| Basic Information | |
|---|---|
| Family ID | F018923 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 232 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MRRFTLITIVVLFGLIIGAAVYQIALANRDQAPFPGPVEGTPFPSVAPSP |
| Number of Associated Samples | 177 |
| Number of Associated Scaffolds | 232 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.44 % |
| % of genes near scaffold ends (potentially truncated) | 17.24 % |
| % of genes from short scaffolds (< 2000 bps) | 77.16 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.155 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.241 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.569 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (29.741 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 232 Family Scaffolds |
|---|---|---|
| PF01261 | AP_endonuc_2 | 32.33 |
| PF12146 | Hydrolase_4 | 12.07 |
| PF08213 | COX24_C | 6.47 |
| PF12695 | Abhydrolase_5 | 5.17 |
| PF14224 | DUF4331 | 3.45 |
| PF05580 | Peptidase_S55 | 2.16 |
| PF16575 | CLP1_P | 1.72 |
| PF00561 | Abhydrolase_1 | 1.72 |
| PF00756 | Esterase | 1.29 |
| PF00106 | adh_short | 0.43 |
| PF04545 | Sigma70_r4 | 0.43 |
| PF07819 | PGAP1 | 0.43 |
| PF00850 | Hist_deacetyl | 0.43 |
| PF15698 | Phosphatase | 0.43 |
| PF12838 | Fer4_7 | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 232 Family Scaffolds |
|---|---|---|---|
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.86 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.43 |
| COG1075 | Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold | Lipid transport and metabolism [I] | 0.43 |
| COG2267 | Lysophospholipase, alpha-beta hydrolase superfamily | Lipid transport and metabolism [I] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.16 % |
| Unclassified | root | N/A | 22.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig101128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
| 2199352025|deepsgr__Contig_68897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1822 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105864773 | All Organisms → cellular organisms → Bacteria | 3805 | Open in IMG/M |
| 3300000443|F12B_10123208 | Not Available | 602 | Open in IMG/M |
| 3300000550|F24TB_11134984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1338 | Open in IMG/M |
| 3300000559|F14TC_102122750 | Not Available | 590 | Open in IMG/M |
| 3300000858|JGI10213J12805_10408802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1010 | Open in IMG/M |
| 3300000956|JGI10216J12902_107145520 | Not Available | 574 | Open in IMG/M |
| 3300001978|JGI24747J21853_1008800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
| 3300002123|C687J26634_10005458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5303 | Open in IMG/M |
| 3300002155|JGI24033J26618_1018485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
| 3300003267|soilL1_10079744 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
| 3300003995|Ga0055438_10184761 | Not Available | 629 | Open in IMG/M |
| 3300004022|Ga0055432_10195352 | Not Available | 580 | Open in IMG/M |
| 3300004114|Ga0062593_100067299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2345 | Open in IMG/M |
| 3300004480|Ga0062592_100225211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1349 | Open in IMG/M |
| 3300004643|Ga0062591_100995261 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300004643|Ga0062591_101102517 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005045|Ga0071328_125851 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
| 3300005093|Ga0062594_100771528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 883 | Open in IMG/M |
| 3300005105|Ga0066812_1019183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300005204|Ga0068997_10007195 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300005294|Ga0065705_10040399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1433 | Open in IMG/M |
| 3300005331|Ga0070670_100896982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
| 3300005332|Ga0066388_104908237 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005356|Ga0070674_101953441 | Not Available | 534 | Open in IMG/M |
| 3300005441|Ga0070700_101712612 | Not Available | 540 | Open in IMG/M |
| 3300005444|Ga0070694_100308405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1215 | Open in IMG/M |
| 3300005457|Ga0070662_101005109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300005713|Ga0066905_100199386 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300005713|Ga0066905_100296664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
| 3300005713|Ga0066905_101285038 | Not Available | 658 | Open in IMG/M |
| 3300005713|Ga0066905_102155866 | Not Available | 519 | Open in IMG/M |
| 3300005764|Ga0066903_106032857 | Not Available | 635 | Open in IMG/M |
| 3300005841|Ga0068863_100533655 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300005937|Ga0081455_10002154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 23493 | Open in IMG/M |
| 3300005937|Ga0081455_10012730 | All Organisms → cellular organisms → Bacteria | 8369 | Open in IMG/M |
| 3300005937|Ga0081455_10033032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4654 | Open in IMG/M |
| 3300005937|Ga0081455_10100491 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
| 3300006049|Ga0075417_10012559 | All Organisms → cellular organisms → Bacteria | 3193 | Open in IMG/M |
| 3300006049|Ga0075417_10099317 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300006572|Ga0074051_10002789 | Not Available | 526 | Open in IMG/M |
| 3300006576|Ga0074047_11949342 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300006577|Ga0074050_11697711 | Not Available | 558 | Open in IMG/M |
| 3300006580|Ga0074049_12621485 | Not Available | 658 | Open in IMG/M |
| 3300006581|Ga0074048_10010751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2404 | Open in IMG/M |
| 3300006844|Ga0075428_100024820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6631 | Open in IMG/M |
| 3300006844|Ga0075428_100033556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5666 | Open in IMG/M |
