| Basic Information | |
|---|---|
| Family ID | F018817 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 233 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MFFLPGYLLGLHFTKLGFIINWLWFDLVFYGWVRAKQMLGDDE |
| Number of Associated Samples | 174 |
| Number of Associated Scaffolds | 233 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 4.74 % |
| % of genes near scaffold ends (potentially truncated) | 74.68 % |
| % of genes from short scaffolds (< 2000 bps) | 81.12 % |
| Associated GOLD sequencing projects | 157 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.210 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (23.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.369 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.412 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 233 Family Scaffolds |
|---|---|---|
| PF00462 | Glutaredoxin | 73.39 |
| PF02617 | ClpS | 6.01 |
| PF11953 | DUF3470 | 4.29 |
| PF02915 | Rubrerythrin | 2.58 |
| PF04055 | Radical_SAM | 2.58 |
| PF00037 | Fer4 | 2.15 |
| PF02657 | SufE | 1.72 |
| PF00011 | HSP20 | 1.29 |
| PF02310 | B12-binding | 1.29 |
| PF10431 | ClpB_D2-small | 0.86 |
| PF07715 | Plug | 0.86 |
| PF01970 | TctA | 0.43 |
| PF01165 | Ribosomal_S21 | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 233 Family Scaffolds |
|---|---|---|---|
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 6.01 |
| COG2166 | Sulfur transfer protein SufE, Fe-S cluster assembly | Posttranslational modification, protein turnover, chaperones [O] | 1.72 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.29 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.43 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.79 % |
| Unclassified | root | N/A | 47.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000256|LP_F_10_SI03_120DRAFT_1015674 | All Organisms → Viruses → Predicted Viral | 1921 | Open in IMG/M |
| 3300001419|JGI11705J14877_10005215 | Not Available | 6267 | Open in IMG/M |
| 3300001460|JGI24003J15210_10008752 | All Organisms → Viruses → Predicted Viral | 4179 | Open in IMG/M |
| 3300001460|JGI24003J15210_10145497 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300003619|JGI26380J51729_10141402 | Not Available | 510 | Open in IMG/M |
| 3300004097|Ga0055584_100943246 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300004097|Ga0055584_101406877 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300004097|Ga0055584_102517314 | Not Available | 519 | Open in IMG/M |
| 3300005433|Ga0066830_10009734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 1819 | Open in IMG/M |
| 3300005512|Ga0074648_1051083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 1791 | Open in IMG/M |
| 3300005838|Ga0008649_10043535 | All Organisms → Viruses → Predicted Viral | 2023 | Open in IMG/M |
| 3300005913|Ga0075108_10043594 | All Organisms → Viruses → Predicted Viral | 1707 | Open in IMG/M |
| 3300006029|Ga0075466_1190577 | Not Available | 512 | Open in IMG/M |
| 3300006164|Ga0075441_10020679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 2723 | Open in IMG/M |
| 3300006193|Ga0075445_10108116 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300006403|Ga0075514_1029973 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300006403|Ga0075514_1929603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 601 | Open in IMG/M |
| 3300006404|Ga0075515_10992557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 751 | Open in IMG/M |
| 3300006749|Ga0098042_1048162 | All Organisms → Viruses → Predicted Viral | 1162 | Open in IMG/M |
| 3300006752|Ga0098048_1033056 | All Organisms → Viruses → Predicted Viral | 1679 | Open in IMG/M |
| 3300006752|Ga0098048_1068240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 1098 | Open in IMG/M |
| 3300006802|Ga0070749_10194389 | Not Available | 1164 | Open in IMG/M |
| 3300006870|Ga0075479_10149274 | Not Available | 954 | Open in IMG/M |
| 3300006870|Ga0075479_10384039 | Not Available | 543 | Open in IMG/M |
| 3300006902|Ga0066372_10664676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300006916|Ga0070750_10180400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 944 | Open in IMG/M |
| 3300006916|Ga0070750_10429103 | Not Available | 549 | Open in IMG/M |
| 3300006925|Ga0098050_1084410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 817 | Open in IMG/M |
| 3300006947|Ga0075444_10133564 | Not Available | 1054 | Open in IMG/M |
| 3300006990|Ga0098046_1004199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4407 | Open in IMG/M |
| 3300007229|Ga0075468_10018943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2564 | Open in IMG/M |
