| Basic Information | |
|---|---|
| Family ID | F018954 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 232 |
| Average Sequence Length | 50 residues |
| Representative Sequence | YRNGVPVAALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG |
| Number of Associated Samples | 176 |
| Number of Associated Scaffolds | 232 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.29 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 91.81 % |
| Associated GOLD sequencing projects | 162 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.534 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (12.931 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.207 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.759 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 7.79% Coil/Unstructured: 77.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 232 Family Scaffolds |
|---|---|---|
| PF01965 | DJ-1_PfpI | 14.22 |
| PF00076 | RRM_1 | 12.50 |
| PF13091 | PLDc_2 | 4.31 |
| PF07681 | DoxX | 2.59 |
| PF05726 | Pirin_C | 2.16 |
| PF04679 | DNA_ligase_A_C | 2.16 |
| PF03807 | F420_oxidored | 1.72 |
| PF04389 | Peptidase_M28 | 1.29 |
| PF00144 | Beta-lactamase | 0.86 |
| PF03358 | FMN_red | 0.86 |
| PF04264 | YceI | 0.86 |
| PF00535 | Glycos_transf_2 | 0.86 |
| PF04542 | Sigma70_r2 | 0.86 |
| PF03625 | DUF302 | 0.43 |
| PF12867 | DinB_2 | 0.43 |
| PF12704 | MacB_PCD | 0.43 |
| PF00753 | Lactamase_B | 0.43 |
| PF07638 | Sigma70_ECF | 0.43 |
| PF14326 | DUF4384 | 0.43 |
| PF13508 | Acetyltransf_7 | 0.43 |
| PF07676 | PD40 | 0.43 |
| PF06234 | TmoB | 0.43 |
| PF12543 | DUF3738 | 0.43 |
| PF07238 | PilZ | 0.43 |
| PF04226 | Transgly_assoc | 0.43 |
| PF13620 | CarboxypepD_reg | 0.43 |
| PF12796 | Ank_2 | 0.43 |
| PF13646 | HEAT_2 | 0.43 |
| PF00903 | Glyoxalase | 0.43 |
| PF00383 | dCMP_cyt_deam_1 | 0.43 |
| PF13336 | AcetylCoA_hyd_C | 0.43 |
| PF06736 | TMEM175 | 0.43 |
| PF05635 | 23S_rRNA_IVP | 0.43 |
| PF12200 | DUF3597 | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 232 Family Scaffolds |
|---|---|---|---|
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 2.59 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 2.59 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 2.16 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 2.16 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.29 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.86 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.86 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.86 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.86 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.86 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.86 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.43 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.43 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.53 % |
| Unclassified | root | N/A | 31.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_14072657 | Not Available | 882 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0503306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300000178|FW301_c1026999 | Not Available | 701 | Open in IMG/M |
| 3300000443|F12B_11437221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300000574|JGI1357J11328_10095476 | Not Available | 948 | Open in IMG/M |
| 3300000956|JGI10216J12902_104433833 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300002070|JGI24750J21931_1054009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300004153|Ga0063455_100799951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 652 | Open in IMG/M |
| 3300004156|Ga0062589_100877481 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300004463|Ga0063356_101448813 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300004480|Ga0062592_101975695 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300004643|Ga0062591_102434926 | Not Available | 549 | Open in IMG/M |
| 3300004801|Ga0058860_11805694 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300005167|Ga0066672_10794482 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005288|Ga0065714_10369811 | Not Available | 617 | Open in IMG/M |
| 3300005294|Ga0065705_10107059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6034 | Open in IMG/M |
| 3300005328|Ga0070676_10201930 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300005330|Ga0070690_100913692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300005332|Ga0066388_108567433 | Not Available | 509 | Open in IMG/M |
| 3300005333|Ga0070677_10458565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300005334|Ga0068869_100986900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060 | 733 | Open in IMG/M |
| 3300005334|Ga0068869_101513056 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005339|Ga0070660_101346849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300005347|Ga0070668_101650048 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005354|Ga0070675_101417259 | Not Available | 641 | Open in IMG/M |
| 3300005354|Ga0070675_101770318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300005364|Ga0070673_101548554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300005365|Ga0070688_100145570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1614 | Open in IMG/M |
| 3300005440|Ga0070705_100135411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1613 | Open in IMG/M |
| 3300005456|Ga0070678_102128691 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005459|Ga0068867_101475538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060 | 633 | Open in IMG/M |
| 3300005466|Ga0070685_11542352 | Not Available | 513 | Open in IMG/M |
| 3300005536|Ga0070697_101261796 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005543|Ga0070672_100742722 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300005543|Ga0070672_101913357 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005544|Ga0070686_100877647 | Not Available | 728 | Open in IMG/M |
| 3300005544|Ga0070686_101627709 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005545|Ga0070695_100327504 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300005545|Ga0070695_100491944 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300005546|Ga0070696_101324918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300005549|Ga0070704_100231293 | Not Available | 1508 | Open in IMG/M |
