| Basic Information | |
|---|---|
| Family ID | F019012 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 232 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSEFQEPISHTTTGTPRWVGLAVAVLGGISLLGLGVGWSALN |
| Number of Associated Samples | 187 |
| Number of Associated Scaffolds | 232 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.55 % |
| % of genes near scaffold ends (potentially truncated) | 93.53 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 175 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.414 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.965 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.293 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.448 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.71% β-sheet: 0.00% Coil/Unstructured: 64.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 232 Family Scaffolds |
|---|---|---|
| PF13490 | zf-HC2 | 36.64 |
| PF01435 | Peptidase_M48 | 10.34 |
| PF10431 | ClpB_D2-small | 4.74 |
| PF02687 | FtsX | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.41 % |
| Unclassified | root | N/A | 27.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0456409 | Not Available | 600 | Open in IMG/M |
| 3300000955|JGI1027J12803_100123840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101186543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300002914|JGI25617J43924_10083042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
| 3300004082|Ga0062384_100711566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300004082|Ga0062384_101174976 | Not Available | 557 | Open in IMG/M |
| 3300004092|Ga0062389_101563588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300004152|Ga0062386_101518243 | Not Available | 558 | Open in IMG/M |
| 3300005181|Ga0066678_10396912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300005332|Ga0066388_102446928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300005332|Ga0066388_107507084 | Not Available | 547 | Open in IMG/M |
| 3300005434|Ga0070709_11226651 | Not Available | 603 | Open in IMG/M |
| 3300005537|Ga0070730_10636658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300005541|Ga0070733_10921707 | Not Available | 587 | Open in IMG/M |
| 3300005542|Ga0070732_10270062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300005568|Ga0066703_10503674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300005586|Ga0066691_10731978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300005591|Ga0070761_10784777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300005598|Ga0066706_11071978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300005881|Ga0075294_1039737 | Not Available | 507 | Open in IMG/M |
| 3300006050|Ga0075028_100820813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300006059|Ga0075017_100712551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300006059|Ga0075017_101187080 | Not Available | 597 | Open in IMG/M |
| 3300006086|Ga0075019_10879296 | Not Available | 574 | Open in IMG/M |
| 3300006172|Ga0075018_10194103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300006174|Ga0075014_100237842 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300006176|Ga0070765_100897180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300006237|Ga0097621_100197506 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300006237|Ga0097621_101450469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300006354|Ga0075021_10280721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
| 3300006358|Ga0068871_100177672 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300006794|Ga0066658_10607673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300006800|Ga0066660_10892538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300006804|Ga0079221_11076858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300007076|Ga0075435_101315579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300007255|Ga0099791_10045116 | Not Available | 1965 | Open in IMG/M |
| 3300007255|Ga0099791_10545908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300009012|Ga0066710_101877873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300009038|Ga0099829_10620357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300009038|Ga0099829_10811700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300009038|Ga0099829_11675443 | Not Available | 523 | Open in IMG/M |
| 3300009088|Ga0099830_10305036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1272 | Open in IMG/M |
| 3300009088|Ga0099830_11110892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300009088|Ga0099830_11114100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300009089|Ga0099828_10898184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300009090|Ga0099827_10367815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1225 | Open in IMG/M |
| 3300009090|Ga0099827_10631047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300009090|Ga0099827_11168165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300009521|Ga0116222_1186647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300009545|Ga0105237_12765101 | Not Available | 502 | Open in IMG/M |
| 3300009551|Ga0105238_10582105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300009672|Ga0116215_1340884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300010046|Ga0126384_11484102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300010304|Ga0134088_10188749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300010336|Ga0134071_10785450 | Not Available | 508 | Open in IMG/M |