| 3300006844|Ga0075428_100336933 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300006844|Ga0075428_102265163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300006847|Ga0075431_101044579 | Not Available | 783 | Open in IMG/M |
| 3300006865|Ga0073934_10116091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1991 | Open in IMG/M |
| 3300007790|Ga0105679_10852710 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300009011|Ga0105251_10177537 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300009081|Ga0105098_10008418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3766 | Open in IMG/M |
| 3300009081|Ga0105098_10411041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300009094|Ga0111539_12945081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300009100|Ga0075418_11565524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300009146|Ga0105091_10288044 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300009146|Ga0105091_10721168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300009147|Ga0114129_10317541 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
| 3300009156|Ga0111538_10036425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6360 | Open in IMG/M |
| 3300009156|Ga0111538_13934289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300009157|Ga0105092_10144326 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300009168|Ga0105104_10021785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3732 | Open in IMG/M |
| 3300009174|Ga0105241_10919834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
| 3300009801|Ga0105056_1027484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300009811|Ga0105084_1023602 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300009811|Ga0105084_1086316 | Not Available | 582 | Open in IMG/M |
| 3300009816|Ga0105076_1000753 | All Organisms → cellular organisms → Bacteria | 3907 | Open in IMG/M |
| 3300009817|Ga0105062_1008097 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300009818|Ga0105072_1006172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2039 | Open in IMG/M |
| 3300009819|Ga0105087_1100822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300009823|Ga0105078_1011251 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300009840|Ga0126313_10354232 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300009840|Ga0126313_11073999 | Not Available | 661 | Open in IMG/M |
| 3300009840|Ga0126313_11509152 | Not Available | 558 | Open in IMG/M |
| 3300010041|Ga0126312_10009409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6557 | Open in IMG/M |
| 3300010166|Ga0126306_10117842 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
| 3300010362|Ga0126377_10025381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4934 | Open in IMG/M |
| 3300010375|Ga0105239_11709968 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300011119|Ga0105246_11146365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300011412|Ga0137424_1001691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2094 | Open in IMG/M |
| 3300011444|Ga0137463_1242762 | Not Available | 672 | Open in IMG/M |
| 3300011445|Ga0137427_10099232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1175 | Open in IMG/M |
| 3300012022|Ga0120191_10096064 | Not Available | 604 | Open in IMG/M |
| 3300012041|Ga0137430_1223915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300012142|Ga0137343_1023139 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300012159|Ga0137344_1100204 | Not Available | 536 | Open in IMG/M |
| 3300012204|Ga0137374_10155246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2037 | Open in IMG/M |
| 3300012204|Ga0137374_10332734 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300012353|Ga0137367_10080420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2410 | Open in IMG/M |
| 3300012355|Ga0137369_10467830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
| 3300012532|Ga0137373_10693038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
| 3300014259|Ga0075311_1146177 | Not Available | 538 | Open in IMG/M |
| 3300014320|Ga0075342_1015718 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300014321|Ga0075353_1168072 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300014745|Ga0157377_10279891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
| 3300015372|Ga0132256_101410330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300015374|Ga0132255_102930779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300017965|Ga0190266_10435098 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300017997|Ga0184610_1076307 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300018028|Ga0184608_10439051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300018031|Ga0184634_10113452 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300018052|Ga0184638_1237734 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300018053|Ga0184626_10023624 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300018053|Ga0184626_10179833 | Not Available | 898 | Open in IMG/M |
| 3300018056|Ga0184623_10098836 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300018056|Ga0184623_10147543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1087 | Open in IMG/M |
| 3300018056|Ga0184623_10434782 | Not Available | 571 | Open in IMG/M |
| 3300018056|Ga0184623_10502757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300018063|Ga0184637_10461935 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300018063|Ga0184637_10647673 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300018067|Ga0184611_1272035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300018074|Ga0184640_10129355 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300018074|Ga0184640_10384228 | Not Available | 634 | Open in IMG/M |
| 3300018075|Ga0184632_10220922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 832 | Open in IMG/M |
| 3300018075|Ga0184632_10437857 | Not Available | 544 | Open in IMG/M |
| 3300018076|Ga0184609_10305533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