| 3300005549|Ga0070704_100671597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300005549|Ga0070704_101704568 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005564|Ga0070664_101301969 | Not Available | 686 | Open in IMG/M |
| 3300005564|Ga0070664_102040901 | Not Available | 544 | Open in IMG/M |
| 3300005577|Ga0068857_101217569 | Not Available | 729 | Open in IMG/M |
| 3300005615|Ga0070702_101509284 | Not Available | 553 | Open in IMG/M |
| 3300005615|Ga0070702_101660439 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005617|Ga0068859_100378499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1511 | Open in IMG/M |
| 3300005618|Ga0068864_102572926 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005718|Ga0068866_10919215 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005840|Ga0068870_11008448 | Not Available | 594 | Open in IMG/M |
| 3300005843|Ga0068860_101262657 | Not Available | 759 | Open in IMG/M |
| 3300005844|Ga0068862_101248629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 743 | Open in IMG/M |
| 3300005985|Ga0081539_10078185 | Not Available | 1747 | Open in IMG/M |
| 3300006196|Ga0075422_10041952 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
| 3300006755|Ga0079222_10955494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300006844|Ga0075428_100078586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3601 | Open in IMG/M |
| 3300006844|Ga0075428_100241149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1950 | Open in IMG/M |
| 3300006844|Ga0075428_100252834 | Not Available | 1899 | Open in IMG/M |
| 3300006846|Ga0075430_100040121 | All Organisms → cellular organisms → Bacteria | 3963 | Open in IMG/M |
| 3300006852|Ga0075433_11604230 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006852|Ga0075433_11656745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300006853|Ga0075420_100635563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300006854|Ga0075425_102059152 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300006854|Ga0075425_102404468 | Not Available | 584 | Open in IMG/M |
| 3300006871|Ga0075434_100084614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3170 | Open in IMG/M |
| 3300006880|Ga0075429_100268928 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300006880|Ga0075429_101032192 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300006894|Ga0079215_10309341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 878 | Open in IMG/M |
| 3300006904|Ga0075424_101220839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300006969|Ga0075419_10033984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3171 | Open in IMG/M |
| 3300006969|Ga0075419_10663013 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300007004|Ga0079218_10809564 | Not Available | 902 | Open in IMG/M |
| 3300007004|Ga0079218_11351057 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300007004|Ga0079218_12887323 | Not Available | 577 | Open in IMG/M |
| 3300007076|Ga0075435_100304326 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300009094|Ga0111539_12123122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300009100|Ga0075418_11707598 | Not Available | 684 | Open in IMG/M |
| 3300009100|Ga0075418_12573974 | Not Available | 555 | Open in IMG/M |
| 3300009147|Ga0114129_10284338 | Not Available | 2209 | Open in IMG/M |
| 3300009147|Ga0114129_12545206 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300009162|Ga0075423_10069450 | All Organisms → cellular organisms → Bacteria | 3655 | Open in IMG/M |
| 3300009162|Ga0075423_10963837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
| 3300009177|Ga0105248_12766756 | Not Available | 560 | Open in IMG/M |
| 3300009678|Ga0105252_10426080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300010042|Ga0126314_11236869 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010043|Ga0126380_10479943 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300010047|Ga0126382_11750633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300010337|Ga0134062_10358299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300010366|Ga0126379_12156616 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300010373|Ga0134128_12350635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300010375|Ga0105239_12021044 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300010397|Ga0134124_13021092 | Not Available | 514 | Open in IMG/M |
| 3300010399|Ga0134127_11704305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060 | 705 | Open in IMG/M |
| 3300010400|Ga0134122_12254371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300010401|Ga0134121_12344129 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010403|Ga0134123_13214775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300011119|Ga0105246_11332644 | Not Available | 667 | Open in IMG/M |
| 3300011415|Ga0137325_1117847 | Not Available | 606 | Open in IMG/M |
| 3300011431|Ga0137438_1066500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1079 | Open in IMG/M |
| 3300011443|Ga0137457_1131280 | Not Available | 820 | Open in IMG/M |
| 3300011445|Ga0137427_10229668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 775 | Open in IMG/M |
| 3300012469|Ga0150984_109833567 | Not Available | 853 | Open in IMG/M |
| 3300012469|Ga0150984_110238228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | 2001 | Open in IMG/M |
| 3300012469|Ga0150984_111041166 | Not Available | 998 | Open in IMG/M |
| 3300012898|Ga0157293_10327234 | Not Available | 516 | Open in IMG/M |
| 3300012899|Ga0157299_10047865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300012914|Ga0157297_10392671 | Not Available | 553 | Open in IMG/M |
| 3300012925|Ga0137419_11902002 | Not Available | 511 | Open in IMG/M |
| 3300012944|Ga0137410_10461787 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300012948|Ga0126375_11520813 | Not Available | 573 | Open in IMG/M |
| 3300013297|Ga0157378_10707130 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300013297|Ga0157378_11266149 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300013306|Ga0163162_11967168 | Not Available | 670 | Open in IMG/M |