| 3300010343|Ga0074044_10641344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300010358|Ga0126370_10675499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300010359|Ga0126376_11773964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300010359|Ga0126376_12600960 | Not Available | 555 | Open in IMG/M |
| 3300010360|Ga0126372_11826164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300010360|Ga0126372_12458553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300010361|Ga0126378_11684816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300010375|Ga0105239_10743872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1122 | Open in IMG/M |
| 3300010379|Ga0136449_101204167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1192 | Open in IMG/M |
| 3300010398|Ga0126383_13567926 | Not Available | 508 | Open in IMG/M |
| 3300010400|Ga0134122_10410380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1199 | Open in IMG/M |
| 3300011120|Ga0150983_10800413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300011120|Ga0150983_15675631 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300011271|Ga0137393_11132187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300012096|Ga0137389_11087017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300012202|Ga0137363_10113160 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300012202|Ga0137363_11643189 | Not Available | 535 | Open in IMG/M |
| 3300012205|Ga0137362_10517503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300012206|Ga0137380_11364778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300012208|Ga0137376_10630060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300012349|Ga0137387_11017263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300012351|Ga0137386_10115598 | Not Available | 1906 | Open in IMG/M |
| 3300012361|Ga0137360_10723429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300012582|Ga0137358_10032978 | Not Available | 3405 | Open in IMG/M |
| 3300012582|Ga0137358_10323932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300012582|Ga0137358_10464558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300012923|Ga0137359_10665022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300012925|Ga0137419_11110333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300012925|Ga0137419_11634045 | Not Available | 548 | Open in IMG/M |
| 3300012929|Ga0137404_10316163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1358 | Open in IMG/M |
| 3300012929|Ga0137404_11625034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300012929|Ga0137404_11845196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300012930|Ga0137407_11725578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300012930|Ga0137407_12180415 | Not Available | 529 | Open in IMG/M |
| 3300012931|Ga0153915_10660126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1206 | Open in IMG/M |
| 3300012944|Ga0137410_10349905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1181 | Open in IMG/M |
| 3300012944|Ga0137410_10380267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
| 3300012971|Ga0126369_10448294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1339 | Open in IMG/M |
| 3300012971|Ga0126369_13339103 | Not Available | 526 | Open in IMG/M |
| 3300012976|Ga0134076_10166763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300012986|Ga0164304_11747591 | Not Available | 520 | Open in IMG/M |
| 3300013308|Ga0157375_10255324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1914 | Open in IMG/M |
| 3300014150|Ga0134081_10091462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300014151|Ga0181539_1036145 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
| 3300014151|Ga0181539_1052220 | Not Available | 1915 | Open in IMG/M |
| 3300014638|Ga0181536_10310916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300015264|Ga0137403_11480953 | Not Available | 529 | Open in IMG/M |
| 3300016341|Ga0182035_11208743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300016387|Ga0182040_11614570 | Not Available | 552 | Open in IMG/M |
| 3300016702|Ga0181511_1394301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1377 | Open in IMG/M |
| 3300017656|Ga0134112_10378995 | Not Available | 581 | Open in IMG/M |
| 3300017823|Ga0187818_10104102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300017926|Ga0187807_1131199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300017928|Ga0187806_1259149 | Not Available | 604 | Open in IMG/M |
| 3300017936|Ga0187821_10147275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300017944|Ga0187786_10599467 | Not Available | 517 | Open in IMG/M |
| 3300017973|Ga0187780_11090765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300017974|Ga0187777_10885795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300017975|Ga0187782_10508526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300017975|Ga0187782_10775457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300018001|Ga0187815_10313677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300018007|Ga0187805_10383636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300018034|Ga0187863_10229059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