| 3300018076|Ga0184609_10446722 | Not Available | 595 | Open in IMG/M |
| 3300018077|Ga0184633_10279283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 854 | Open in IMG/M |
| 3300018078|Ga0184612_10140239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1265 | Open in IMG/M |
| 3300018078|Ga0184612_10208790 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300018078|Ga0184612_10343803 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300018078|Ga0184612_10500537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300018078|Ga0184612_10593691 | Not Available | 526 | Open in IMG/M |
| 3300018081|Ga0184625_10403647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
| 3300018082|Ga0184639_10186694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1100 | Open in IMG/M |
| 3300018083|Ga0184628_10160448 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300018083|Ga0184628_10709720 | Not Available | 501 | Open in IMG/M |
| 3300018084|Ga0184629_10352717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
| 3300018422|Ga0190265_12180121 | Not Available | 657 | Open in IMG/M |
| 3300018432|Ga0190275_13068015 | Not Available | 540 | Open in IMG/M |
| 3300018465|Ga0190269_10113712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1346 | Open in IMG/M |
| 3300018466|Ga0190268_10042687 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300018469|Ga0190270_11321769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300018469|Ga0190270_12060977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300018469|Ga0190270_13395253 | Not Available | 505 | Open in IMG/M |
| 3300018476|Ga0190274_10090678 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
| 3300018481|Ga0190271_11543918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
| 3300019356|Ga0173481_10448293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
| 3300019377|Ga0190264_10287690 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300019458|Ga0187892_10024300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5431 | Open in IMG/M |
| 3300019767|Ga0190267_10033083 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300019767|Ga0190267_10249850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
| 3300019884|Ga0193741_1003527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4323 | Open in IMG/M |
| 3300020003|Ga0193739_1027854 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300020005|Ga0193697_1054301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
| 3300021073|Ga0210378_10013841 | All Organisms → cellular organisms → Bacteria | 3333 | Open in IMG/M |
| 3300021078|Ga0210381_10053043 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300021082|Ga0210380_10335529 | Not Available | 690 | Open in IMG/M |
| 3300021510|Ga0222621_1119509 | Not Available | 560 | Open in IMG/M |
| 3300022195|Ga0222625_1144671 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300025167|Ga0209642_10267903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 976 | Open in IMG/M |
| 3300025167|Ga0209642_10406489 | Not Available | 762 | Open in IMG/M |
| 3300025313|Ga0209431_10069378 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
| 3300025325|Ga0209341_10785909 | Not Available | 723 | Open in IMG/M |
| 3300025326|Ga0209342_10961970 | Not Available | 655 | Open in IMG/M |
| 3300025549|Ga0210094_1094658 | Not Available | 562 | Open in IMG/M |
| 3300025904|Ga0207647_10058979 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
| 3300025908|Ga0207643_10001584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12883 | Open in IMG/M |
| 3300025925|Ga0207650_10109509 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
| 3300025925|Ga0207650_10256572 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300025925|Ga0207650_11732772 | Not Available | 529 | Open in IMG/M |
| 3300025973|Ga0210145_1010210 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300026053|Ga0208422_1006794 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300026075|Ga0207708_10000835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23253 | Open in IMG/M |
| 3300026075|Ga0207708_10001304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 18770 | Open in IMG/M |
| 3300026894|Ga0207980_1002757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1097 | Open in IMG/M |
| 3300027006|Ga0209896_1000678 | All Organisms → cellular organisms → Bacteria | 2847 | Open in IMG/M |
| 3300027006|Ga0209896_1012465 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300027056|Ga0209879_1054841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
| 3300027332|Ga0209861_1012300 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300027379|Ga0209842_1018477 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300027490|Ga0209899_1016696 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300027490|Ga0209899_1082872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300027647|Ga0214468_1007936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3098 | Open in IMG/M |
| 3300027650|Ga0256866_1039602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1238 | Open in IMG/M |
| 3300027722|Ga0209819_10292058 | Not Available | 562 | Open in IMG/M |
| 3300027743|Ga0209593_10065711 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300027873|Ga0209814_10001497 | All Organisms → cellular organisms → Bacteria | 8268 | Open in IMG/M |
| 3300027873|Ga0209814_10031182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2194 | Open in IMG/M |
| 3300027909|Ga0209382_10020463 | All Organisms → cellular organisms → Bacteria | 8047 | Open in IMG/M |
| 3300027909|Ga0209382_10350412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1654 | Open in IMG/M |
| 3300027909|Ga0209382_12294241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300027956|Ga0209820_1106895 | Not Available | 763 | Open in IMG/M |
| 3300027961|Ga0209853_1036616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1414 | Open in IMG/M |
| 3300028608|Ga0247819_10274742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 935 | Open in IMG/M |