| 3300013306|Ga0163162_12139501 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300013307|Ga0157372_10983137 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300013308|Ga0157375_10449044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1455 | Open in IMG/M |
| 3300013308|Ga0157375_12602650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300014157|Ga0134078_10550889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300014325|Ga0163163_12281885 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300014326|Ga0157380_10041606 | All Organisms → cellular organisms → Bacteria | 3587 | Open in IMG/M |
| 3300014326|Ga0157380_10075042 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
| 3300014326|Ga0157380_11621556 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300014326|Ga0157380_12027605 | Not Available | 637 | Open in IMG/M |
| 3300014326|Ga0157380_13372771 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300014745|Ga0157377_10063769 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300014745|Ga0157377_10659588 | Not Available | 754 | Open in IMG/M |
| 3300014745|Ga0157377_11312257 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300015077|Ga0173483_10561488 | Not Available | 620 | Open in IMG/M |
| 3300015200|Ga0173480_10948320 | Not Available | 562 | Open in IMG/M |
| 3300015201|Ga0173478_10065971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1236 | Open in IMG/M |
| 3300015245|Ga0137409_10346402 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300015371|Ga0132258_12977330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
| 3300015371|Ga0132258_13428115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
| 3300015372|Ga0132256_100329059 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300015372|Ga0132256_101367388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060 | 820 | Open in IMG/M |
| 3300015373|Ga0132257_100762147 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300015373|Ga0132257_103317148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300015374|Ga0132255_100310283 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300015374|Ga0132255_100964394 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300015374|Ga0132255_102770236 | Not Available | 750 | Open in IMG/M |
| 3300018067|Ga0184611_1102312 | Not Available | 996 | Open in IMG/M |
| 3300018083|Ga0184628_10155571 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300018083|Ga0184628_10501900 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300018089|Ga0187774_11179474 | Not Available | 547 | Open in IMG/M |
| 3300018422|Ga0190265_11522257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300018429|Ga0190272_11952306 | Not Available | 619 | Open in IMG/M |
| 3300018476|Ga0190274_10763441 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300018476|Ga0190274_13405693 | Not Available | 536 | Open in IMG/M |
| 3300019356|Ga0173481_10122164 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300019362|Ga0173479_10338831 | Not Available | 701 | Open in IMG/M |
| 3300020084|Ga0194110_10434785 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300020221|Ga0194127_10845430 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021082|Ga0210380_10388546 | Not Available | 638 | Open in IMG/M |
| 3300022880|Ga0247792_1144524 | Not Available | 512 | Open in IMG/M |
| 3300022910|Ga0247768_1231401 | Not Available | 557 | Open in IMG/M |
| 3300023071|Ga0247752_1039874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300023102|Ga0247754_1069311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060 | 832 | Open in IMG/M |
| 3300025310|Ga0209172_10125499 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300025315|Ga0207697_10457302 | Not Available | 566 | Open in IMG/M |
| 3300025903|Ga0207680_10011316 | All Organisms → cellular organisms → Bacteria | 4504 | Open in IMG/M |
| 3300025903|Ga0207680_11156204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300025907|Ga0207645_11084919 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300025920|Ga0207649_11484593 | Not Available | 537 | Open in IMG/M |
| 3300025923|Ga0207681_10436226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1063 | Open in IMG/M |
| 3300025923|Ga0207681_10625006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 892 | Open in IMG/M |
| 3300025926|Ga0207659_10228776 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300025926|Ga0207659_11556591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300025930|Ga0207701_10606894 | Not Available | 931 | Open in IMG/M |
| 3300025932|Ga0207690_11716065 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300025934|Ga0207686_11660979 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300025940|Ga0207691_11144707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300025942|Ga0207689_11119494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060 | 663 | Open in IMG/M |
| 3300025945|Ga0207679_10160416 | Not Available | 1841 | Open in IMG/M |
| 3300025945|Ga0207679_11158449 | Not Available | 709 | Open in IMG/M |
| 3300025960|Ga0207651_11963655 | Not Available | 526 | Open in IMG/M |
| 3300025961|Ga0207712_11147963 | Not Available | 692 | Open in IMG/M |
| 3300025972|Ga0207668_11330282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060 | 647 | Open in IMG/M |
| 3300025981|Ga0207640_10819987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300026089|Ga0207648_11570969 | Not Available | 618 | Open in IMG/M |
| 3300026116|Ga0207674_10224821 | Not Available | 1825 | Open in IMG/M |
| 3300026118|Ga0207675_102582527 | Not Available | 518 | Open in IMG/M |
| 3300026121|Ga0207683_10552936 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300026121|Ga0207683_11390951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300026285|Ga0209438_1151058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300027876|Ga0209974_10074778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
| 3300027882|Ga0209590_10715011 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027886|Ga0209486_10594794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 701 | Open in IMG/M |
| 3300028381|Ga0268264_10006355 | All Organisms → cellular organisms → Bacteria | 9958 | Open in IMG/M |