| 3300018044|Ga0187890_10263938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300018058|Ga0187766_10937455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300018085|Ga0187772_10200637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1340 | Open in IMG/M |
| 3300018090|Ga0187770_11628656 | Not Available | 527 | Open in IMG/M |
| 3300018433|Ga0066667_10367248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1151 | Open in IMG/M |
| 3300019788|Ga0182028_1407544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3039 | Open in IMG/M |
| 3300019788|Ga0182028_1424932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1824 | Open in IMG/M |
| 3300019883|Ga0193725_1078826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300019886|Ga0193727_1124434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300019887|Ga0193729_1145930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300020199|Ga0179592_10249322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300020579|Ga0210407_10027294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4247 | Open in IMG/M |
| 3300020579|Ga0210407_10182019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1629 | Open in IMG/M |
| 3300020579|Ga0210407_10501661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300020579|Ga0210407_11203003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300020580|Ga0210403_11334829 | Not Available | 546 | Open in IMG/M |
| 3300020581|Ga0210399_10005567 | All Organisms → cellular organisms → Bacteria | 9785 | Open in IMG/M |
| 3300020581|Ga0210399_10308661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1320 | Open in IMG/M |
| 3300021046|Ga0215015_10318567 | Not Available | 616 | Open in IMG/M |
| 3300021088|Ga0210404_10454443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300021171|Ga0210405_10490473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300021178|Ga0210408_11465492 | Not Available | 512 | Open in IMG/M |
| 3300021180|Ga0210396_10444880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
| 3300021180|Ga0210396_11083245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300021401|Ga0210393_10584705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300021401|Ga0210393_10824303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300021402|Ga0210385_10144286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1698 | Open in IMG/M |
| 3300021405|Ga0210387_10283467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1455 | Open in IMG/M |
| 3300021407|Ga0210383_11426108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300021478|Ga0210402_10048843 | Not Available | 3696 | Open in IMG/M |
| 3300021478|Ga0210402_10170454 | Not Available | 1991 | Open in IMG/M |
| 3300021478|Ga0210402_10817615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300021479|Ga0210410_10032850 | Not Available | 4502 | Open in IMG/M |
| 3300021479|Ga0210410_10227119 | Not Available | 1673 | Open in IMG/M |
| 3300021559|Ga0210409_10558320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300023259|Ga0224551_1005838 | Not Available | 2055 | Open in IMG/M |
| 3300024246|Ga0247680_1045468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300024330|Ga0137417_1315240 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300024331|Ga0247668_1062449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300025473|Ga0208190_1055981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300025910|Ga0207684_11108828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300026301|Ga0209238_1118630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300026305|Ga0209688_1003953 | All Organisms → cellular organisms → Bacteria | 2621 | Open in IMG/M |
| 3300026310|Ga0209239_1031980 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
| 3300026319|Ga0209647_1268195 | Not Available | 571 | Open in IMG/M |
| 3300026319|Ga0209647_1328481 | Not Available | 516 | Open in IMG/M |
| 3300026326|Ga0209801_1311610 | Not Available | 558 | Open in IMG/M |
| 3300026328|Ga0209802_1313691 | Not Available | 518 | Open in IMG/M |
| 3300026335|Ga0209804_1010136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5131 | Open in IMG/M |
| 3300026474|Ga0247846_1044433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300026489|Ga0257160_1055211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300026530|Ga0209807_1201512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300026555|Ga0179593_1237670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2795 | Open in IMG/M |
| 3300026557|Ga0179587_10894724 | Not Available | 585 | Open in IMG/M |
| 3300027045|Ga0207726_1022329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300027109|Ga0208603_1032581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300027516|Ga0207761_1099250 | Not Available | 567 | Open in IMG/M |
| 3300027565|Ga0209219_1136009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300027645|Ga0209117_1128267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300027671|Ga0209588_1250952 | Not Available | 540 | Open in IMG/M |
| 3300027701|Ga0209447_10002673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5344 | Open in IMG/M |
| 3300027703|Ga0207862_1060249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
| 3300027767|Ga0209655_10182898 | Not Available | 691 | Open in IMG/M |
| 3300027783|Ga0209448_10268793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300027826|Ga0209060_10008870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6266 | Open in IMG/M |