| 3300028708|Ga0307295_10032453 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300028708|Ga0307295_10112291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
| 3300028708|Ga0307295_10223178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300028711|Ga0307293_10014570 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
| 3300028711|Ga0307293_10239857 | Not Available | 576 | Open in IMG/M |
| 3300028722|Ga0307319_10073095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1087 | Open in IMG/M |
| 3300028793|Ga0307299_10009281 | All Organisms → cellular organisms → Bacteria | 3459 | Open in IMG/M |
| 3300028793|Ga0307299_10186186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
| 3300028803|Ga0307281_10082755 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300028807|Ga0307305_10244244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
| 3300028814|Ga0307302_10668417 | Not Available | 516 | Open in IMG/M |
| 3300028819|Ga0307296_10159195 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300028828|Ga0307312_10503543 | Not Available | 799 | Open in IMG/M |
| 3300028875|Ga0307289_10009993 | All Organisms → cellular organisms → Bacteria | 3625 | Open in IMG/M |
| 3300028878|Ga0307278_10432137 | Not Available | 577 | Open in IMG/M |
| 3300028885|Ga0307304_10099267 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300028889|Ga0247827_10156398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1217 | Open in IMG/M |
| 3300030006|Ga0299907_10000117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 30221 | Open in IMG/M |
| 3300030006|Ga0299907_10005242 | All Organisms → cellular organisms → Bacteria | 8680 | Open in IMG/M |
| 3300030619|Ga0268386_10004628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10165 | Open in IMG/M |
| 3300031170|Ga0307498_10087565 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300031576|Ga0247727_10591468 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300031901|Ga0307406_12097226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300031943|Ga0310885_10076683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1464 | Open in IMG/M |
| 3300031949|Ga0214473_10105095 | All Organisms → cellular organisms → Bacteria | 3297 | Open in IMG/M |
| 3300031949|Ga0214473_10228054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2148 | Open in IMG/M |
| 3300031949|Ga0214473_11346507 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300031965|Ga0326597_10521300 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300032003|Ga0310897_10034063 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300032017|Ga0310899_10694147 | Not Available | 516 | Open in IMG/M |
| 3300032174|Ga0307470_10672677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
| 3300032180|Ga0307471_102984840 | Not Available | 600 | Open in IMG/M |
| 3300033407|Ga0214472_10625339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 987 | Open in IMG/M |
| 3300033407|Ga0214472_10850795 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300033550|Ga0247829_11214980 | Not Available | 625 | Open in IMG/M |
| 3300033551|Ga0247830_11730778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300034148|Ga0364927_0109707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300034165|Ga0364942_0200281 | Not Available | 652 | Open in IMG/M |
| 3300034176|Ga0364931_0090424 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 12.93% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 7.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.02% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.59% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.16% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.16% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.16% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.72% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.29% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.43% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.43% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.43% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.43% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
| 3300002123 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3 | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005045 | Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005105 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC | Environmental | Open in IMG/M |
| 3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012142 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT499_2 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025973 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026053 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026894 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_00546840 | 2124908045 | Soil | MRRFTLITIVVLFALIVGAAVYQIALANHDQAPFPGPVEGTPFPSLTPPP |
| KansclcFeb2_11239610 | 2124908045 | Soil | MRRFTLITLIVLFALLVGAAVYQLTLANRDEGPFPGPV |
| deepsgr_00923070 | 2199352025 | Soil | MRRFTFITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTPLPSLTPSP |
| INPhiseqgaiiFebDRAFT_1058647735 | 3300000364 | Soil | MRRFTLVTIVVLFALXIGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSP* |
| F12B_101232082 | 3300000443 | Soil | MRRFTLVTIVVLFALIIGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSP* |
| F24TB_111349842 | 3300000550 | Soil | MRRFTFITIVVLFGLLIGAGVYQLVLANRDRPPFPGPVEGTPLPSFAPSP* |
| F14TC_1021227502 | 3300000559 | Soil | MRRFTLVTIVVLFALIIGAAVYQIALASRDRAPFPGPVEGTPFPTVAPSP* |
| JGI10213J12805_104088022 | 3300000858 | Soil | MRRFTLITIIVLFALIVGAAIYQLALANRDRPRYPGPVEGTPLPSFAPSP* |
| JGI10216J12902_1071455202 | 3300000956 | Soil | MRRFTLITIVVLFALIVGAAVYQIALANHDQAPFPGPVEGTPFPSLTPPP* |
| JGI24747J21853_10088002 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFTFITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTPLPSL |
| C687J26634_100054582 | 3300002123 | Soil | VRRSTLITIIVLSVLIAGAAVCQVALASRDQGPFPSRVGHPLPQVQPSP* |
| JGI24033J26618_10184851 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFTFITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTP |
| soilL1_100797444 | 3300003267 | Sugarcane Root And Bulk Soil | VRRFTLITIIVLFLLIVAAAVSQLILASGDRPRFPGPVPGTPFPSPSASG* |