| 3300028608|Ga0247819_10613565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300028812|Ga0247825_10656769 | Not Available | 753 | Open in IMG/M |
| 3300028812|Ga0247825_10782982 | Not Available | 688 | Open in IMG/M |
| 3300028812|Ga0247825_11045284 | Not Available | 594 | Open in IMG/M |
| 3300028889|Ga0247827_10692593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300031538|Ga0310888_10164225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300031538|Ga0310888_10645825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300031547|Ga0310887_10500859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300031562|Ga0310886_10072282 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300031562|Ga0310886_11004281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300031716|Ga0310813_10885167 | Not Available | 808 | Open in IMG/M |
| 3300031731|Ga0307405_11511497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300031731|Ga0307405_12119506 | Not Available | 505 | Open in IMG/M |
| 3300031854|Ga0310904_11031882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300031854|Ga0310904_11185735 | Not Available | 550 | Open in IMG/M |
| 3300031858|Ga0310892_10150815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1348 | Open in IMG/M |
| 3300031858|Ga0310892_10319091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300031901|Ga0307406_10838684 | Not Available | 778 | Open in IMG/M |
| 3300031901|Ga0307406_11348417 | Not Available | 624 | Open in IMG/M |
| 3300031908|Ga0310900_11236074 | Not Available | 622 | Open in IMG/M |
| 3300031938|Ga0308175_101571799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300031939|Ga0308174_10826700 | Not Available | 779 | Open in IMG/M |
| 3300031940|Ga0310901_10023982 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300031940|Ga0310901_10515441 | Not Available | 538 | Open in IMG/M |
| 3300031943|Ga0310885_10201452 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300031943|Ga0310885_10710443 | Not Available | 565 | Open in IMG/M |
| 3300031944|Ga0310884_10156101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1182 | Open in IMG/M |
| 3300032002|Ga0307416_100448406 | Not Available | 1342 | Open in IMG/M |
| 3300032012|Ga0310902_10581042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060 | 741 | Open in IMG/M |
| 3300032013|Ga0310906_10016977 | All Organisms → cellular organisms → Bacteria | 2996 | Open in IMG/M |
| 3300032017|Ga0310899_10550097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300032075|Ga0310890_10036375 | All Organisms → cellular organisms → Bacteria | 2705 | Open in IMG/M |
| 3300032126|Ga0307415_100024227 | All Organisms → cellular organisms → Bacteria | 3785 | Open in IMG/M |
| 3300032157|Ga0315912_11672584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060 | 500 | Open in IMG/M |
| 3300032179|Ga0310889_10679342 | Not Available | 536 | Open in IMG/M |
| 3300032180|Ga0307471_100025970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4411 | Open in IMG/M |
| 3300032180|Ga0307471_100125748 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
| 3300032180|Ga0307471_104007388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300032211|Ga0310896_10037638 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
| 3300033551|Ga0247830_10304600 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300033551|Ga0247830_10527663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → unclassified Jiangella → Jiangella sp. DSM 45060 | 930 | Open in IMG/M |
| 3300034150|Ga0364933_020532 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.02% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.02% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.59% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.59% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.16% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.16% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.29% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.29% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.43% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.43% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.43% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.43% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.43% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.43% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.43% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.43% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.43% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000178 | Pristine groundwater from Oak Ridge Integrated Field Research Center, Tennessee (resequenced) | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300022910 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6 | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0374.00005020 | 2162886012 | Miscanthus Rhizosphere | IVYLRGVPVSAMEGDMLRVLAPVDAAMAPLVAAAAAGRRVPVLSGYVGRI |
| ICChiseqgaiiDRAFT_05033061 | 3300000033 | Soil | RIRAAASSRLVYRNGVPVMAMEGDMLRTLADVGPDVLADAAAIAAGRRVPVSHGYVGRLST* |
| FW301_10269992 | 3300000178 | Groundwater | LRMLDEVDPAIASDVAAAAAGRRVPVLSGYVGRIG* |
| F12B_114372212 | 3300000443 | Soil | ERDMLRTFAEVDPAIAADVAAAAAGRSVPVFSGYVGRTS* |
| JGI1357J11328_100954764 | 3300000574 | Groundwater | RVLSQVDPEVAAAAAAAAAGRRVPVVSGYVGRIG* |
| JGI10216J12902_1044338332 | 3300000956 | Soil | IAALEGDMLRTLAVVDAEIAEHAAAAAAGRRVPVVSGWVGRV* |
| JGI24750J21931_10540091 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | NGIPLAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS* |
| Ga0063455_1007999512 | 3300004153 | Soil | GDRIRSSTGTRIVYRNGVVLAAMEGDMLRMLAPLAPDDATRVAAAAAGRRVPVISGYVGRVGR* |
| Ga0062589_1008774811 | 3300004156 | Soil | AMEGDMLRTFGDLEPELAADAAAAAAGRRVPVISGFVGRL* |
| Ga0063356_1014488131 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RDGVPLAAMEGDVARELTAIDPAIAGDVARALRRRRVPALLR* |
| Ga0062592_1019756952 | 3300004480 | Soil | GTRIVYRNGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR* |
| Ga0062591_1024349261 | 3300004643 | Soil | VMAMEGDMLRTLADVDAPILADAAALAAGRRVPVSNGYVGRIWP* |
| Ga0058860_118056944 | 3300004801 | Host-Associated | ANRIVYRNGVPVAAMEGDLLRTFGDLEPELAADAAAAAAGRRVPVISGFVGR* |