| 3300027846|Ga0209180_10546704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300027884|Ga0209275_10445515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300027884|Ga0209275_10731092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300027986|Ga0209168_10021339 | Not Available | 3660 | Open in IMG/M |
| 3300028047|Ga0209526_10497108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300028145|Ga0247663_1077248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300028536|Ga0137415_10778613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300028808|Ga0302228_10329401 | Not Available | 682 | Open in IMG/M |
| 3300028906|Ga0308309_10699365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300030659|Ga0316363_10100560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1286 | Open in IMG/M |
| 3300030707|Ga0310038_10459744 | Not Available | 544 | Open in IMG/M |
| 3300030743|Ga0265461_12195888 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300031057|Ga0170834_109775821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300031057|Ga0170834_110949569 | Not Available | 564 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1081575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300031170|Ga0307498_10222088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300031231|Ga0170824_118794669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300031231|Ga0170824_125425869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300031469|Ga0170819_12909699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300031474|Ga0170818_104356966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300031720|Ga0307469_10252889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1419 | Open in IMG/M |
| 3300031753|Ga0307477_10076753 | All Organisms → cellular organisms → Bacteria | 2313 | Open in IMG/M |
| 3300031754|Ga0307475_11411462 | Not Available | 536 | Open in IMG/M |
| 3300031797|Ga0318550_10348162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300031820|Ga0307473_10304286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300031823|Ga0307478_10626293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300031833|Ga0310917_10040067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2824 | Open in IMG/M |
| 3300031962|Ga0307479_10539317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1150 | Open in IMG/M |
| 3300032059|Ga0318533_10900526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300032180|Ga0307471_100450340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1426 | Open in IMG/M |
| 3300032180|Ga0307471_102015667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300032180|Ga0307471_103426658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300032205|Ga0307472_101383459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300032782|Ga0335082_10773578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300032805|Ga0335078_12749121 | Not Available | 500 | Open in IMG/M |
| 3300033158|Ga0335077_11913561 | Not Available | 553 | Open in IMG/M |
| 3300033803|Ga0314862_0102235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300033983|Ga0371488_0520228 | Not Available | 535 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.02% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.02% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.16% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.16% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.29% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.29% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.86% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.43% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.43% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.43% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.43% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.43% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.43% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.43% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005881 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026474 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T0 | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026817 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_04564091 | 2228664022 | Soil | MSEYQEVNPTVVAATPRWVGLAVAVLAVLSLVGLGVAWSAINHSK |
| JGI1027J12803_1001238401 | 3300000955 | Soil | MSEYQDSNPTTTAGTPRWVGLALAVLGALSLLGLGVGWSATNHANSV |
| JGIcombinedJ26739_1011865432 | 3300002245 | Forest Soil | MSEYQEPVVHTAGTPRWVALAVAIVAGLSLIGLGVGWSALSHANS |
| JGI25617J43924_100830421 | 3300002914 | Grasslands Soil | MSEFNESASTSTVGAPRWVGLAVAVLGGLSLIGLGVGWSALNQ |
| Ga0062384_1007115661 | 3300004082 | Bog Forest Soil | MSEFQEPISHTTTGTPRWVGLAVAVLGGISLLGLGVGWSALN |
| Ga0062384_1011749761 | 3300004082 | Bog Forest Soil | MSEFQDTSVQSSAAVPRWVGLAVAALGGISLIGLGVGVSALNQAKS |
| Ga0062389_1015635881 | 3300004092 | Bog Forest Soil | MSEFQEPMYQTTTTSSTPRWVGLAVILLGATSLLGVGVGWTALNQAKSVGQ |
| Ga0062386_1015182431 | 3300004152 | Bog Forest Soil | MSEFQEPIHQSTTGTPRWVGLAVVVLGGISLLGLGVGWSAIN |
| Ga0066678_103969122 | 3300005181 | Soil | MSEYQETNIQSTSGTPRWVGLAVAVLGGVSLLGLGVGISALSHANSVENS |
| Ga0066388_1024469283 | 3300005332 | Tropical Forest Soil | MSDFQDPIHHTSTGTPRWVGLAVGILGGISLVSLGLGWSAINQARNAQDATQA |
| Ga0066388_1075070841 | 3300005332 | Tropical Forest Soil | MSEYQDTHIQSTTGTPRWVGLAVAVLGGVSLLGLGVGFSAL |