| Ga0055438_101847612 | 3300003995 | Natural And Restored Wetlands | VRRFTLITIIVLLVLLAGAAVYQVALASRDQEPFPGPVSGTPLPEAPPSTSG* |
| Ga0055432_101953521 | 3300004022 | Natural And Restored Wetlands | VRRFTLITLIVLFVLLVGAGAYQLVIASRDQAPYPGPVSGTPLPSLVPSP* |
| Ga0062593_1000672993 | 3300004114 | Soil | VRRFTLITLIVLFVLLVLAALYQLTLANRDAGPFPGPAPGTPLPSAPT* |
| Ga0062592_1002252112 | 3300004480 | Soil | MRRFTFITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTPLPSLTPSP* |
| Ga0062591_1009952612 | 3300004643 | Soil | VRRFTLITLIVLFVLLAGAALYQLTLANRNEGPFPGPVQGTPLPTAAGAT* |
| Ga0062591_1011025172 | 3300004643 | Soil | MRRFTFITIVVLFALLIGAAVYQIALANRDQAPFPGPVEGTPLPSFAPSP* |
| Ga0071328_1258512 | 3300005045 | Permafrost | VRRFTLITIVVLFALIAVAALYQLVLANRGEPRFPGPVPGTPLPTATPNP* |
| Ga0062594_1007715282 | 3300005093 | Soil | MRRFTFITIVVLFALLIGAAVYQIALANRGQAPFPGPVEGTPLPSFAPSP* |
| Ga0066812_10191832 | 3300005105 | Soil | MRRFTLITIVVLIALIIGAAVYQIALANRDQAPFPGPVEGTPFPSVAPSP* |
| Ga0068997_100071952 | 3300005204 | Natural And Restored Wetlands | VRRFTLITVIVLFSVIVGAAIFQLVLASRDQTPYPGPVEGTPLPQSSP* |
| Ga0065705_100403992 | 3300005294 | Switchgrass Rhizosphere | MRRFTLITIVVLFGLLIGAAVYQTVLANRDRAPFPGPVEGTPLPSFAPSP* |
| Ga0070670_1008969822 | 3300005331 | Switchgrass Rhizosphere | MRRFTFITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTQLPSLTPSP* |
| Ga0066388_1049082372 | 3300005332 | Tropical Forest Soil | VRRFTRITLIVLFVGLVVAAFYQLALANRDAGPFPGPGPGTPLPTAST* |
| Ga0070674_1019534412 | 3300005356 | Miscanthus Rhizosphere | RFTFITIVVLFALLIGAAVYQIALANRGQAPFPGPVEGTPLPSFAPSP* |
| Ga0070700_1017126122 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQGTPFPSFTAPP* |
| Ga0070694_1003084051 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFTLVTIVVLFALIVGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSP* |
| Ga0070662_1010051092 | 3300005457 | Corn Rhizosphere | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPDQGTPLPSFTASP* |
| Ga0066905_1001993862 | 3300005713 | Tropical Forest Soil | MRRFTLITLIVLFVLLLGAALYQLTLANREAGPFPGPQKGTPLPTGSGTT* |
| Ga0066905_1002966642 | 3300005713 | Tropical Forest Soil | MRRFTLITLIVLVALLVGAAIYQLTLANRDVGPFPGPVHGTPLPSAAPSD* |
| Ga0066905_1012850382 | 3300005713 | Tropical Forest Soil | MRRFTLITLIVLFVLLVGAALYQFTLANRDDGPFPGPVEGTPLPTAAPSG* |
| Ga0066905_1021558661 | 3300005713 | Tropical Forest Soil | VRRFTFITIVVLFVLIAGAAVYQVLIASEDRAPYPGPVQGTPLPST |
| Ga0066903_1060328572 | 3300005764 | Tropical Forest Soil | VRRFTLITLIVLFVLLVGAAFYQLALANREAGPFPGPGKGTPLPTATT* |
| Ga0068863_1005336554 | 3300005841 | Switchgrass Rhizosphere | MRRFTLVTIVVLFALIIGAAVYQIGLASRDRAPFPGPVEGTPFPSVAPSP* |
| Ga0081455_1000215415 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VRRFTLITLIVLFVLLVGAALYQLTLANRDVGPFPGPVEGTPLPTGTT* |
| Ga0081455_100127302 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VRRFTLITLIVLFVLLVGAALYQLTLANRDAGPFPGPMSGTPLPTGAPTT* |
| Ga0081455_100330326 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVRGTPFPSFTPSP* |
| Ga0081455_101004914 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRRFTLIALIVLSVLLVGAAVYQLTLANRDVGPFPGPVEGTPLPTAAP* |
| Ga0075417_100125594 | 3300006049 | Populus Rhizosphere | VRRFTLITLIVLFVLLVGAAVYQLTLASRNEGPFPGPVEGTPLPTAAGAT* |
| Ga0075417_100993173 | 3300006049 | Populus Rhizosphere | MRRFTLITIVVLFTLIIGAAVYQIALANRDQPPFPGPVQGTPFPSFTAPP* |
| Ga0074051_100027892 | 3300006572 | Soil | MRRFTLITIVVLFVLIVCAAVYQIALANRDQAPFPGPVVGTPLPTFSPSP* |
| Ga0074047_119493421 | 3300006576 | Soil | MRRFTLITIVVLFGLIIGAAVYQIALASRDQAPFPGPVEGTPFPSVAPSP* |
| Ga0074050_116977111 | 3300006577 | Soil | AMRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQGTPFPSFTASP* |
| Ga0074049_126214852 | 3300006580 | Soil | MRRFTLITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTPLPSLTPSP* |
| Ga0074048_100107512 | 3300006581 | Soil | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQGTPFPSFTASP* |
| Ga0075428_1000248208 | 3300006844 | Populus Rhizosphere | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTIVGSP* |
| Ga0075428_1000335566 | 3300006844 | Populus Rhizosphere | VRRFTFITIVVLIVLIAGAAVYQIVIASKDRAPLPGPVPGTPLPSIEPSP* |
| Ga0075428_1003369332 | 3300006844 | Populus Rhizosphere | MRRFTLITLIVLFVLLVGAALYQLTLANNDAGPFPGPVEGTPLPTASP* |
| Ga0075428_1022651631 | 3300006844 | Populus Rhizosphere | MRRFTLITIVVLFALIIGAAVYQIALASRDRAPFPGPVEGTPFPSVA |
| Ga0075431_1010445792 | 3300006847 | Populus Rhizosphere | VRRFTLITLIVLFVLLVGAAVYQLTLASRNEGPFPGPVEGTPLP |
| Ga0073934_101160913 | 3300006865 | Hot Spring Sediment | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTSVP* |
| Ga0105679_108527104 | 3300007790 | Soil | VRRFTLITIVVLFALIVAAAVYQLMLAGSDAPRYPGPQPGTPLPSASVTVATG* |
| Ga0105251_101775372 | 3300009011 | Switchgrass Rhizosphere | MRRFTFVTIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTPLPSLTPSP* |
| Ga0105098_100084184 | 3300009081 | Freshwater Sediment | VRRFTLITIIVLFGLILGTAIYQLVLANRDQPRYPGPVEGTPLPSIVRSP* |
| Ga0105098_104110411 | 3300009081 | Freshwater Sediment | MRRFTLITIVVLFALIIGAAVYQIALANRDQAPFPGPVEGTPFPSVAPSR* |
| Ga0111539_116307632 | 3300009094 | Populus Rhizosphere | MRRFTLITIVVLFTLIIGAAVYQIALANRDQPPFPGP |
| Ga0111539_129450812 | 3300009094 | Populus Rhizosphere | MRRFTFIAIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTPLPSLTPSP* |
| Ga0075418_115655242 | 3300009100 | Populus Rhizosphere | MRRFTLITIVVLFALIIGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSP* |
| Ga0105091_102880441 | 3300009146 | Freshwater Sediment | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPSIVRSP* |
| Ga0105091_107211682 | 3300009146 | Freshwater Sediment | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVQGTPLPTIVRSP* |
| Ga0114129_103175412 | 3300009147 | Populus Rhizosphere | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTIVRSP* |
| Ga0111538_100364254 | 3300009156 | Populus Rhizosphere | MRRFTLITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTPLPSFAPSR* |
| Ga0111538_139342892 | 3300009156 | Populus Rhizosphere | MRRFTLITIVVLFTLIIGAAVYQIALANRDQPPFPGPVQGTPFPSFTAP |