| Ga0066672_107944821 | 3300005167 | Soil | RVVYRNGVAVAAMEGDMLRTFGDLDPEIAADAAAAAAGRRVPVVSGYVGRL* |
| Ga0065714_103698111 | 3300005288 | Miscanthus Rhizosphere | VPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG* |
| Ga0065705_101070591 | 3300005294 | Switchgrass Rhizosphere | LGDRIRAAASSRIVYRNGVPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP* |
| Ga0070676_102019303 | 3300005328 | Miscanthus Rhizosphere | NRIVYRNGVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG* |
| Ga0070690_1009136922 | 3300005330 | Switchgrass Rhizosphere | GDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP* |
| Ga0066388_1085674332 | 3300005332 | Tropical Forest Soil | LEGDMLRTLGEIDPSIAADVAAAAAGRRVPVVNGYVGRLGT* |
| Ga0070677_104585651 | 3300005333 | Miscanthus Rhizosphere | TGIVTLGDRIRAAASSRVVYRNGIPIMAMEGDMLRPLADVDATVLADAAALAAGRRVPVSNGYVGRIWP* |
| Ga0068869_1009869002 | 3300005334 | Miscanthus Rhizosphere | ALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLGSW* |
| Ga0068869_1015130561 | 3300005334 | Miscanthus Rhizosphere | ERIRASAANRIVYRSGVPVAAMEGDMLRTFGDLEPELAADAAAAAAGRRVPVISGFVGRL |
| Ga0070660_1013468491 | 3300005339 | Corn Rhizosphere | YRNGVPLAALEGDMLRTFGEIEPSIAADVAAAAAGRPVPVLSGFVGRLG* |
| Ga0070668_1016500482 | 3300005347 | Switchgrass Rhizosphere | VVLAAMEGDMLRMLAPLEGEDAANVGAAAAGRRVPVISGYVGRFGR* |
| Ga0070675_1014172592 | 3300005354 | Miscanthus Rhizosphere | VLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR* |
| Ga0070675_1017703181 | 3300005354 | Miscanthus Rhizosphere | YLRGVPVSAMEGDMLRVLADVDPAIAPTVAAAAAGRRVPVLSGYVGRI* |
| Ga0070673_1015485541 | 3300005364 | Switchgrass Rhizosphere | GEERIRASAANRIVYRNGVPVAAMEGDLLRTFGDLEPDLAADAAAAAAGRRVPVISGYVGRL* |
| Ga0070688_1001455705 | 3300005365 | Switchgrass Rhizosphere | GEERIRASAANRIVYRNGMPVAAMEGDMLRTFGDLEPDLAADAAAAAAGRRVPVISGFVGRL* |
| Ga0070705_1001354115 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | IRASAANRIVYRNGMPVAAMEGDMLRTFGDLEPDLAADAAAAAAGRRVPVISGFVGRL* |
| Ga0070678_1021286912 | 3300005456 | Miscanthus Rhizosphere | GILTNGERIRTSVSARVVYRNGTAVAAMEGDMLRMLQPLDPIDAAAAAGAAAGRRVPVVNGYVGRVR* |
| Ga0068867_1014755381 | 3300005459 | Miscanthus Rhizosphere | YRNGVPVAALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG* |
| Ga0070685_115423521 | 3300005466 | Switchgrass Rhizosphere | GIPVMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP* |
| Ga0070697_1012617963 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | IRASASTRLVYRNGVPVAAMEGDMLRTFGNLDREIASEAAAAAAGRRVPVISGFVGRI* |
| Ga0070672_1007427222 | 3300005543 | Miscanthus Rhizosphere | SAGNRIRASVGTRLVYRNGVVLAAMEGDMLRMLAPLEGEDAASVAAAAAGRRVPVIRGYVGRFGR* |
| Ga0070672_1019133571 | 3300005543 | Miscanthus Rhizosphere | SATNRVVYRNGLPVAAMEGDLLRTFAELDPDLAADAAAAAAGRRVPVIRGFVGRM* |
| Ga0070686_1008776471 | 3300005544 | Switchgrass Rhizosphere | VVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR* |
| Ga0070686_1016277091 | 3300005544 | Switchgrass Rhizosphere | VAAMEGDMLRTFGDLEPDLAADAAAAAAGRRVPVISGFVGRL* |
| Ga0070695_1003275045 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TGIITGDERIRASASTRLVYRNGTAVAAMEGDMLRTFGDLAPEIAADAAAAAAGRRVPVIAGYVGRL* |
| Ga0070695_1004919444 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GEERIRASASTRLVYRNGVPVAAMEGDMLRTFGNLDREIASEAAAAAAGRRVPVISGFVGRI* |
| Ga0070696_1013249182 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | YRDGVPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP* |
| Ga0070704_1002312931 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RLRTVASNRIVYLRGVPVSAMEGDMLRVLAPVDAAMAPLVAAAAAGRRVPVLSGYVGRI* |
| Ga0070704_1006715972 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AGNRIVYRNGVPLAALEGDMLRTFGEIEPSIAADVAAAAAGRPVPVLSGFVGRLG* |
| Ga0070704_1017045683 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AAMEGDMLRTFCDLDAETAADAAAAAAGRRVPVISGFVGRL* |
| Ga0070664_1013019691 | 3300005564 | Corn Rhizosphere | TLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLGSW* |
| Ga0070664_1020409012 | 3300005564 | Corn Rhizosphere | EGDMLRCLSPVDGAIAERAAAAAAGRRVPVLSGYVGRR* |
| Ga0068857_1012175692 | 3300005577 | Corn Rhizosphere | VSAMEGDMLRVLAPVDAAMAPLIAAAAAGRRVPVLSGYVGRI* |
| Ga0070702_1015092842 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GIPVMAMEGDMLRTLADVDAPILADAAALAAGRRVPVSNGYVGRIWP* |
| Ga0070702_1016604391 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | NGIPVAAMEGDMLRTFCDLDAETAADAAAAAAGRRVPVISGFVGRL* |
| Ga0068859_1003784992 | 3300005617 | Switchgrass Rhizosphere | SRIVYRNGVPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP* |
| Ga0068864_1025729262 | 3300005618 | Switchgrass Rhizosphere | SSGDRIRVATATRIVYKNGVPVAAMEGDMLRMFAAFDGVTAAAVAAAAAGRRVPVTSGYVGRVSR* |
| Ga0068866_109192151 | 3300005718 | Miscanthus Rhizosphere | AAGNRIVYRNGVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG* |
| Ga0068870_110084482 | 3300005840 | Miscanthus Rhizosphere | IVFHRGVAVCALEGDMLRTLSPVDDSIAADVAAAAAGRRVPVLSGWVGRI* |
| Ga0068860_1012626572 | 3300005843 | Switchgrass Rhizosphere | GDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG* |
| Ga0068862_1012486292 | 3300005844 | Switchgrass Rhizosphere | GDRIRAAASSRVVYRNGIPVMAMEGDMLRTLADVDAPILADAAALAAGRRVPVSNGYVGRIWP* |
| Ga0081539_100781851 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VYRNGVPLAAMEGDMLRTLGEIDPAIALDVAAAAAGRRVPVVSGYVGRLG* |
| Ga0075422_100419524 | 3300006196 | Populus Rhizosphere | GIPLAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS* |
| Ga0079222_109554942 | 3300006755 | Agricultural Soil | RIVYRNGIPLMAMEGDMLRTLADADASVLADAATLAARRRVPVVHGYVGRIWP* |
| Ga0075428_1000785865 | 3300006844 | Populus Rhizosphere | MEGDMLRTINAVDRGIAADVAALAAGRRVPVLSGYVGRLL* |
| Ga0075428_1002411494 | 3300006844 | Populus Rhizosphere | TRIVYRNGVPVAAMEGDLLRTFGTLDAETAADAAAAAAGRRVPVVSGFVGRV* |
| Ga0075428_1002528341 | 3300006844 | Populus Rhizosphere | IITPGDRIRTAAASRVVYLRGVPVSAMEGDMLRILAPVDPELAPVVAAAAAGRRVPVLSGYVGRKG* |
| Ga0075430_1000401211 | 3300006846 | Populus Rhizosphere | RNGVPLAALEGDMLRTLGDIDPSIAADVAAAAAGRRVPVVNGYVGRLAT* |
| Ga0075433_116042301 | 3300006852 | Populus Rhizosphere | IVYRNGIPVAAMEGDMLRTFCDLDAETAADAAAAAAGRRVPVISGFVGRL* |
| Ga0075433_116567451 | 3300006852 | Populus Rhizosphere | IVYRNGVPLAALEGDMLRTLGDIDPSIAADVAAAAAGRRVPVVSGYVGRLG* |