| Ga0070709_112266511 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSQDPILHTSAGTPRWVGLAVGVLGGVSLLGLGLGLSAINRTRGIEEST |
| Ga0070730_106366581 | 3300005537 | Surface Soil | MSEFQEPLNHTATGTPRWVGLAVAVLGGVSLLGLGVGWSALN |
| Ga0070733_103899331 | 3300005541 | Surface Soil | MSEFQDTNVQGTTATPRWVGLAIGALGVVSLLGIGIGVSALNQAKS |
| Ga0070733_109217072 | 3300005541 | Surface Soil | MSDFQEPIHHTAAETPRWVGLAVAILGGVSLVGIGLGWSAIN |
| Ga0070732_102700623 | 3300005542 | Surface Soil | MSEYQEPISHTTGTPRWIGLAVAVLGGLSLLGIGI |
| Ga0066703_105036742 | 3300005568 | Soil | MSEFQESPNMHTVGAPRWVGLAVAVLGGVSLISLGVGWSALNQARS |
| Ga0066691_107319782 | 3300005586 | Soil | MSEFQDSANVHTIGAPRWVGLAVAVLGGISLISLGVGWSAL |
| Ga0070761_107847771 | 3300005591 | Soil | MSEYQDPIDHTAATATGTPRWVGLAVAVLAGVSLLGLGVGWSALNHANN |
| Ga0066706_110719781 | 3300005598 | Soil | MSEYQETNIQSTSGTPRWVGLDVAVLGGVSLLGLGVGISAL |
| Ga0075294_10397371 | 3300005881 | Rice Paddy Soil | MSDFQEASVQQTAGTPRWIGLAVAVLAGISLLSLGVGWSASNHARS |
| Ga0075028_1008208131 | 3300006050 | Watersheds | MSDYQEPIHTSTGTPRWVGLAVGILGGVSLIGLGLGWTAIN |
| Ga0075017_1007125511 | 3300006059 | Watersheds | MSDFQDSAIAHTTGTPRWVGLAVAVLGGISLLGLGVGWSALNQA |
| Ga0075017_1011870802 | 3300006059 | Watersheds | MSEFQEPVYQSTTAGTPRWVGLAVIVLGALSLAGLGVGWSALSQAKSVGQATEASLK |
| Ga0075019_108792962 | 3300006086 | Watersheds | MSEYQETRIEAATPRWVGLAIAALGGISLIGLGLGW |
| Ga0075018_101941033 | 3300006172 | Watersheds | MSDFLDSANTNTTGTPRWVGLAVGLLGGISLLGLGVGWSALNQAKSI |
| Ga0075014_1002378423 | 3300006174 | Watersheds | MSEFQDPINHTTTGTPRWVGLAVAVLGGISLLGLGV |
| Ga0070765_1008971801 | 3300006176 | Soil | MSEFQEPVYQTTTTTPRWVGLAVAILGAVSLAGLGVGWSALNEAKSTGQT |
| Ga0097621_1001975063 | 3300006237 | Miscanthus Rhizosphere | MSEYQESIPPSTVGTPRWVGLAVVVLGALSLLGLGVGWSAVNHANSL |
| Ga0097621_1014504692 | 3300006237 | Miscanthus Rhizosphere | MSEYQEPLNHTTSGTPRWVGLAVAVLGGVSLLGLGVGWSALNHAN |
| Ga0075021_102807213 | 3300006354 | Watersheds | MSDFQDSANTTGTPRWVGLAVAVLGGISLLGLGVGWSALNQAKSI |
| Ga0068871_1001776723 | 3300006358 | Miscanthus Rhizosphere | MSEYQESIPPSTVGTPRWVGLAVVVLGALSLLGLGVGWSAVNH |
| Ga0066658_106076731 | 3300006794 | Soil | MSEFQDSANVHTIGAPRWVGLAVAVLGGISLISLGVGWSA |
| Ga0066660_108925381 | 3300006800 | Soil | MSEFQDSANVHTIGAPRWVGLAVAVLGGISLISLGVGWSALNQARN |
| Ga0079221_110768581 | 3300006804 | Agricultural Soil | MSEFQEPLHHTTSGTPRWVGLAVAVLAGVSVLGLGVGWS |
| Ga0075435_1013155791 | 3300007076 | Populus Rhizosphere | MSEYQETNFQNTSGTPRWVGLAVAVLGGVSLLGLGVGVSALSHANS |
| Ga0099791_100451164 | 3300007255 | Vadose Zone Soil | MSDFHDSTIAHATGTPRWVGLAVAVLGGISLLSLG |
| Ga0099791_105459082 | 3300007255 | Vadose Zone Soil | MSDFHDSAIAHATGTPRWVGLAVAVLGGISLLSLG |
| Ga0066710_1018778731 | 3300009012 | Grasslands Soil | MSEFNESASTSTVGAPRWVGLAVAVLGGLSLIGLGVG |
| Ga0099829_106203572 | 3300009038 | Vadose Zone Soil | MSEFQDSPSTHTVGAPRWVGLAVAVLGGISLISLGIGWSAINQ |
| Ga0099829_108117001 | 3300009038 | Vadose Zone Soil | MKYMSDFQDSAIAHTTGTPRWVGLAVAVLGGISLLSLGVGWS |
| Ga0099829_116754431 | 3300009038 | Vadose Zone Soil | MSEFQETNASGTAGTPRWVGLSVAVLGALSLLGLGVGWSAINH |
| Ga0099830_103050361 | 3300009088 | Vadose Zone Soil | MSEFLDSANTSTTGTPRWVGLAVAVLGGLSLLGLGLGWSALYQARNIE |
| Ga0099830_111108922 | 3300009088 | Vadose Zone Soil | MSDFHDSANTTGTPRWVGLAVAVLGGISLLGLGVGWSALNQAKNVEQS |
| Ga0099830_111141002 | 3300009088 | Vadose Zone Soil | MSDFQDSANTTGTHRWVGLAVAVLGGISLLGLGVGWSALNQAKNVEQS |
| Ga0099828_108981842 | 3300009089 | Vadose Zone Soil | MSMSEIQDSNLQSTAAAPRWVGLAVAALGGVSLLGLGVGWSALN |
| Ga0099827_103678152 | 3300009090 | Vadose Zone Soil | MSEFQDSAIAHTTGTPRWVGLAVAILGGISLISLGIGWSALN |
| Ga0099827_106310472 | 3300009090 | Vadose Zone Soil | MSEFQESANTTATPRWVGLAVALLGGISLLGLGVSWSALNQA |
| Ga0099827_111681651 | 3300009090 | Vadose Zone Soil | MSEIQGQFGHTAPGAPRWVGLAVVVLGGVSLIGLG |
| Ga0116222_11866472 | 3300009521 | Peatlands Soil | MKSMSEFQETNTQSTAGTPRWVGLAIPALGGLSLFGIGVA |
| Ga0105237_127651011 | 3300009545 | Corn Rhizosphere | MSEYQDSNPTTTAGTPRWVGLAVAVLGALSLLGLGVGWSAINHANSVE |
| Ga0105238_105821051 | 3300009551 | Corn Rhizosphere | MSEFQEPIHHTTAETPRWVGLAVALLGGVSLLGLGLGWSAINQTKGIQ |
| Ga0116215_13408841 | 3300009672 | Peatlands Soil | MKSMSEFQETNVQSTTGAPRWVGLAIAALSGLSLIGIGVGWSALNHAKSVEQ |
| Ga0126384_114841022 | 3300010046 | Tropical Forest Soil | MSDFQDPIHHTSAGTPRWVGLAVGILGGISLISLGLGWSAVNQAKSAE |
| Ga0134088_101887491 | 3300010304 | Grasslands Soil | MSEFQESPNMHTVGAPRWVGLAVAVLGGVSLISLGVGWSALNQARSL |
| Ga0134071_107854502 | 3300010336 | Grasslands Soil | MSEFNESASTSTVGAPRWVGLAVAVLGGLSLIGLGVGWSALNQARSV |
| Ga0074044_106413441 | 3300010343 | Bog Forest Soil | MSDFQDPINHTTTETPRWVGLAVAVLGGVSLLGLGVGWSALNHAN |
| Ga0126370_106754991 | 3300010358 | Tropical Forest Soil | MSEYQDSNPTVTTATPRWVGLAVAVLGALSLLGLGVGWSAINHANSVEQ |
| Ga0126376_117739642 | 3300010359 | Tropical Forest Soil | MSEYQESNQSATGTPRWVGLAVAALGGVSLLGLGVGFSALSHANSVE |
| Ga0126376_126009601 | 3300010359 | Tropical Forest Soil | MSDFQDPIQHTSAGTPHWVGSAVCILRGISLTCLGLGWSAVNQAK |
| Ga0126372_118261641 | 3300010360 | Tropical Forest Soil | MSEYQGSSFQSTTGTPRWVGLAVAVLGGVSLLGLGVG |
| Ga0126372_124585531 | 3300010360 | Tropical Forest Soil | MSEFQDPIHHTSTGTPRWVGLAVGILGGISLVSLGIGWSALNSAKSAEQ |
| Ga0126378_116848161 | 3300010361 | Tropical Forest Soil | MSEFQDPVVHVTDTETPRWVTLAIAVLAGVSLLGLGVAWS |
| Ga0105239_107438723 | 3300010375 | Corn Rhizosphere | MSEYQDSNPATTAGTPRWVGLAVAVLGALSLLGLG |
| Ga0136449_1012041671 | 3300010379 | Peatlands Soil | MKYMSEFLHSNDASTSGTPRWVGLAVVILGGVSLL |