| Ga0105092_101443262 | 3300009157 | Freshwater Sediment | MRRFTLITIVVLFTLIIGAAVYQIALAKRDQAPFPGPVQGTPFPSFTPSP* |
| Ga0105104_100217852 | 3300009168 | Freshwater Sediment | VRRFTLITIIVLFALILGTAIYQLALANRDQPRYPGPVEGTPLPTIVRSP* |
| Ga0105241_109198342 | 3300009174 | Corn Rhizosphere | MRRFTFITIVVLFALLIGAAVYQITLANRDQAPFPGPVEGTPLPGFAPSP* |
| Ga0105056_10274842 | 3300009801 | Groundwater Sand | MRRFTLITIVVLFALIVGAAVYQIALANRDQAPFPGPVEGTPFPSFTPPP* |
| Ga0105056_10572501 | 3300009801 | Groundwater Sand | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVE |
| Ga0105084_10218602 | 3300009811 | Groundwater Sand | MRRVTLITIILLFGLILGTAIYQLALANRDRPRYP |
| Ga0105084_10236022 | 3300009811 | Groundwater Sand | MRRFTLITIVVLFTLIIGAAVYQIALADRDQAPFPGPVQGTPFPSFTASP* |
| Ga0105084_10863161 | 3300009811 | Groundwater Sand | MRRFTLITIVVLFALIVGAAVYQIALANRDQAPFPGPVEGTPFPSFTPAPLMPHGGANDAR* |
| Ga0105076_10007535 | 3300009816 | Groundwater Sand | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTTVRSP* |
| Ga0105062_10080972 | 3300009817 | Groundwater Sand | MRRFTLVTIVVLFALIIGAAVYQIALASRDRAPFPGPVEGTPFPSVAASP* |
| Ga0105072_10061723 | 3300009818 | Groundwater Sand | MRRFTLITIVVLFALIIGAAVYQIALANRDQAPFPGPVEGTPFLSFTPPP* |
| Ga0105087_11008222 | 3300009819 | Groundwater Sand | VRRFTLITIIVLFGLILGTALYPLALANRDQPRYPGPVEGTPLPTTVRSP* |
| Ga0105078_10112512 | 3300009823 | Groundwater Sand | VRRVTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTIVGSP* |
| Ga0126313_103542322 | 3300009840 | Serpentine Soil | MRRFTLITIVVLFALIIGAAVYQIALANRDQAPFPGPVEGTPFPSIAPSP* |
| Ga0126313_110739992 | 3300009840 | Serpentine Soil | MRRFTLITIVVLFALILGAAVYQIALASCDQAPFPGPVEGTPLPSPTPSP* |
| Ga0126313_115091522 | 3300009840 | Serpentine Soil | VRRFTLITIIVLFLLIGAAAIYQLVLAGGDRPRFPGPVPGTPLPSASVGGASG* |
| Ga0126312_100094092 | 3300010041 | Serpentine Soil | VRRFTLVTIVVLFALIIAAAVYQIALANRDQAPFPGPVEGTPLPTFAPSP* |
| Ga0126306_101178424 | 3300010166 | Serpentine Soil | MRRFTLITIVVLFALIIGAAVYQIALANRDQAPFPGPVEGTPFPSVAPSP* |
| Ga0126377_100253816 | 3300010362 | Tropical Forest Soil | MRRFTLITLIVLFVLLVGAAVYQLTLASRDTGPFPGPMSGTPLPTADDAT* |
| Ga0105239_117099682 | 3300010375 | Corn Rhizosphere | MRRFTLITIVVLFALLIGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSP* |
| Ga0105246_111463652 | 3300011119 | Miscanthus Rhizosphere | MRRFTFITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTPL |
| Ga0137424_10016914 | 3300011412 | Soil | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTSLPTLVP* |
| Ga0137463_12427622 | 3300011444 | Soil | MRRFTLITIVVLFALIIGAAVYQIALANRDQAPFPGPVEGTPLPSFAPTR* |
| Ga0137427_100992321 | 3300011445 | Soil | VRRFTLITIIVLSVLIAGAAIYQIALASRDQAPYPGPISGTPLPQVTPSP* |
| Ga0120191_100960641 | 3300012022 | Terrestrial | VRRGTFIAIVVLFVLLGAAAIYQLVLASDDRDPFPGPQPGTPVPTTTTTP* |
| Ga0137430_12239151 | 3300012041 | Soil | MRRFTLITIVVLFALLIGAAVYQIALANRDQAPFPGLVEGTPLPSFAPTR* |
| Ga0137343_10231392 | 3300012142 | Soil | VRRFTLITIIVLFGLIVGTAIYQLALANRDRPRYPGPVEGTPLPTIVRSP* |
| Ga0137344_11002042 | 3300012159 | Soil | PPVRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPIEGTPLPTSVP* |
| Ga0137374_101552462 | 3300012204 | Vadose Zone Soil | MRRFTLITIVVLFALIVGAAVYQIALANRDQAPFPGPVEGTPFPSLTPSP* |
| Ga0137374_103327341 | 3300012204 | Vadose Zone Soil | MRRFTLVTIVVLFALIIGAAVYQIALASRDRAPFPGPVEGTPFPSIAPSP* |
| Ga0137367_100804202 | 3300012353 | Vadose Zone Soil | MRRFTLITIVVLFALIIGAAVYQIALANRDQAPFPGPVEGTPLPSVAMSP* |
| Ga0137369_104678301 | 3300012355 | Vadose Zone Soil | MRRFTLITIVVLFALIIGAAIYQIALANRDRAPFPGPVEGTPFP |
| Ga0137373_106930382 | 3300012532 | Vadose Zone Soil | MRRFTLITIVVLFGLIIGAAVYQIALANRDQAPFPGPVEGTPFPSVAPSP* |
| Ga0075311_11461772 | 3300014259 | Natural And Restored Wetlands | VRRFTLITIIVLFVLIAGAAIYQVVLASREQAPFPGPVSGTPLPQATASP* |
| Ga0075342_10157182 | 3300014320 | Natural And Restored Wetlands | VRRFTLITIIVLFVLIAGAAVYQIALASRDQEPFPGPVSGTPLPEGQP* |
| Ga0075353_11680722 | 3300014321 | Natural And Restored Wetlands | RFTLITVIVLFSVIVGAAIFQLVLASRDQTPYPGPVEGTPLPQASP* |
| Ga0157377_102798911 | 3300014745 | Miscanthus Rhizosphere | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQGTP |
| Ga0132256_1014103301 | 3300015372 | Arabidopsis Rhizosphere | MRRFTFITIVVLFGLLIGAAVYQTVLANRDRAPFPGPVEGTPL |
| Ga0132255_1029307792 | 3300015374 | Arabidopsis Rhizosphere | MRRFTLITIVVLFGLLIGAAVYQTVLANRDRAPFPGPVEGTPLPSFVPSP* |
| Ga0190266_104350981 | 3300017965 | Soil | VRRFTLITIIVLFGLIIGTAIYQLALANRDRPRYPGPVEGTPLPTIVRSP |
| Ga0184610_10763073 | 3300017997 | Groundwater Sediment | IIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTSVP |
| Ga0184608_104390512 | 3300018028 | Groundwater Sediment | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTSVP |
| Ga0184634_101134523 | 3300018031 | Groundwater Sediment | VRRFTPVTIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTSVP |
| Ga0184638_12377342 | 3300018052 | Groundwater Sediment | ITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTSVP |
| Ga0184626_100236242 | 3300018053 | Groundwater Sediment | MRRFTLITIVVLFALIVGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSP |
| Ga0184626_101798332 | 3300018053 | Groundwater Sediment | VRRFTLITLIVLFVLIVGTAIYQLVLANRDQAPFPGPALGTPLPSLTGST |
| Ga0184623_100988362 | 3300018056 | Groundwater Sediment | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPAEGTPLPTSVP |
| Ga0184623_101475432 | 3300018056 | Groundwater Sediment | VRRFTLITIIVLFGLIVGAAIYQLALANRDRPRYPGPVEGTPLPSFAPTR |
| Ga0184623_104347822 | 3300018056 | Groundwater Sediment | VRRFTFITILVLFLLLGGAAVYQLVLANRDDQRFPGPAPGTPLPTPSPTS |
| Ga0184623_105027571 | 3300018056 | Groundwater Sediment | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTSDP |
| Ga0184637_104619352 | 3300018063 | Groundwater Sediment | TFITLICLFLLIAGAAVYQLALANRDVGRFPGPEIGTPLPSATAAT |
| Ga0184637_106476732 | 3300018063 | Groundwater Sediment | ITLIVLFVLIIGTAIYQLVLADRDQAPFPGPALGTPLPSLTGST |
| Ga0184611_12720351 | 3300018067 | Groundwater Sediment | MRRFTFITIVVLFGLLIGAGIYQLVLANRDRPPFPGPGEGTPLPSFAPSP |
| Ga0184640_101293552 | 3300018074 | Groundwater Sediment | VRRFTLITIIVLFVLIVGTAIYQLVLANRDQEPFPGPALGTPLPSLTGST |
