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNTIK |
| Ga0302313_101542752 | 3300030693 | Palsa | DAPAKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNTIK |
| Ga0302325_127068002 | 3300031234 | Palsa | ESSSAAKPLEAYEAQLLMVAGDVSRVRAAPMWRRVSMLK |
| Ga0265332_100935071 | 3300031238 | Rhizosphere | WPEATGPTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK |
| Ga0302187_102798742 | 3300031259 | Bog | ESASAAKQLEAYEAQLLMVAGDASRISAAPMWRRVSMLK |
| Ga0302140_107096531 | 3300031261 | Bog | FAWWPESSSPAKRLEAYEAQLLMVAGDVSRIRAAPMWRRVS |
| Ga0302326_110940651 | 3300031525 | Palsa | EANGPARSLEAYEAQLLMAAGDVSRVRAAPMWRRVNG |
| Ga0318534_103002612 | 3300031544 | Soil | PRGIFAGGRKPAKRLEAYEAQLLLAAGDVSRVRAAPMWRRVNGPN |
| Ga0318538_101220331 | 3300031546 | Soil | DTPAKRLEAYQAQLLLAAGDVSRVRAAPMWRRVNGPN |
| Ga0310915_109330662 | 3300031573 | Soil | SAPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLN |
| Ga0307374_102530333 | 3300031670 | Soil | WPESSSPAKALEAYEAQLLMVAGDVSRVRAAPMWRRVSDLK |
| Ga0318572_102275671 | 3300031681 | Soil | WPQAEQPAKRLESYEAQLLLAAGDVSQVRAAPMWRRVNGPK |
| Ga0307474_112305942 | 3300031718 | Hardwood Forest Soil | VWWPEATGPTKSLEAYEAQLLMAAGDLSRVRAAPMWRRVSVLK |
| Ga0306917_101762301 | 3300031719 | Soil | EATKPLEAYEAQLLMAAGDPSRVRAAPMWRRVNAPK |
| Ga0306917_112250951 | 3300031719 | Soil | ESDTPAKPLEAHEAQLLMVAGDLSRLRAAPMWRRVNALR |
| Ga0318521_103907941 | 3300031770 | Soil | WPEADQPAKKLEAYEAQLLLAAGDVSRVHAAPMWRRVDGPN |
| Ga0318548_100698543 | 3300031793 | Soil | TPAKRLEAYEAQLLLAAGDVSRVRAAPMWRRVNGPN |
| Ga0318523_102910732 | 3300031798 | Soil | SEPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK |
| Ga0306925_109299232 | 3300031890 | Soil | MVAEAAEATKPLEANEAQLLMAAGDLFRVRAAPMWRRVNALT |
| Ga0306921_107952301 | 3300031912 | Soil | PESDAPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALR |
| Ga0310912_100116131 | 3300031941 | Soil | WWPEASAPAKALEAYEVQLLMAAGDVSRVRAAPMWRRVSVLK |
| Ga0310910_100355315 | 3300031946 | Soil | WWPEAAEATKLLEAYEAQLLMAAGDLSRVRAAPMWRRVNAPK |
| Ga0306926_103519631 | 3300031954 | Soil | ASGPAKSLEAYEAQLLMAAGDISRVRAAPMWRRVNG |
| Ga0307479_110779492 | 3300031962 | Hardwood Forest Soil | WPEASEAAKRLETYEAQLLMAAGDVSRVRAAPMWRRVEAPP |
| Ga0318514_105838371 | 3300032066 | Soil | AAKALEAYEAQLLMVAGDVSRVRAAPMWRRVNAVV |
| Ga0315903_108198101 | 3300032116 | Freshwater | WPESDHAAKQLEAYEALLLFAAGDVARVRAAPMWRRVNTLK |
| Ga0311301_119015521 | 3300032160 | Peatlands Soil | AAAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK |
| Ga0335079_109001742 | 3300032783 | Soil | RFVWGPQGCDATKPLEAYEAQLLMVAGDLSRVKAAPMWRPVNTPK |
| Ga0335078_103988031 | 3300032805 | Soil | WWPEASGAAKSLESYEAQLLMAAGDVSRVRAAPMWRRVNG |
| Ga0335072_113673041 | 3300032898 | Soil | AAKPLEAYEAQLLMAAGDLSRLRAAPMWRRVNAPK |
| Ga0335077_101232854 | 3300033158 | Soil | ESSSPAKALEAYEAHLLMAAGDVSRVRAAPMWRRVNTVA |
| Ga0335077_101305004 | 3300033158 | Soil | AANEPAKPLEAYEAQLLMAAGDLSRLRAAPMWRRVTARK |
| Ga0335077_111318071 | 3300033158 | Soil | PESDAPAKPLEAYEAQLLIAAGDLSRLRVAPMWRRVNALR |
| Ga0310914_108849972 | 3300033289 | Soil | QPAKRLESYEAQLLLAAGDVSRVRAAPVWRRVNEPK |
| Ga0318519_107012812 | 3300033290 | Soil | AEPTKPLEAYEAQLLMAAGDLSRVRAAPMWRRVNAPK |
| Ga0310810_100580179 | 3300033412 | Soil | VWWPEATGTTKPLEAYEAQLLMAAGDLSKVRAAPMWRRVSVLK |
| Ga0316620_115623362 | 3300033480 | Soil | SALPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK |
| Ga0316628_1005276023 | 3300033513 | Soil | LPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK |
| Ga0316628_1010531812 | 3300033513 | Soil | VWWPEDTRATKPLEAYEAQLLMAAGDLSRVRAAPMWRRVGVLK |
| Ga0334804_069331_860_967 | 3300033818 | Soil | AAKRLEAYEAQLLMVAGDVSRVRAAPMWRRVSEVK |
| Ga0334854_093030_592_720 | 3300033829 | Soil | WWPESSSAAKRLEAYEAQLLMVAGDVSRVHAAPMWRRVSELK |
| Ga0373959_0174327_1_123 | 3300034820 | Rhizosphere Soil | PESETPAKPLEAYEAQLLMAAGDVSRVRAAPMWRRVNALK |
| ⦗Top⦘ |