| Ga0126383_135679261 | 3300010398 | Tropical Forest Soil | MSEYEESNPTSTVGTPRWVGLAVAILTVLSLVSLGVGWSAVNHANSLEQ |
| Ga0134122_104103803 | 3300010400 | Terrestrial Soil | MSEYQDSNPTITTATPRWVGLAVAVLGALSLLGLGVAWSAINHANSVEQST |
| Ga0150983_108004131 | 3300011120 | Forest Soil | MSEFNDSPIAHTTGTPRWVGLAVAVLGGISLLSLGVGWSALNQARTVEQT |
| Ga0150983_156756312 | 3300011120 | Forest Soil | EAKENKSMSEFQEPIIHTTETPRWVGLAVAVLGGVSLLGLGV* |
| Ga0137393_111321872 | 3300011271 | Vadose Zone Soil | MSEYQESNPAVVSGTPRWVGLAVAVLGALSLLGLG |
| Ga0137389_110870171 | 3300012096 | Vadose Zone Soil | MRDFNESASTSTVGAPRWVGLAVAVLGGLSLIGLGVGWSALNQA |
| Ga0137363_101131604 | 3300012202 | Vadose Zone Soil | MSEFNDSPIAHTTGTPRWVGLAVAVLGGLSLLGLGVGWS |
| Ga0137363_116431891 | 3300012202 | Vadose Zone Soil | MSDFHDSTIAHATGTPRWVGLAVAVLGGISLLSLGIGWSALNQARGIE |
| Ga0137362_105175033 | 3300012205 | Vadose Zone Soil | MSDFQDSANTTGTPRWVGLAVAVLGGISLLSLGVGWSAL |
| Ga0137380_113647781 | 3300012206 | Vadose Zone Soil | MSEFQEPTYQGQAGTPRWITLAIIVLAGVSLLGLG |
| Ga0137376_106300602 | 3300012208 | Vadose Zone Soil | MSEFQESATTATPRWVGLAVAVLGGISLLGLGVSWSALNQAKSI |
| Ga0137387_110172632 | 3300012349 | Vadose Zone Soil | MSEFNESAGTSTVGAPRWVGLAVAVLGGLSLIGLGVGWSALNQARSVEQ |
| Ga0137386_101155981 | 3300012351 | Vadose Zone Soil | MSEFNESASTSTVGAPRWVGLAVAVLGGLSLIGLGVGWSA |
| Ga0137360_107234291 | 3300012361 | Vadose Zone Soil | MSEFQESTTQAAAPRWVGLAIAALGATSLLGIGIG |
| Ga0137358_100329781 | 3300012582 | Vadose Zone Soil | MSEFQDSPNTHTSGTPRWVGLAVGLLSGISLLSLGVGWSALNQAK |
| Ga0137358_103239323 | 3300012582 | Vadose Zone Soil | MSEFLDSPNTHTSGTPRWVGLAVGLLSGISLLSLGVGWSALNQAK |
| Ga0137358_104645582 | 3300012582 | Vadose Zone Soil | MSEYQESNPTVISATPRWVGLALAVLGALSLLGLGVGWSAINHA |
| Ga0137359_106650222 | 3300012923 | Vadose Zone Soil | MSDFQDSAIAHTSGTPRWVGLAVAVLGGISLLSLGVGWSALNQA |
| Ga0137419_111103332 | 3300012925 | Vadose Zone Soil | MSEYQDTSMQSMSGTPRWVGLAVAVLGGVSLLGLGLGVSALSHAN |
| Ga0137419_116340452 | 3300012925 | Vadose Zone Soil | MSDFQDSAIAHTTGTPRWVGLAVAVLGGVSLLGLGIGWSALNQ |
| Ga0137404_103161633 | 3300012929 | Vadose Zone Soil | MSEFQDSPSTHTIGAPRWVGLAVAVLGGISLISLGIGWSALNQAR |
| Ga0137404_116250342 | 3300012929 | Vadose Zone Soil | MSDFHDSTIAHTTGTPRWVGLAVAVLGGISLLSLGIGWSALNQARG |
| Ga0137404_118451961 | 3300012929 | Vadose Zone Soil | MSDFHDSTIAHATGTPRWVGLAVAVLGGISLLSLGIGWS |
| Ga0137407_117255782 | 3300012930 | Vadose Zone Soil | MSDYQDPIHQTSTGTPRWVGLAVGILGGVSLIGLGLGWAAINQARSAE |
| Ga0137407_121804152 | 3300012930 | Vadose Zone Soil | MSDFHDSAIAHTTGTPRWVGLAVAVLGGISLLSLGIGWSA |
| Ga0153915_106601261 | 3300012931 | Freshwater Wetlands | MPKGDKAMSDFQEASVQQTAGTPRWIGLAVAALAG |
| Ga0137410_103499053 | 3300012944 | Vadose Zone Soil | MSDFHDSAIAHTTGTPRWVGLAVAVLGGISLLSLGIGWSAL |
| Ga0137410_103802673 | 3300012944 | Vadose Zone Soil | MKYMSEFQESANTTPRWVGLAVAVLGGISLLGLGVG |
| Ga0126369_104482943 | 3300012971 | Tropical Forest Soil | MSEYQDSNPTTTVGIPRWVGLAIAVLGALSLLALGVGWSAINHAN |
| Ga0126369_133391032 | 3300012971 | Tropical Forest Soil | MSEYQDSNPTIIAATPRWVGLAVAVLGALSLLALGVGWSA |
| Ga0134076_101667632 | 3300012976 | Grasslands Soil | MSEFNESVSTSTVGAPRWVGLAVAVLGGLSLIGLGVGWSALNQARSVEQT |
| Ga0164304_117475911 | 3300012986 | Soil | MSEYQEPLNHTTSGTPRWVGLAVAVLGGVSLLGLGVGWSALNHANSVEQST |
| Ga0157375_102553244 | 3300013308 | Miscanthus Rhizosphere | MSEYQDSNPATTAGTPRWVGLAVAVLGALSLLGLGVGWSAI |
| Ga0134081_100914621 | 3300014150 | Grasslands Soil | MSEFQEFSHTGTAGTPRWVGLAVGVLGGLSLIGLGL |
| Ga0181539_10361451 | 3300014151 | Bog | MKSMSEFQETNIQSTAGTPRWVGLAIAALGGLSLIGIGVGWSA |
| Ga0181539_10522202 | 3300014151 | Bog | MKSMSEFQETNIQSTAGTPRWVGLAIAALGGLSLIGIGVGWSALNHAKSVE |
| Ga0181536_103109161 | 3300014638 | Bog | MKSMSEFQETNIQSTAGTPRWVGLAIAALGGLSLIGI |
| Ga0137420_11838052 | 3300015054 | Vadose Zone Soil | MSEFQETTTQAAAPRWVGLAIAALGATSLLGIGIGWSALNQGKTTE |
| Ga0137403_114809531 | 3300015264 | Vadose Zone Soil | MSEYQETNFQNTSGTPRWVGLAVAVLGGVSLLGLGVGVSALSHANSVETST |
| Ga0182035_112087431 | 3300016341 | Soil | MSDFQDPIHHTSAGTPRWVGLAVGVLGGISLISLGLGWSAVNQAKS |
| Ga0182040_116145701 | 3300016387 | Soil | MSEYPEPNPAITTGTPRWVGLAVVLLAALSLLGLGVGWSALSHANRIAQST |
| Ga0181511_13943012 | 3300016702 | Peatland | MSEFQETNIENTAAAPRWVGLAVAALGGISLLGLGVGWSALNQAK |
| Ga0134112_103789952 | 3300017656 | Grasslands Soil | MSDYQESNPTVVAGTPRWVGLAVAVLGALSLLGLGVGWSAINHA |
| Ga0187818_101041021 | 3300017823 | Freshwater Sediment | MSEFQESSVQSTAAAPRWVGLAVAALGGISLLGLGVGWSALNQAKNDQ |
| Ga0187807_11311991 | 3300017926 | Freshwater Sediment | MSDFQETNIQSSTGTPRWVGLAIAVLGGLSLIGLGLGWSAFSQVRVAQS |
| Ga0187806_12591491 | 3300017928 | Freshwater Sediment | MSEFQDGTIQSGVGAPRWVGLAVAALGGISLIGLGIG |
| Ga0187821_101472751 | 3300017936 | Freshwater Sediment | MSEFQEPFNHTTTGTPRWVGLAIAVLGGVSLLGLGVGW |
| Ga0187786_105994671 | 3300017944 | Tropical Peatland | MSEFQENNFQSTAATPRWVGLAIAVLGGVSLIGLGFGVS |
| Ga0187780_110907652 | 3300017973 | Tropical Peatland | MSEYQEPISHTATGTPRWVGLAIAALGGISLLSLGVGWSAL |
| Ga0187777_108857953 | 3300017974 | Tropical Peatland | MSDFLDSSNTSTTGTPRWVGLAVGILGGLSLIGLGVGWSALNQ |
| Ga0187782_105085262 | 3300017975 | Tropical Peatland | MSEFQETNIASTAATPRWVGLAIAALGGISLIGLGVGVSALNQS |
| Ga0187782_107754571 | 3300017975 | Tropical Peatland | MSEFQESLNQTTTGTPRWVGLAVAALGGVSLLSLAVGWSALNH |
| Ga0187815_103136771 | 3300018001 | Freshwater Sediment | MSEFQEPNIQSSAATPRWVGLAVAALGGISLLGLGV |