| Ga0184640_103842281 | 3300018074 | Groundwater Sediment | MRRFTFVTIVVLFGLLIGAGIYQLVLANRDRPPFPGPVQGTPFPSFTASP |
| Ga0184632_102209222 | 3300018075 | Groundwater Sediment | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPASVP |
| Ga0184632_104378572 | 3300018075 | Groundwater Sediment | VRRFTLITIIVLFGLILGTAIYQLSLANRDRPRYPGPVEGTPLPTIVRSP |
| Ga0184609_103055332 | 3300018076 | Groundwater Sediment | VRRFTLITIIVLFGLIVGAAIYQLALANRDRPRYPGPVEGTPLPTIVRSP |
| Ga0184609_104467222 | 3300018076 | Groundwater Sediment | VRRFTLITIIVLFGLILGTAIYQLALANRDRPRYPGPVEGTPLPTLVP |
| Ga0184633_102792832 | 3300018077 | Groundwater Sediment | VRRFTLITLIFLFVLLSAAAIYQLVIASRDRGPSPGPVSGTASPTAEISPTS |
| Ga0184612_101402391 | 3300018078 | Groundwater Sediment | MRRFTLVTIVVLFALIIGAAVYQIALASRDRAPFPGPVEG |
| Ga0184612_102087901 | 3300018078 | Groundwater Sediment | TLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTIVRSP |
| Ga0184612_103438031 | 3300018078 | Groundwater Sediment | TIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTSVP |
| Ga0184612_105005371 | 3300018078 | Groundwater Sediment | VRRFTLVTIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTSV |
| Ga0184612_105936912 | 3300018078 | Groundwater Sediment | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQGTPFPNSTASP |
| Ga0184625_104036472 | 3300018081 | Groundwater Sediment | MRRFTFVTIVVLFGLLIGAGIYQLVLANRDRPPFPGPGEGTPLPSFAPSP |
| Ga0184639_101866941 | 3300018082 | Groundwater Sediment | VRRFTLITIIVLFVLMIGAAIYQLVLADRDQAPFPGPALGTPLPSLTGST |
| Ga0184628_101604482 | 3300018083 | Groundwater Sediment | MRRFTLIAIVVLFALIIGAAVYQIALANRDQAPFPGPVEGTPLPSFAPTR |
| Ga0184628_107097202 | 3300018083 | Groundwater Sediment | MRRFTLITIVVLFALIIGAAVYQIALARRDRAPFPGPVEGTPFPSVVPSP |
| Ga0184629_103527172 | 3300018084 | Groundwater Sediment | MRRSTFITIVVLFALLIGAAVYQITLANRDQAPFPGPVEGTPLPSFAPTR |
| Ga0190265_121801212 | 3300018422 | Soil | VRRFTLITIVVLFVLLGAAAIYQLVLANRNDERFPGPVPGTPLPSPSTTS |
| Ga0190275_130680152 | 3300018432 | Soil | VRRFTLITIVVLFALLGAAAIYQLVLANRNDERFPGPVPGTPLPSPSTTS |
| Ga0190269_101137123 | 3300018465 | Soil | VRRFTLITIIVLFGLIIGTAIYQLALANRDRPRYPGPVEGTPLPTSVP |
| Ga0190268_100426872 | 3300018466 | Soil | MRRFTLVTIVVLFALIIGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSR |
| Ga0190270_113217691 | 3300018469 | Soil | MRRFTFITIVVLFGLLIGAAVYQIALANRDQAPFPGPAEGTPFPSLTPPP |
| Ga0190270_120609772 | 3300018469 | Soil | MRRFTLVTIVVLFALIIGAAVYQIALASRDRAPFPGPVEGTPFPSVVPSP |
| Ga0190270_133952532 | 3300018469 | Soil | VRRFTFITIVVLFALIIGAAFYQIALANRDQAPFPGPVEGTPFPSAPSP |
| Ga0190274_100906784 | 3300018476 | Soil | MRRFTLITIVVLFALIIGAAVYQIALANRDQAPFPGPVEGTPFPSVAPSR |
| Ga0190271_115439182 | 3300018481 | Soil | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTIVPSP |
| Ga0173481_104482932 | 3300019356 | Soil | MRRFTFITIVVLFALLIGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSP |
| Ga0190264_102876902 | 3300019377 | Soil | VRRFTLITLIVLLALLVGAGAYQVVLATRDQEPFPGPAPGTPLPSVSVTP |
| Ga0187892_100243002 | 3300019458 | Bio-Ooze | VRRFTFITLVVLFVLIAATAIYQLVLANREQAPFPGPELGTPLPSLTGST |
| Ga0190267_100330831 | 3300019767 | Soil | MRRFTLITIVVLFALIIGAAVYQIALAGRDRAPFPGPVEGTPFPSVAPSP |
| Ga0190267_102498502 | 3300019767 | Soil | MRRFTLVTIVVLFALIIGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSP |
| Ga0193741_10035273 | 3300019884 | Soil | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTIVRSP |
| Ga0193739_10278544 | 3300020003 | Soil | VRRFTLITIIVLFGLIVGAAVYQIALANRDRAPFPGPVEGTPFPSVAPSP |
| Ga0193697_10543012 | 3300020005 | Soil | MRRFTFITIVVLFALLIGAAVYQITLANRDQAPFPGPVEGT |
| Ga0210378_100138414 | 3300021073 | Groundwater Sediment | VRRFTLVTIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTSVP |
| Ga0210381_100530432 | 3300021078 | Groundwater Sediment | MRRFTLVTIVVLFALIIGAAVYQIALASRDRAPFPAPVEGTPFPSVAPSP |
| Ga0210380_103355292 | 3300021082 | Groundwater Sediment | MRRFTFITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVQGTPLPSLTPSP |
| Ga0222621_11195092 | 3300021510 | Groundwater Sediment | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQGTPFPSFTASP |
| Ga0222625_11446712 | 3300022195 | Groundwater Sediment | MRRFTLVTIVVLFALISGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSP |
| Ga0209642_102679031 | 3300025167 | Soil | VRRFTLITIIVLVVLIAGAAVYQIALASRDQGPFPGPVSGTPLPEITPSPAG |
| Ga0209642_104064892 | 3300025167 | Soil | VRRFTLITIIVLFAAIAGAAIFQLTLASRDQAPYPGPVSGSPLPGVEGSP |
| Ga0209431_100693784 | 3300025313 | Soil | VRRFTLITIIVLSVLIAGAAAYQVALASRDRGPFPGPVSGTPLPEITPSPAG |
| Ga0209341_107859092 | 3300025325 | Soil | VRRFTLITIIVLFVLIVGAAVYQIALASRDQDPFPGPVSGTPLPQTQPSPSA |
| Ga0209342_109619702 | 3300025326 | Soil | VRRFTLITIIVLSVLITGAAVYQVALASRDQDPYPGPVSGTPLPQVELSP |
| Ga0210094_10946582 | 3300025549 | Natural And Restored Wetlands | VRRFTLITIIVLLVLLAGAAVYQVALASRDQEPFPGPVSGTPLPEAPPSTSG |
| Ga0207647_100589794 | 3300025904 | Corn Rhizosphere | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQGTPFPSFTAPP |
| Ga0207643_100015847 | 3300025908 | Miscanthus Rhizosphere | MRRFTFITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTQLPSLTPLPLSLAAARTA |
| Ga0207650_101095094 | 3300025925 | Switchgrass Rhizosphere | MRRFTFITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTQLPSLTPSP |
| Ga0207650_102565722 | 3300025925 | Switchgrass Rhizosphere | MRRFTLITIVVLFALIIGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSP |
| Ga0207650_117327721 | 3300025925 | Switchgrass Rhizosphere | MRRFTFVTIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTPLPSLTPSP |
| Ga0210145_10102102 | 3300025973 | Natural And Restored Wetlands | VRRFTLITVIVLFSVIVGAAIFQLVLASRDQTPYPGPVEGTPLPQSSP |
| Ga0208422_10067942 | 3300026053 | Natural And Restored Wetlands | VRRFTLITIIVLFVLIAGAAVYQIALASRDQEPFPGPVSGTPLPEGQP |
| Ga0207708_1000083528 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | FITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTPLPSLTPSP |
| Ga0207708_100013042 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFTLITIVVLFGLLIGAAVYQTVLANRDRAPFPGPVEGTPLPSFAPSP |
| Ga0207980_10027572 | 3300026894 | Soil | MRRFTLITIVVLIALIIGAAVYQIALANRDQAPFPGPVEGTPFPSVAPSP |