| Ga0075420_1006355632 | 3300006853 | Populus Rhizosphere | RIVYRNGIPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP* |
| Ga0075425_1020591523 | 3300006854 | Populus Rhizosphere | RASASTRLVYRNGVPVAAMEGDMLRTFGNLDRDVASEAAAAAAGRRVPVISGFVGRI* |
| Ga0075425_1024044683 | 3300006854 | Populus Rhizosphere | NRIVYLRGVPVSAMEGDMLRVLAPVDAAMAPLVAAAAAGRRVPVLSGYVGRI* |
| Ga0075434_1000846147 | 3300006871 | Populus Rhizosphere | ERIRASASTRLVYRNGVPVAAMEGDMLRTFGNLDRDIASEAAAAAAGRRVPVISGFVGRI |
| Ga0075429_1002689284 | 3300006880 | Populus Rhizosphere | AAMEGDLLRTFGDLEPELAAEAAAAAAGRRVPVISGFVGRL* |
| Ga0075429_1010321922 | 3300006880 | Populus Rhizosphere | ASGNRVVYRNGVPVAAMEGDMLRTLAELEPAIAVEAAAAAAGRRVPVLSGYVGRLG* |
| Ga0079215_103093412 | 3300006894 | Agricultural Soil | YLHGVPVSAMEGDMLRVLAPVEAARAAAVAEAAAGRRVPVVSGYVGRK* |
| Ga0075424_1012208391 | 3300006904 | Populus Rhizosphere | MEGDLLRTFGNLDADAAAAAAGRRVPVISGFVGRLY* |
| Ga0075419_100339841 | 3300006969 | Populus Rhizosphere | AMEGDVLRRLAEVDPAVAAEAAAAAAGRRVPAFSGYVGRLG* |
| Ga0075419_106630131 | 3300006969 | Populus Rhizosphere | RASAANRIVYRNGVPVAAMEGDLLRTFGDLEPELAAEAAAAAAGRRVPVISGFVGRL* |
| Ga0079218_108095642 | 3300007004 | Agricultural Soil | YRNGIPIAAMEGDMLRTLSDMAPSVAAEAAAAAAGRRVPVVTGYVGRVSS* |
| Ga0079218_113510572 | 3300007004 | Agricultural Soil | DRIRTATSNRIVYLRGVPVSAMEGDMLRVLAPVDASVAAAVAEAAAGRRVPVMSGYVGRLSG* |
| Ga0079218_128873232 | 3300007004 | Agricultural Soil | YLRGVPVSAMEGDMLRVLAPVDASVATAVAEAAAGRRVPVLSGYVGRLSG* |
| Ga0075435_1003043264 | 3300007076 | Populus Rhizosphere | RIVYRNGIPVATMEGDMLRTFGDLDAETAADAAAAAAGRRVPVISGFVGRL* |
| Ga0111539_121231221 | 3300009094 | Populus Rhizosphere | DMLRLLAAVDAGLAPDVAAAAAGRRVPVVTGFVGRLRN* |
| Ga0075418_117075982 | 3300009100 | Populus Rhizosphere | VVYRNGVPVAAMEGDMLRTLAELEPEVAAEAAAAAAGRRVPVLSGYVGRLG* |
| Ga0075418_125739742 | 3300009100 | Populus Rhizosphere | AMEGDMLRTINAVDRGIAADVAALAAGRRVPVVSGYVGRIR* |
| Ga0114129_102843381 | 3300009147 | Populus Rhizosphere | DLLRTFGDLEPELAADAAAAAAGRRVPVISGFVGRL* |
| Ga0114129_125452063 | 3300009147 | Populus Rhizosphere | AMEGDMLRTFGDLEPDLAADAAAAAAGRRVPVISGFVGRL* |
| Ga0075423_100694501 | 3300009162 | Populus Rhizosphere | DMLRTFGDLNPALAADAAAAAAGRRVPVISGFVGRV* |
| Ga0075423_109638371 | 3300009162 | Populus Rhizosphere | MECDMLRQLRDLDAETAAEAAAAAAGRRVPVVSGYVGRLAT* |
| Ga0105248_127667562 | 3300009177 | Switchgrass Rhizosphere | YRNGVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG* |
| Ga0105252_104260801 | 3300009678 | Soil | TLADIDPDVAGDAAALAAGRRVPVSSGYVGRLHT* |
| Ga0126314_112368691 | 3300010042 | Serpentine Soil | NLTGIITDGDRIRTSTSSRIVYRNGVALAAMEGDMLRMLAAALEPGDAANVAAAAAGRRVPVVSGYVGRVR* |
| Ga0126380_104799431 | 3300010043 | Tropical Forest Soil | IRASAANRIVYRNGVPVAAMEGDLLRTFGDLEPELAADAAAAAAGRRVPVISGFVGRL* |
| Ga0126382_117506332 | 3300010047 | Tropical Forest Soil | PLAALEGDMLRTLGDIDPAIAADVAAAAAGRRVPVLSGYVGRLG* |
| Ga0134062_103582991 | 3300010337 | Grasslands Soil | VMVAAMEGDMLRTFGDLDAEAAADAAASAAGCRVPVISGFVGRL* |
| Ga0126379_121566161 | 3300010366 | Tropical Forest Soil | RNGVPVAAMEGDLLRTFAELEPELAADAAAAAAGRRVPVISGFVGRLQPS* |
| Ga0134128_123506352 | 3300010373 | Terrestrial Soil | GVPLAALEGDMLRTLGEIEPSIAADVAAAAAGRRVPVLSGYVGRSG* |
| Ga0105239_120210441 | 3300010375 | Corn Rhizosphere | SAANRIVYRNGMPVAAMEGDMLRTFGDLEPDLAADAAAAAAGRRVPVISGFVGRL* |
| Ga0134124_130210922 | 3300010397 | Terrestrial Soil | VPLAAMEGDMLRMLTTVDPAIAADVAAAAAGRRVPVLSGYVGRIQ* |
| Ga0134127_117043051 | 3300010399 | Terrestrial Soil | NRIVYRNGVPVAALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLGSW* |
| Ga0134122_122543711 | 3300010400 | Terrestrial Soil | TGDARVRASAANRVVYRNGLPVAAMEGDLLRTFAELDPDLAADAAAAAAGRRVPVLSGFVGRL* |
| Ga0134121_123441291 | 3300010401 | Terrestrial Soil | MEGDMLRMLGELDPATAADAAAAAAGRRVPVVSGYVGRV* |
| Ga0134123_132147751 | 3300010403 | Terrestrial Soil | RVASGNRVVYRNGVPVAAMEGDMLRTLAELEPAIAVEAAAAAAGRRVPVLSGYVGRLG* |
| Ga0105246_113326441 | 3300011119 | Miscanthus Rhizosphere | IVDRNGVPLAAMEGDMLRMLTTVDPAIASDVAAAAAGRRVPVLSGYVGRLS* |
| Ga0137325_11178471 | 3300011415 | Soil | AAGNRIVYRNGVPLAALEGDMLRTLGDIDPTIAADVAAAAAGRRVPVLSGFVGRLG* |
| Ga0137438_10665005 | 3300011431 | Soil | EGDILRTFGDLDPEVAADAAAAAAGRRVPVVTGYVGRL* |
| Ga0137457_11312801 | 3300011443 | Soil | ISAADPLNLTGVLSDERVRVSTASRIVYRNGVALAAMEGDMLRTMGVVDPAIASEVAAAAAGRRVPVVRGYVGRIG* |
| Ga0137427_102296682 | 3300011445 | Soil | GNRIVYRNGVPLAAMEGDMLRTLSELEPAVAAEAAAAAAGRRVPVLSGYVGRLG* |
| Ga0150984_1098335672 | 3300012469 | Avena Fatua Rhizosphere | AAMEGDNLRMLGALDAETAADAAAVAAGRRVPVVSGYVGRR* |
| Ga0150984_1102382281 | 3300012469 | Avena Fatua Rhizosphere | HLIFTGVATTGDRIRTSSGTRIVYRNGVAVTAMEGDMLRMLAPLQGDEAARAAAAATGRRVPVVSGYVGRFGR* |
| Ga0150984_1110411662 | 3300012469 | Avena Fatua Rhizosphere | RSSAATRIVYRNGIVLAAMEGDMLRMLVPLESADAARVATAVAGRRVPVVSGYVGRVNR* |
| Ga0157293_103272342 | 3300012898 | Soil | IVTVGVRLRTVASNRIVYLRGVPVSAMEGDMLRVLAPVDAAMAPLIAAAAAGRRVPVLSGYVGRI* |
| Ga0157299_100478652 | 3300012899 | Soil | MEGDMLRTLADVDAPILADAAALAAGRRVPVSNGYVGSIWP* |
| Ga0157297_103926712 | 3300012914 | Soil | GDRLRTVASNRIVYLRGVPVSAMEGDMLRVLAPVDAAMGPLIAAAAAGRRVPVLSGYVGRI* |
| Ga0137419_119020022 | 3300012925 | Vadose Zone Soil | SASARIVYRNGVPVAAMEGDMLRAFGDLDAHAAADAAAAAAGRRVPVVSGFVGRL* |
| Ga0137410_104617874 | 3300012944 | Vadose Zone Soil | VPVAAMEGDMLRRFGNLDAESAAEAAAAAAGRRVPVVSGFVGRL* |
| Ga0126375_115208131 | 3300012948 | Tropical Forest Soil | LRTLAAIDPALAADAAAAAAGRRVPVVSGFVGRI* |
| Ga0157378_107071304 | 3300013297 | Miscanthus Rhizosphere | AANRIVYRNGVPVAAMEGDLLRTFGDLEPELAADAAAAAAGRRVPVISGFVGRL* |
| Ga0157378_112661492 | 3300013297 | Miscanthus Rhizosphere | LEGETLRMLAEVDPAIAPDVAAAAAGRRVPVLSGFVGRVS* |
| Ga0163162_119671681 | 3300013306 | Switchgrass Rhizosphere | RIRTSSGTRLVYRNGVVLAAMEGDMLRMLAPLEGEDAASVAAAAAGRRVPVIRGYVGRFGR* |
| Ga0163162_121395012 | 3300013306 | Switchgrass Rhizosphere | SDRIRSAASTRIVYRNGVVVAAMEGDMLRMLAPLEGEDAAHVAAAAAGRRVPVVSGYVGRSAR* |
| Ga0157372_109831371 | 3300013307 | Corn Rhizosphere | TSTGTRIVYRNGVVLAAMVGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR* |
| Ga0157375_104490443 | 3300013308 | Miscanthus Rhizosphere | AALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS* |
| Ga0157375_126026501 | 3300013308 | Miscanthus Rhizosphere | GDMLRMLTDIDPAIAADVAAAAAGRRVPVLKGFVGRMR* |