| Ga0187805_103836362 | 3300018007 | Freshwater Sediment | MSEFQAPLNHTSTGTPRWVGLAVAVLGGVSLLGLGVGWSA |
| Ga0187863_102290591 | 3300018034 | Peatland | MSEFQETNIQSTAGTPRWVGLAIAALGALSLIGIAVGWSA |
| Ga0187890_102639382 | 3300018044 | Peatland | MSEFQEPVYQSTTSGTPRWIGLAVIVLAAISLAGLGLGWSALNQAKSVAQSS |
| Ga0187766_109374552 | 3300018058 | Tropical Peatland | MSEFGDPIHHTSAGAPRWVGLAVGILGGISLISLGLGW |
| Ga0187772_102006371 | 3300018085 | Tropical Peatland | MSEFQEGSVQSTGTPRWIGLAIAVLGGISLIGLGVGVSALSHSKS |
| Ga0187770_116286561 | 3300018090 | Tropical Peatland | MSEFQETNIQSSTGTPRWVGLAIAVLGGVSLIGLGLGWSALSQVRVAQSNEA |
| Ga0066667_103672483 | 3300018433 | Grasslands Soil | MHTVGAPRWVGLAVAVLGGVSLISLGVGWSALNQARSIE |
| Ga0182028_14075449 | 3300019788 | Fen | MSEFQETNIQSTATTPRWVGLAIAALGGLSLIGIE |
| Ga0182028_14249321 | 3300019788 | Fen | MSEFQETNIQSTATTPRWVGLAIAALGGLSLIGIGVGWSALNHAKS |
| Ga0193725_10788262 | 3300019883 | Soil | MSEYQESNPTVASGTPRWVGLAVAVLGALSLLGLGVGWSAINHANSVEK |
| Ga0193727_11244341 | 3300019886 | Soil | MSEYQESNPAVVSGTPRWVGLAVAVLGALSLLGLGVGWSAINHANSV |
| Ga0193729_11459301 | 3300019887 | Soil | MSDFQEPIYHTNAGTPRWVGLAVAVLGGVSLLGLGVGLSALSHANSVQQ |
| Ga0179592_102493221 | 3300020199 | Vadose Zone Soil | MSEYQESNTTVVSGTPRWVGLAVAVLGALSLLGLGVGWSAINHANSV |
| Ga0210407_100272943 | 3300020579 | Soil | MSEFQDPISHTTTGTPRWVGLAVAVLGGVSLLGLGVGWSALNHANSIE |
| Ga0210407_101820191 | 3300020579 | Soil | MSDFQDSAIAHSTGTPRWVGLAVGVLGGISLLSLGLGWS |
| Ga0210407_105016611 | 3300020579 | Soil | MSEFQDSAIAHTTGTPRWVGLAVAVLGGVSLLSLGVGWSALNQAKSIEQT |
| Ga0210407_112030032 | 3300020579 | Soil | MSEFQEPISHNTTGTPRWVGLAVAVLGGVSLLGLGV |
| Ga0210403_113348292 | 3300020580 | Soil | MSEFQDTNVTTTSTPRWVGLAIGALGAVSLLGIGIG |
| Ga0210399_1000556711 | 3300020581 | Soil | MTEFQETTTQAAAPRWVGLAIAALGATSLLGIGIGWSALNQGKQ |
| Ga0210399_103086611 | 3300020581 | Soil | MSEFQETTTQAAAPRWVGLAIAALGATSLLGIGIGWSALNQGKQ |
| Ga0215015_103185672 | 3300021046 | Soil | MSEFQESTTQAAAPRWVGLAIAALGATSLLGIGIGWSALNQGCLLY |
| Ga0210404_104544432 | 3300021088 | Soil | MSDFHDSAIAHSTGTPRWVGLAVGVLGGISLLGLGL |
| Ga0210405_104904731 | 3300021171 | Soil | MSEFQDSPIAHTTGTPRWVGLAVAVLGGLSLLGLGVSWS |
| Ga0210408_114654921 | 3300021178 | Soil | MSDFQEPIIHTTETPRWVGLAVAILGGVSLLGLGVGWAALNHANSIEQTT |
| Ga0210396_104448801 | 3300021180 | Soil | MSEFQEPISHTTTGTPRWVGLAVAVLGGVSLLGLGVGWSAL |
| Ga0210396_110832451 | 3300021180 | Soil | MSDFQEPIYHTNTGAPRWVGLAVAVLGGVSVLGLGVGLSAL |
| Ga0210393_105847052 | 3300021401 | Soil | MSEFQEPISHTSTGTPRWVGLAVAVLGGVSLLGLGVGW |
| Ga0210393_108243032 | 3300021401 | Soil | MSEFQDPISYTTTGTPRWVGLAVAVLGGVSLLGLGVGWSALNHA |
| Ga0210385_101442863 | 3300021402 | Soil | MSEFQEPISHTTTGTPRWVGLAVAVLGGVSLLGLGVGWSALNHANSIEQT |
| Ga0210387_102834673 | 3300021405 | Soil | MSDFQEPIYHTNAGAPRWVGLAVAVLGGVSVLGLGVGLSALNHANS |
| Ga0210387_115640752 | 3300021405 | Soil | MSEFQEPVYQTTTTTPRWVGLAVAILGAVSLAGLGVGW |
| Ga0210383_111321801 | 3300021407 | Soil | MSEFQEPVYSASTTSGTPRWIGLAVILLGATSLLGV |
| Ga0210383_114261082 | 3300021407 | Soil | MSEFQEPISHTATGTPRWVGLAVAVLGGVSLLGLGLGWSALNHA |
| Ga0210402_100488434 | 3300021478 | Soil | MSDFQDSANTTGTPRWVGLAVAVLGGISLLGLGVG |
| Ga0210402_101704544 | 3300021478 | Soil | MSEFQETTIQSSTATPRWVGLAIGALGAVSLLGIGIGVSALNQAK |
| Ga0210402_108176153 | 3300021478 | Soil | MSEYQEPINHSTAGTPRWIGLAVAVLGGLSLLGIGVGWS |
| Ga0210410_100328501 | 3300021479 | Soil | MSEFQETTTQAAAPRWVGLALAALGATSLLAIGIGWS |
| Ga0210410_102271191 | 3300021479 | Soil | MSEFQESAHPNAVGAPRWVGLAVAVLGGLSLLGLGVGW |
| Ga0210409_105583201 | 3300021559 | Soil | MSEFQDPISHTTTGTPRWVGLAVAVLGGVSLLGLG |
| Ga0210409_109616891 | 3300021559 | Soil | MSEFQETTTQAAAPRWVGLAIAALGATSLLGIGIGWSALNQGKQTE |
| Ga0224551_10058384 | 3300023259 | Soil | MSDFQEPIHHINAGTPRWVGLAVAALGGVSLLGLGLGWSAINRAN |
| Ga0247680_10454681 | 3300024246 | Soil | MSEYQETNIHSTSGTPRWVGLAVAVLGGVSLLGLGV |
| Ga0137417_13152402 | 3300024330 | Vadose Zone Soil | MSEYQESNPGVVPGTPRWVGLAVAVLGALSLLGLGVGWSAINHANSLEK |
| Ga0247668_10624491 | 3300024331 | Soil | MSEYQDSNPATTAGTPRWVGLAVAVLGALSLLGLGVG |
| Ga0208190_10559811 | 3300025473 | Peatland | MSEFQETNIQSTAGTPRWVGLAIAALGALSLIGIA |
| Ga0207684_111088281 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEFQEPVIQTTTGAPRWVGLAVAVLGGVSLLGLGIGGSAISHLS |
| Ga0209238_11186302 | 3300026301 | Grasslands Soil | MSEYQETNIQSTSGTPRWVGLAVAVLGGVSLLGLGV |
| Ga0209688_10039531 | 3300026305 | Soil | MSEFQESATTATPRWVGLAVAVLGGISLLGLGVSW |
| Ga0209239_10319801 | 3300026310 | Grasslands Soil | MSEFQESAYTNTTPRWVGLAVAVLGGISLLGLGVSWS |
| Ga0209647_12681952 | 3300026319 | Grasslands Soil | MSEFQESNPASTSGTPRWVGLAVVVLGALSLAGLGVGWSALNHANSAAESTQ |
| Ga0209647_13284811 | 3300026319 | Grasslands Soil | MNEYQESSSHSTSGTPRWVGLAVAVLGGVSLLGLGIGVSALSHANNVEQ |
| Ga0209801_13116101 | 3300026326 | Soil | MSEYQETNIQSTSGTPRWVGLAVAVLGGVSLLGLGVGISA |
| Ga0209802_13136911 | 3300026328 | Soil | MNDFQDSAIAHTSGTPRWVGLAVAVLGGVSLLSLGVGW |
| Ga0209804_10101362 | 3300026335 | Soil | MSEFQESPNMHTVGAPRWVGLAVAVLGGVSLISLGVGWSADQ |
| Ga0247846_10444331 | 3300026474 | Soil | MSEFQETNIQSTATTPRWVGLAIAALGGLSLIGIGVGWSALNHAKSVE |
| Ga0257160_10552112 | 3300026489 | Soil | MSEYQESNPAVASGTPRWVGLAVAVLGALSLLGLGVGWSAINH |
| Ga0209807_12015121 | 3300026530 | Soil | MSEFQESPNMHTVGAPRWVGLAVAVLGGVSLISLGVGWSALNQARSIEQS |
| Ga0179593_12376703 | 3300026555 | Vadose Zone Soil | MSDFQDSANTTGTPRWVGLAVAVLGGFSLLSLGVGWSALNQARALSNRRKPA |
| Ga0179587_108947241 | 3300026557 | Vadose Zone Soil | MSEYQESNPTVASGTARWVGLAVAVLGALSLLGLGVGWSAINHANSL |