| Ga0209896_10006782 | 3300027006 | Groundwater Sand | MRRFTLITIVVLFALIVGAAVYQIALANRDQAPFPGPVEGTPFPSFTPPP |
| Ga0209896_10124652 | 3300027006 | Groundwater Sand | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTIVGSP |
| Ga0209879_10548412 | 3300027056 | Groundwater Sand | VRRVTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTIVGSP |
| Ga0209861_10123002 | 3300027332 | Groundwater Sand | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTTVRSP |
| Ga0209842_10184773 | 3300027379 | Groundwater Sand | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQGTPFPSFTVSP |
| Ga0209899_10166962 | 3300027490 | Groundwater Sand | VRRFTLITIIVLFGLILGTAIYQLALANRDRPRYPGPVEGTPLPTSVP |
| Ga0209899_10828721 | 3300027490 | Groundwater Sand | MRRFTLITIVVLFALIVGAAVYQIALANRDQAPFPGPV |
| Ga0214468_10079362 | 3300027647 | Soil | VRRFTFITIVVLFALLGAAAIYQLVLANRGEQRFPGPAIGTPLPSPSPTA |
| Ga0256866_10396022 | 3300027650 | Soil | VRRFTLITIIVLFVLLGAAAIYQLVLANRNDERFPGPVPGAPLPSPSSTS |
| Ga0209819_102920582 | 3300027722 | Freshwater Sediment | VRRFTLITIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPSIVRSP |
| Ga0209593_100657112 | 3300027743 | Freshwater Sediment | VRRFTLITIIVLFALILGTAIYQLALANRDQPRYPGPVEGTPLPTIVRSP |
| Ga0209814_100014976 | 3300027873 | Populus Rhizosphere | MRRFTLITIVVLFTLIIGAAVYQIALANRDQPPFPGPVQGTPFPSFTAPP |
| Ga0209814_100311822 | 3300027873 | Populus Rhizosphere | VRRFTLITLIVLFVLLVGAAVYQLTLASRNEGPFPGPVEGTPLPTAAGAT |
| Ga0209382_100204635 | 3300027909 | Populus Rhizosphere | VRRFTFITIVVLIVLIAGAAVYQIVIASKDRAPLPGPVPGTPLPSIEPSP |
| Ga0209382_103504122 | 3300027909 | Populus Rhizosphere | VRRFTLIMIIVLFGLILGTAIYQLALANRDQPRYPGPVEGTPLPTIVGSP |
| Ga0209382_122942412 | 3300027909 | Populus Rhizosphere | MRRFTLITIVVLFTLIIGAAVYQIALANRDQPPFPGPVQGTPFP |
| Ga0209820_11068952 | 3300027956 | Freshwater Sediment | VRRFTLITIIVLFGLILGTAIYQLVLANRDQPRYPGPVEGTPLPSIVRSP |
| Ga0209853_10366161 | 3300027961 | Groundwater Sand | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQGTPFPSFT |
| Ga0247819_102747421 | 3300028608 | Soil | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQG |
| Ga0307295_100324531 | 3300028708 | Soil | PPPMRRFTLVTIVVLFALIIGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSP |
| Ga0307295_101122912 | 3300028708 | Soil | MRRFTLVTIVVLFALIIGAAVYQIALASRDRAPFPGPVEGTPFPSVAP |
| Ga0307295_102231782 | 3300028708 | Soil | MRRFTLIAIVVLFALIIGAAVYQITLANRDQAPFPGPVEGTPLPSFAPTR |
| Ga0307293_100145704 | 3300028711 | Soil | MRRFTLITIVVLFALIIGAAVYQIALANRDQAPFPGPVEGTPLPSFAPKR |
| Ga0307293_102398572 | 3300028711 | Soil | VRRFTLITIIVLFGLILGTAIYQVALANRDQPRYPGPVEGTPLPTSVP |
| Ga0307319_100730952 | 3300028722 | Soil | MRRFTLITIVVLFALIIGAAFYQIALANRDQAPFPGPVEGTPFPSLTPSP |
| Ga0307320_103891472 | 3300028771 | Soil | MRRFTLITIVVLFALIIGAAVYQIALANRDQAPFP |
| Ga0307299_100092812 | 3300028793 | Soil | MRRFTLITIVVLFALIIGAAIYQITLANRDQAPFPGPVEGTPLPSFAPTR |
| Ga0307299_101861862 | 3300028793 | Soil | MRRFTFITIVVLFALLIGAAVYQITLANRDQAPFPGPVEGTPL |
| Ga0307281_100827552 | 3300028803 | Soil | MRRFTFITIVVLLGLLIGAAVYQIVLANRDRAPFPGPVEGTPLPSLTPSP |
| Ga0307305_102442442 | 3300028807 | Soil | MRRFTLVTIVVLFALIIGAAVYQIALAGRDRAPFPGPVEGTPFPSVPPSP |
| Ga0307302_106684171 | 3300028814 | Soil | VRRFTRLTIVFLFLLLAGAALYQLILANRNIERFPGPVPGTPLPSASRTR |
| Ga0307296_101591952 | 3300028819 | Soil | MRRFTLITIVVLFGLIVGAAVYQIALANREQAPYPGPVEGTPFPSVAPSP |
| Ga0307312_105035432 | 3300028828 | Soil | MRRFTLVTIVVLFALIIGAAIYQIALASRDRAPFPGPVEGTPFPSVAPSP |
| Ga0307289_100099931 | 3300028875 | Soil | MRRFTLITIVVLFALIIGAAVYQIALANRDQAPFPGPVEGTPLPSFAPTR |
| Ga0307278_104321372 | 3300028878 | Soil | MRRFTLITIVVLFGLIVGAAVYQIGLANRDQAPFPGPVEGTPFPSLTPSP |
| Ga0307304_100992672 | 3300028885 | Soil | MRRFTLVTIVVLFALIVGAAVYQIALASRDRAPFPGPVEGTPFPSVAPSP |
| Ga0247827_101563981 | 3300028889 | Soil | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQGTPFPSFTASPP |
| Ga0299907_100001172 | 3300030006 | Soil | VRRGTFIAIVVLFVLLAAAAIYQLVLASDDRDRFPGPQPGTPVPTTTTTP |
| Ga0299907_1000524211 | 3300030006 | Soil | VRRFTLITIIVLFTLIAGAAAYQIAIANRDRAPYPGPVLGTPLPSIAPSP |
| Ga0268386_100046287 | 3300030619 | Soil | VRRFTLITIIVLFVLLGAAAIYQLVLANRNDERFPGPVPGTPLPSPSSTS |
| Ga0307498_100875652 | 3300031170 | Soil | MRRFTFITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTPLPSLTPSA |
| Ga0247727_105914682 | 3300031576 | Biofilm | VRRFTLITLIVLFVLIVGTAIYQLVLADRDQAPFPGPALGTPLPSLTGST |
| Ga0307406_120972261 | 3300031901 | Rhizosphere | MRRFTLITIVVLFALIIGAAVYQIALANRDQAPFPGPVEGTPFPSIAPSP |
| Ga0310885_100766832 | 3300031943 | Soil | MRRFTLITIVVLFGLLIGAAVYQTVLANRDRAPFPGPVEGTQLPSLTPSP |
| Ga0214473_101050952 | 3300031949 | Soil | VRRFTLITIIVLFVLIVGAAVYQIALASRDQDPFPGPVSGTPLPQIQPSPSA |
| Ga0214473_102280542 | 3300031949 | Soil | VRRFTLITIIVLFVLLGAAAIYQLVLANRNVERFPGPVPGTPLPSPSSTS |
| Ga0214473_113465072 | 3300031949 | Soil | VRRFTLITIIVLFVLIVGAAVYQIALASRDQDPFPGPVSGTPLPQVQPSPSA |
| Ga0326597_105213002 | 3300031965 | Soil | VRRFTLITIIVLFVLIVGAAAYQIALASRNQDPFPGPVSGTPLPQIQPSPSA |
| Ga0310897_100340631 | 3300032003 | Soil | VRRFTLITIVVLFGLLIGAAVYQIVLANRDRAPFPGPVEGTP |
| Ga0310899_106941472 | 3300032017 | Soil | IVVLFGLLIGAAVYQTVLANRDRAPFPGPVEGTPLPSFAPSP |
| Ga0307470_106726772 | 3300032174 | Hardwood Forest Soil | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGP |
| Ga0307471_1029848402 | 3300032180 | Hardwood Forest Soil | TASLPAMRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQGTPFPSFTASP |
| Ga0214472_106253392 | 3300033407 | Soil | VRRFTFITIVVLFSLLGAAAIYQLVLANRNDERFPGPVPGTPLPSPSSTS |
| Ga0214472_108507951 | 3300033407 | Soil | VRRFTLITVIALFVLLGAAAIYQLVLANRNDVRFPGPVPGTPLPSPSSTS |
| Ga0247829_112149802 | 3300033550 | Soil | MRRFTLLTIVVLFTLIIGAAVYQIALASRDQAPFPGPVMGTPLPSVAPSP |
| Ga0247830_117307782 | 3300033551 | Soil | MRRFTLITIVVLFTLIIGAAVYQIALANRDQAPFPGPVQGTPFPSFTA |
| Ga0364927_0109707_305_457 | 3300034148 | Sediment | MRRFTLITIVVLFALLIGAAVYQIALANRDQGPFPGPVEGTPLPSFAPTR |
| Ga0364942_0200281_193_351 | 3300034165 | Sediment | VRRFTLITIIVLVVLIAGAAVYQIALASRDQGPFPGPVSGTPLPGITPSPAG |
| Ga0364931_0090424_1_147 | 3300034176 | Sediment | RFTLITIIVLFGLIVGAAIYQLALANRDRPRYPGPVEGTPLPTIVRSP |
| ⦗Top⦘ |