| Ga0134078_105508893 | 3300014157 | Grasslands Soil | RNGVAVAAMEGDMLRTFGNLDPGVAADAAAAAAGRRVPVVAGYVGRL* |
| Ga0163163_122818851 | 3300014325 | Switchgrass Rhizosphere | GVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR* |
| Ga0157380_100416061 | 3300014326 | Switchgrass Rhizosphere | NGIPLAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSVYVGRTS* |
| Ga0157380_100750425 | 3300014326 | Switchgrass Rhizosphere | ATGNRVVYRNGVPVAAMEGDMLRTLAELEPATALEAAAAAAGRRVPVLSGYVGRLG* |
| Ga0157380_116215561 | 3300014326 | Switchgrass Rhizosphere | AANRIVYRNGVPVAAMEGDLLRTFGNLEPELAADAAAAAAGRRVPVISGFVGR* |
| Ga0157380_120276051 | 3300014326 | Switchgrass Rhizosphere | DMLRVLADVDPAIAPTVAAAAAGRRVPVLSGYVGRI* |
| Ga0157380_133727713 | 3300014326 | Switchgrass Rhizosphere | VAAMEGDMLRTFGDHEPELAADAAAAAAGRRVPVISGFVGRL* |
| Ga0157377_100637691 | 3300014745 | Miscanthus Rhizosphere | PLAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS* |
| Ga0157377_106595882 | 3300014745 | Miscanthus Rhizosphere | VGTRLVYRNGVVLAAMEGDMLRMLAPLEGEDAASVAAAAAGRRVPVIRGYVGRFGR* |
| Ga0157377_113122573 | 3300014745 | Miscanthus Rhizosphere | RVRASGANRVVYRNGVPVAAMEGDLLRTFAELEPELAADAAAAAAGRRVPVISGFVGRL* |
| Ga0173483_105614882 | 3300015077 | Soil | ILSTGERIRTSTGTRIVYRNGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR* |
| Ga0173480_109483201 | 3300015200 | Soil | STGERIRTSTGTRIVYRNGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR* |
| Ga0173478_100659713 | 3300015201 | Soil | DLLRSFGDLEPELAADAAAAAAGRRVPVISGFVGRL* |
| Ga0137409_103464021 | 3300015245 | Vadose Zone Soil | ASTRVVYRNGVPVAAMEGDMLRRFGNLDAESAAEAAAAAAGRRVPVVSGFVGRL* |
| Ga0132258_129773301 | 3300015371 | Arabidopsis Rhizosphere | GDMLRTLADVDAAVLADAAAIAAGRRVPVSQGYVGRIWP* |
| Ga0132258_134281151 | 3300015371 | Arabidopsis Rhizosphere | ALEGDMLQTFGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG* |
| Ga0132256_1003290593 | 3300015372 | Arabidopsis Rhizosphere | PLAALEGDMLRTLGEIDPAIAADVAAAAAGRRVPVLSGYVGRLGT* |
| Ga0132256_1013673881 | 3300015372 | Arabidopsis Rhizosphere | PVAALEGDMLRTFGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG* |
| Ga0132257_1007621473 | 3300015373 | Arabidopsis Rhizosphere | VYRNGVVLAAMEGDMLRMLAPLEGEDAASVAAAAAGRRVPVIRGYVGRFGR* |
| Ga0132257_1033171481 | 3300015373 | Arabidopsis Rhizosphere | MLRTLGEIDPAIAADVAAAAAGRRVPVLSGYVGRLGT* |
| Ga0132255_1003102831 | 3300015374 | Arabidopsis Rhizosphere | SSSSRLVYRNGVPVAVMEGDMLRTLVELEPSIASDVAAAAAGRRVPVINGYVGRVS* |
| Ga0132255_1009643943 | 3300015374 | Arabidopsis Rhizosphere | AALEGDMLRTFGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG* |
| Ga0132255_1027702362 | 3300015374 | Arabidopsis Rhizosphere | VYLRGVPVSAMEGDMLRVLAPVDPSIAPIVAAAAAGRRVPVFSGYVGRI* |
| Ga0184611_11023123 | 3300018067 | Groundwater Sediment | VAALEGDMLRTFGEIDPTIAAEVAATAAGRRVPVLSGFVGRLG |
| Ga0184628_101555713 | 3300018083 | Groundwater Sediment | MNHHLTGIKVAALEGDMLRTFGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG |
| Ga0184628_105019002 | 3300018083 | Groundwater Sediment | YRNGVALAAMEGDMLRVLAPLEPGDAANVAAAAAGRRVPVVSGYVGRVR |
| Ga0187774_111794741 | 3300018089 | Tropical Peatland | RNGAPVAAMEGDMLRLLGEVDPAVASDAAAAAAGRRVPVVSGYVGRL |
| Ga0190265_115222571 | 3300018422 | Soil | ANRVVYRNGVPVAAMEGDMLKMLNPVAPEQAADVAAAAAGRRVPVLSGYVGQVRS |
| Ga0190272_119523061 | 3300018429 | Soil | TPCAAMEGDMLRMLATVDASIAADVAAAAAGRRVPVLSGYVGRL |
| Ga0190274_107634412 | 3300018476 | Soil | GIAVAALEGDMLRTLAPVDGEIAEAAAAAAAGRRVPVISGWVGRA |
| Ga0190274_134056931 | 3300018476 | Soil | AMEGDLLRTIGDVDPAIAADVAAAAAGRRVKVLSGFVGAIR |
| Ga0173481_101221643 | 3300019356 | Soil | AALEGDMLRTLTPVDGEIAEAAAAAAAGRRVPVLSGWVGRA |
| Ga0173479_103388311 | 3300019362 | Soil | MEGDMLRVLAPVDAAMAPLIAAAAAGRRVPVLSGYVGRI |
| Ga0194110_104347851 | 3300020084 | Freshwater Lake | EGDMLETLAAVEPEVAIEAAAAAAGRKVPVISGYVGRVN |
| Ga0194127_108454302 | 3300020221 | Freshwater Lake | IPIAAMEGDMLETLAAVEPEVAIEAAAAAAGRKVPVISGYVGRVN |
| Ga0210380_103885461 | 3300021082 | Groundwater Sediment | AAMEGDMLRMLAPLEPGDAAHVAAAAAGRRVPVVNGYVGRVR |
| Ga0247792_11445242 | 3300022880 | Soil | GERIRTSTGARIVYRNGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR |
| Ga0247768_12314011 | 3300022910 | Plant Litter | GILSTGERIRTSTGTRIVYRNGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR |
| Ga0247752_10398742 | 3300023071 | Soil | ATGNRIVYRNGIPVAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS |
| Ga0247754_10693111 | 3300023102 | Soil | NGVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG |
| Ga0209172_101254991 | 3300025310 | Hot Spring Sediment | NGVPLAALEGDMLRTLGDVDPAIAADVAAAAAGRRVPVLTGYVGRLG |
| Ga0207697_104573021 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VYRNGTAVAAMEGDMLRMLQPLDPIDAAAAAGAAAGRRVPVVNGYVGRVR |
| Ga0207680_100113161 | 3300025903 | Switchgrass Rhizosphere | RPLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLGSW |
| Ga0207680_111562041 | 3300025903 | Switchgrass Rhizosphere | HLRASASTRIIYRNGIPVAAMEGDMLRTFGDLDAETAADAAAAAAGRRVPVVRGFVGRL |
| Ga0207645_110849193 | 3300025907 | Miscanthus Rhizosphere | EGDLLRTFGNLEPELAADAAAAAAGRRVPVISGFVGR |
| Ga0207649_114845931 | 3300025920 | Corn Rhizosphere | EGDMLRVLAPVDAAMAPLVAAAAAGRRVPVLSGYVGRI |
| Ga0207681_104362261 | 3300025923 | Switchgrass Rhizosphere | GNRIVYRNGVPVAALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLGSW |
| Ga0207681_106250061 | 3300025923 | Switchgrass Rhizosphere | TGIVTLGDRIRAAASSRIVYRNGMAIMAMEGDMLRTLADADAIVLADAAAIAAGRRVPVSHGYVGRIWP |
| Ga0207659_102287765 | 3300025926 | Miscanthus Rhizosphere | YRSGVPVAAMEGDMLRTFGDLEPELAADAAAAAAGRRVPVISGFVGRL |
| Ga0207659_115565911 | 3300025926 | Miscanthus Rhizosphere | VYRNGIPVAAMEGDMLRLLAAVDAGLAPDVAAAAAGRRVPVVTGFVGRLRN |
| Ga0207701_106068941 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GDRIRTSVSARVVYRNGTAVAAMEGDMLRMLQPLDPIDAAAAAGAAAGRRVPVVNGYVGRVR |
| Ga0207690_117160651 | 3300025932 | Corn Rhizosphere | EGDLLRTFGDLEPDLAADAAAAAAGRRVPVISGYVGRLE |
| Ga0207686_116609791 | 3300025934 | Miscanthus Rhizosphere | RASAANRIVYRNGVPVAAMEGDLLRTFGDLEPELAADAAAAAAGRRVPVVSGFVGRM |
| Ga0207691_111447072 | 3300025940 | Miscanthus Rhizosphere | MAFMEGDMLRMPAALEPEDAARVAAAAAGRRVPVVSGYVGRISR |
| Ga0207689_111194942 | 3300025942 | Miscanthus Rhizosphere | IVYRNGVPVAALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLGSW |
| Ga0207679_101604161 | 3300025945 | Corn Rhizosphere | RIRASAANRIVYRSGVPVAAMEGDMLRTFGDLEPELAADAAAAAAGRRVPVIRGFVGRL |
| Ga0207679_111584492 | 3300025945 | Corn Rhizosphere | VPVAALEGDMLRTFGEIDPTIAAEVAATAAGRRVPVLSGFVGRLGSW |
| Ga0207651_119636551 | 3300025960 | Switchgrass Rhizosphere | VPVSAMEGDMLRVLAPVDAAMAPVVAAAAAGRRVPVLSGYVGRI |
| Ga0207712_111479631 | 3300025961 | Switchgrass Rhizosphere | GDMLRMLTTVDPAIAADVAAAAAGRRVPVLSGYVGRIQ |
| Ga0207668_113302821 | 3300025972 | Switchgrass Rhizosphere | TAAGNRIVYRNGVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG |
| Ga0207640_108199871 | 3300025981 | Corn Rhizosphere | IVYRNGIPLAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS |
| Ga0207648_115709691 | 3300026089 | Miscanthus Rhizosphere | VLSAGNRIRASVGTRLVYRNGVVLAAMEGDMLRMLAPLEGEDAASVAAAAAGRRVPVIRGYVGRFGR |
| Ga0207674_102248213 | 3300026116 | Corn Rhizosphere | ASNRIVYLRGVPVSAMEGDMLRVLAPVDAAMAPLIAAAAAGRRVPVLSGYVGRI |
| Ga0207675_1025825272 | 3300026118 | Switchgrass Rhizosphere | AAMEGDMLRTLNEVDPSTALEVAAAAAGRRVPVVSGYVGRVRT |
| Ga0207683_105529363 | 3300026121 | Miscanthus Rhizosphere | IPLAALEGDMLRTFGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG |
| Ga0207683_113909512 | 3300026121 | Miscanthus Rhizosphere | TAASSRIVYRKGIAIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP |
| Ga0209438_11510583 | 3300026285 | Grasslands Soil | IVYRNGVPVAAMEGDMLRTFGVQDRELAAEAAAAAAGRRVPVIAGYVGRL |
| Ga0209974_100747782 | 3300027876 | Arabidopsis Thaliana Rhizosphere | IRAAASSRIVYRNGVPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP |
| Ga0209590_107150111 | 3300027882 | Vadose Zone Soil | PVAAMEGDMLRTYGTLDRETAADAAAAAAGRRVPVISGFVGRI |
| Ga0209486_105947941 | 3300027886 | Agricultural Soil | TANRVVYRNGVPVAAMEGDMLRTLADLEPSVASEAAAAAAGRRVPVLSGYVGRIG |
| Ga0268264_1000635514 | 3300028381 | Switchgrass Rhizosphere | VAAMEGDLLRTFGNLEPELAADAAAAAAGRRVPVISGFVGRL |
| Ga0247819_106135652 | 3300028608 | Soil | TGIVTLGDRIRAAASSRIVYRNGIPVMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP |
| Ga0247825_106567691 | 3300028812 | Soil | RNGVPVAAKEGDMLRSLSEVDPDVAADAAAAAAGRRVPVVRGFVGRLG |
| Ga0247825_107829823 | 3300028812 | Soil | EGDMLRTLAPVDGEVAEAAASAAAGRRVPVLSGWVGRA |
| Ga0247825_110452841 | 3300028812 | Soil | RNGVPIAAMEGDMLRSLSEVDAGTAADAAAAAAGRRVPVVRGFVGRRG |
| Ga0247827_106925932 | 3300028889 | Soil | VMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP |
| Ga0310888_101642252 | 3300031538 | Soil | AAASSRLVYRNGVPVMAMEGDMLRTLADVGPDVLADAAAIAAGRRVPVSHGYVGRLST |
| Ga0310888_106458251 | 3300031538 | Soil | NGVPIMAMEGDMLRTLADADVTVLADAAAIAAGRRVPVSHGYVGRIWP |
| Ga0310887_105008591 | 3300031547 | Soil | RTLADVGPDVLADAAAIAAGRRVPVSHGYVGRLST |
| Ga0310886_100722821 | 3300031562 | Soil | LRGVPVSAMEGDMLRVLANVDPAIAPAVAAAAAGRRVPVLSGYVGRL |
| Ga0310886_110042811 | 3300031562 | Soil | AALEGDMLRTFGEIEPSIAADVAAAAAGRPVPVLSGFVGRLG |
| Ga0310813_108851673 | 3300031716 | Soil | GTRIVYRNGVVLAAMEGDMLRMLAPLEGEDAAQVAAVAAGRRVPVISGYVGRFGR |
| Ga0307405_115114971 | 3300031731 | Rhizosphere | LAAMEGDMLKMLGDVDASIAQQVASAAAGRHAPALSGYIGRLR |
| Ga0307405_121195061 | 3300031731 | Rhizosphere | IVYRNGIPVMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP |
| Ga0310904_110318821 | 3300031854 | Soil | RVVYRNGIPIMAMEGDMLRPLADVDATVLADAAALAAGRRVPVSNGYVGRIWP |
| Ga0310904_111857351 | 3300031854 | Soil | DVLKRLAEVDPAVAAEAAAAAAGRRVPVFSGYVGRLG |
| Ga0310892_101508151 | 3300031858 | Soil | GIVTLGDRIRAAASSRIVYRNGVPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP |
| Ga0310892_103190912 | 3300031858 | Soil | RAAASSRIVYRNGIPVMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP |
| Ga0307406_108386842 | 3300031901 | Rhizosphere | IRVATGNRIVYRNGVPVAAMEGDMLRTLADLEPSVAAEAAAAAAGRRVPVLSGYVGRMSS |
| Ga0307406_113484171 | 3300031901 | Rhizosphere | VAGNRIVYRNGIPIAAMEGDMLRTLSDMAPSVAAEAAAAAAGRRVPVVTGYVGRVSS |
| Ga0310900_112360741 | 3300031908 | Soil | ANRVVYLRGVPVSAMEGDMLRILVPVDPELAPVVAAAAAGRRVPVLSGYVGRKG |
| Ga0308175_1015717992 | 3300031938 | Soil | EGDIIRVLAPVAPALAADVAAAAAGRRVPVLSGYVGRA |
| Ga0308174_108267002 | 3300031939 | Soil | RIRSSAATRIVYRNGVALAAMEGDMLRMMATLDPIDAAEVAAAAAGRRVPVVSGYVGRIS |
| Ga0310901_100239821 | 3300031940 | Soil | YRNGIPLAALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS |
| Ga0310901_105154412 | 3300031940 | Soil | VPVAALEGDMLRTFGEIDPTIAAEVAATAAGRRVPVLSGFVGRLG |
| Ga0310885_102014521 | 3300031943 | Soil | DMLRVLANVDPAIAPAVAAAAAGRRVPVLSGYVGRL |
| Ga0310885_107104431 | 3300031943 | Soil | YRNGIPIMAMEGDMLRPLADVDVTVLADAAALAAGRRVPVSNGYVGRIWP |
| Ga0310884_101561012 | 3300031944 | Soil | TGIVTLGDRIRAAASSRIVYRNGVPIMAMEGDMLRTLADADATVLADAAAIAAGRRVPVSHGYVGRIWP |
| Ga0307416_1004484062 | 3300032002 | Rhizosphere | MEGDFLRTLGHVEPDIAADVAAAAAGRRVPVVSGYVGRLKA |
| Ga0310902_105810421 | 3300032012 | Soil | AAGNRIVYRNGIPVAALEGDMLRTLGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG |
| Ga0310906_100169774 | 3300032013 | Soil | LGDRIRAAASSRIVYRNGIPIMAMEGDMLRTLADADAAVLADAAAIAAGRRVPVSHGYVGRIWP |
| Ga0310899_105500972 | 3300032017 | Soil | LAALEGDMLRTFGEIEPSIAADVAAAAAGRPVPVLSGFVGRLG |
| Ga0310890_100363751 | 3300032075 | Soil | IVYRNGVPVAALEGDMLRTFGEIDSSIAADVAAAAAGRRVPVLSGFVGRLG |
| Ga0307415_1000242275 | 3300032126 | Rhizosphere | DRLRTVAANRIVYLRGVPVSAMEGDMLRVLAPVDAALAAQVAEAAAGRRVPVVSGYVGRM |
| Ga0315912_116725841 | 3300032157 | Soil | PLAALEGDMLRTFGEIDPSIAADVAAAAAGRRVPVLSGFVGRLG |
| Ga0310889_106793422 | 3300032179 | Soil | GIPVMAMEGDMLRTLADVDAPILADAAALAAGRRVPVSNGYVGRIWP |
| Ga0307471_1000259701 | 3300032180 | Hardwood Forest Soil | AAMEGDMLRAFGPLDRQVAAEAAAAAAGRRVPVISGFVGRI |
| Ga0307471_1001257481 | 3300032180 | Hardwood Forest Soil | DMLRTFGTLDREVASEAAAAAAGRRVPVISGVVGRI |
| Ga0307471_1040073881 | 3300032180 | Hardwood Forest Soil | ITGDERIRAAASTRIVYRNGVPVAAMEGDMLRTFGTLDREVASEAAAAAAGRRVPVISGFVGRI |
| Ga0310896_100376384 | 3300032211 | Soil | AALEGDMLRTFAEVDPAIAADVAAAAAGRRVPVFSGYVGRTS |
| Ga0247830_103046002 | 3300033551 | Soil | PVSAMEGDMLRVLANVDPAIAPAVAAAAAGRRVPVLSGYVGRL |
| Ga0247830_105276632 | 3300033551 | Soil | AGNRIVYRNGVPVAALEGDMLRTFGEIDPTIAAEVAAAAAGRRVPVLSGFVGRLG |
| Ga0364933_020532_1_210 | 3300034150 | Sediment | TGIITPGDRLRSVAANRIVYLRGVPVSAMEGDMLRVLAPVDPALGPAVAAAAAGRRVPVVSGYVGRLSR |
| ⦗Top⦘ |