| Ga0207775_1068781 | 3300026817 | Tropical Forest Soil | MSEFLEQNADTTVGTPRWVGLAIAVLGGVSLIGVGLGVTA |
| Ga0207726_10223291 | 3300027045 | Tropical Forest Soil | MSEFQDSNFQSNTAVPRWVGLAVAVLGGVSLIGVIL |
| Ga0208603_10325811 | 3300027109 | Forest Soil | MSEFQEPISHTTTGTPRWVGLAVAVLGGVSLLGLGVGWSALNHAN |
| Ga0207761_10992502 | 3300027516 | Tropical Forest Soil | MSEYQETRVETATATPRWVGLAIAALGGISLLGLGIG |
| Ga0209219_11360092 | 3300027565 | Forest Soil | MSEFQEPISHTTTGTPRWVGLAVAVLGGVSLLGLGLGWSA |
| Ga0209117_11282671 | 3300027645 | Forest Soil | MNEFQEPINHTTETPRWIGLAVAVLGGVSLLGLGVGFAALNHVNGI |
| Ga0209588_12509522 | 3300027671 | Vadose Zone Soil | MSDFQDSAIAHTSGTPRWVGLAVAVLGGISLLSLGIGWSAL |
| Ga0209446_11448692 | 3300027698 | Bog Forest Soil | MSEFQEPVYSTTTSSTPRWVGLAVILLGATSLLGVGV |
| Ga0209447_100026736 | 3300027701 | Bog Forest Soil | MSEFQEPIHQSTTGTPRWVGLAVVVLGGISLLGLGVGWSAINQAKSAEQ |
| Ga0207862_10602491 | 3300027703 | Tropical Forest Soil | MSEFQEDSNLQSSAGVPRWVGLAVAVLGGVSLIGVGLGWS |
| Ga0209655_101828982 | 3300027767 | Bog Forest Soil | MSEFQEPVYQTGATAGTPRWVALAVVVLAALSVVGIGVGWSALNQAKSVGQAAESSLKQSND |
| Ga0209448_102687931 | 3300027783 | Bog Forest Soil | MSDFLDSSNTSTTGTPRWVGLAVGLLGGISLLSLGVGWSALNQAKSIEQ |
| Ga0209060_100088705 | 3300027826 | Surface Soil | MSDFQEPIHHTTAETPRWVGLAVAILGGVSLVGVGLGWSA |
| Ga0209773_104970371 | 3300027829 | Bog Forest Soil | MSEFQEPVYSTTTSSTPRWVGLAVILLGATSLLGVGVGWTALNQAK |
| Ga0209180_105467041 | 3300027846 | Vadose Zone Soil | MSDFQDSAIAHTTGTPRWVGLAVAVLGGISLLSLGVGWS |
| Ga0209275_104455152 | 3300027884 | Soil | MSEFQEPIHHTTAETPRWVGLAVALLGGVSLVGIGLG |
| Ga0209275_107310921 | 3300027884 | Soil | MNEFQEPTNHTTTGTPRWVGLAVAVLGGVSLLGLALGWSALNH |
| Ga0209168_100213391 | 3300027986 | Surface Soil | MSEFQEPIHHTTAETPRWVGLAVALLGGVSLLGLGLGWSAINQT |
| Ga0209526_104971082 | 3300028047 | Forest Soil | MSDFQEPIHETVAATPRWVALAVAVLGGVSLLGLGVAYSALN |
| Ga0247663_10772482 | 3300028145 | Soil | MSEFQERLNHTTSGTPRWVGLAVAILGGVSLLGLGVGWSALNHANSV |
| Ga0137415_107786132 | 3300028536 | Vadose Zone Soil | MSEFQETANTTATPRWVGLAVGVLGGISLLGLGVSWS |
| Ga0302228_103294011 | 3300028808 | Palsa | MSEFQEPVYQTSTTTGTPRWIGLAVIVLAALSLASLGVGWSALNQARSVGQTAQNSLKQTND |
| Ga0308309_106993651 | 3300028906 | Soil | MSEFQEPVYQTTTTTPRWVGLAVAILGAVSLAGLGVGWSALNEAKSTGQTAQASLKQTNDALNQ |
| Ga0311340_104870591 | 3300029943 | Palsa | MSEFQEPNYQTTTTVGTPRWVGLAVVVLGVISILG |
| Ga0316363_101005602 | 3300030659 | Peatlands Soil | MSEFQETSIQSTAGTPRWVGLAIAALGGLSLIGIGVGWSALNHAKSVEQ |
| Ga0310038_104597441 | 3300030707 | Peatlands Soil | MSEFQETNIQSTAGTPRWVGLAIAALGALSLIGIGVGWSAL |
| Ga0265461_121958882 | 3300030743 | Soil | MSDFQEPIYHTNTGAPRWVGLSVAVLGGVSVLGLGVGLSAL |
| Ga0170834_1097758211 | 3300031057 | Forest Soil | MSEFQDSTTQAAAPRWVGLAIASLGAASLLGIGIGWSALNQGK |
| Ga0170834_1109495692 | 3300031057 | Forest Soil | MSDYQETNIQSTSATPRWVGLAIAALGGVSLLGLGLGWSALNQSK |
| (restricted) Ga0255311_10815751 | 3300031150 | Sandy Soil | MSEYNEPNVQGTSAAPRWVGLAIAALGGISLLGLGVGWSALNQ |
| Ga0307498_102220881 | 3300031170 | Soil | MSEYQESIPPSTVGTPRWVGLAVVVLGALSLLGLGVGWSA |
| Ga0170824_1187946692 | 3300031231 | Forest Soil | MSDFQEPINHTNAGAPRWVGLAVAVLGGTSLLGLGVGLSALHHADS |
| Ga0170824_1254258691 | 3300031231 | Forest Soil | MSDFQEPIHHTTAETPRWVGLAVAVLGGVSLVSLGL |
| Ga0170819_129096991 | 3300031469 | Forest Soil | MSDFQEPIHHTTAETPRWVGLAVALLGGVSLIGIGLGWSAINQTKGIQET |
| Ga0170818_1043569661 | 3300031474 | Forest Soil | MSEYQESNPAVVSGTPRWVGLAVAVLGALSLLGLGVGWSAINHANS |
| Ga0307469_102528893 | 3300031720 | Hardwood Forest Soil | MSEFQDSTTQAAAPRWVGLAIAALGATSLLGIGIGW |
| Ga0307477_100767531 | 3300031753 | Hardwood Forest Soil | MSEFQEFSQTGTTGTPRWVGLAVGILGGLSLVGLGLSWSALNQ |
| Ga0307475_114114621 | 3300031754 | Hardwood Forest Soil | MSEYQESNPTVVAGTPRWVGLAVAVLGALSLLGLGVGW |
| Ga0318547_105693752 | 3300031781 | Soil | MSEFLEPNADTTAATPRWVGLAIAVLGGVSLLGVGLGVAAWN |
| Ga0318550_103481623 | 3300031797 | Soil | MSEFLEPNADTTAATPRWVGLAIAVLGGVSLLGVGL |
| Ga0307473_103042862 | 3300031820 | Hardwood Forest Soil | MSEFQDSPSTHTVGAPRWVGLAVAVLGGISLISLGIGWSAM |
| Ga0307478_106262931 | 3300031823 | Hardwood Forest Soil | MSEYQESNPTVVSSTGTARWVGLAVAVLGALSLLGLG |
| Ga0310917_100400671 | 3300031833 | Soil | MSEYQDSNPTTAAGTPRWVGLAIAVLGALSLLGLGVGWSAINHANS |
| Ga0306923_104363031 | 3300031910 | Soil | MSEFLEPNADTTAATPRWVGLAIAVLGGVSLLGVGLGVAAW |
| Ga0307479_105393171 | 3300031962 | Hardwood Forest Soil | MSEYQESNPTVVSGTPRWVGLAVAVLGALSLLGLGIGWSAINHANSVE |
| Ga0318533_109005261 | 3300032059 | Soil | MSEYPESSPATVVGIPRWVGLAVALVGALALLGLGIGWSAMGHA |
| Ga0307471_1004503403 | 3300032180 | Hardwood Forest Soil | MSEFQETTTQAAAPRWVGLAIAALGATSLLGIGIGWSAL |
| Ga0307471_1020156673 | 3300032180 | Hardwood Forest Soil | MSEFQESAHSNTVAAPRWVGLAVVVLAGLSLLGLGVSWSA |
| Ga0307471_1034266581 | 3300032180 | Hardwood Forest Soil | MSEFQDSPSTHTVGAPRWVGLAVAVLGGISLISLGIGWSA |
| Ga0307472_1013834592 | 3300032205 | Hardwood Forest Soil | MSEFQETTTQAAAPRWVGLAIAALGATSLLGIGIGWSALNQGKQT |
| Ga0335082_107735781 | 3300032782 | Soil | MSEFQEDSNFQSNAAVPRWVGLAVAVLGGVSLIGVGLGWSALS |
| Ga0335078_127491212 | 3300032805 | Soil | MSEFQDTNVQTTAAVPRWVGLAIAALGGVSLIGLG |
| Ga0335077_119135612 | 3300033158 | Soil | MSEFLDSNNQSTTGTPRWVGLAVAVLGGVSLVGLGLGWSAF |
| Ga0314862_0102235_527_664 | 3300033803 | Peatland | MSEFQETNTQSTAGTPRWVGLAIAALGGLSLIGIGVGWSALNHAKS |
| Ga0371488_0520228_2_121 | 3300033983 | Peat Soil | MSEFQETNIQSTAGTPRWVGLAIAALGGLSLIGIGVGWSA |
| ⦗Top⦘ |