| 3300007234|Ga0075460_10168178 | Not Available | 757 | Open in IMG/M |
| 3300007236|Ga0075463_10237170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 587 | Open in IMG/M |
| 3300007725|Ga0102951_1038406 | All Organisms → Viruses → Predicted Viral | 1444 | Open in IMG/M |
| 3300007960|Ga0099850_1046292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1866 | Open in IMG/M |
| 3300007960|Ga0099850_1173085 | Not Available | 860 | Open in IMG/M |
| 3300008012|Ga0075480_10058282 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
| 3300008012|Ga0075480_10142467 | Not Available | 1308 | Open in IMG/M |
| 3300008012|Ga0075480_10243269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 933 | Open in IMG/M |
| 3300008996|Ga0102831_1241086 | Not Available | 597 | Open in IMG/M |
| 3300009000|Ga0102960_1205806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 701 | Open in IMG/M |
| 3300009001|Ga0102963_1259709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 686 | Open in IMG/M |
| 3300009077|Ga0115552_1025141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2873 | Open in IMG/M |
| 3300009172|Ga0114995_10072334 | All Organisms → Viruses → Predicted Viral | 1945 | Open in IMG/M |
| 3300009172|Ga0114995_10093243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 1691 | Open in IMG/M |
| 3300009172|Ga0114995_10326444 | Not Available | 844 | Open in IMG/M |
| 3300009173|Ga0114996_10350703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 1142 | Open in IMG/M |
| 3300009173|Ga0114996_10660369 | Not Available | 770 | Open in IMG/M |
| 3300009193|Ga0115551_1447685 | Not Available | 553 | Open in IMG/M |
| 3300009420|Ga0114994_10024102 | All Organisms → Viruses → Predicted Viral | 4271 | Open in IMG/M |
| 3300009420|Ga0114994_10886028 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300009423|Ga0115548_1054940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1402 | Open in IMG/M |
| 3300009425|Ga0114997_10139705 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1441 | Open in IMG/M |
| 3300009426|Ga0115547_1173961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 683 | Open in IMG/M |
| 3300009426|Ga0115547_1178601 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300009433|Ga0115545_1240553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 609 | Open in IMG/M |
| 3300009435|Ga0115546_1057284 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300009437|Ga0115556_1148944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 864 | Open in IMG/M |
| 3300009445|Ga0115553_1248311 | Not Available | 697 | Open in IMG/M |
| 3300009497|Ga0115569_10475001 | Not Available | 531 | Open in IMG/M |
| 3300009512|Ga0115003_10107464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 1713 | Open in IMG/M |
| 3300009512|Ga0115003_10219035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 1140 | Open in IMG/M |
| 3300009705|Ga0115000_10320819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 998 | Open in IMG/M |
| 3300009785|Ga0115001_10991308 | Not Available | 503 | Open in IMG/M |
| 3300009786|Ga0114999_11350057 | Not Available | 504 | Open in IMG/M |
| 3300009790|Ga0115012_10023121 | All Organisms → Viruses → Predicted Viral | 3942 | Open in IMG/M |
| 3300009790|Ga0115012_10532030 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300010318|Ga0136656_1008463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3736 | Open in IMG/M |
| 3300010368|Ga0129324_10050566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1903 | Open in IMG/M |
| 3300010368|Ga0129324_10251365 | Not Available | 705 | Open in IMG/M |
| 3300010883|Ga0133547_10099079 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 6485 | Open in IMG/M |
| 3300010883|Ga0133547_11400140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1320 | Open in IMG/M |
| 3300011253|Ga0151671_1055520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 744 | Open in IMG/M |
| 3300012928|Ga0163110_10002080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10268 | Open in IMG/M |
| 3300012936|Ga0163109_10009720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7147 | Open in IMG/M |
| 3300012936|Ga0163109_10571490 | Not Available | 828 | Open in IMG/M |
| 3300012953|Ga0163179_10595122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 927 | Open in IMG/M |
| 3300012954|Ga0163111_12470443 | Not Available | 529 | Open in IMG/M |
| 3300012969|Ga0129332_1137569 | Not Available | 789 | Open in IMG/M |
| 3300016745|Ga0182093_1741312 | Not Available | 3504 | Open in IMG/M |
| 3300016747|Ga0182078_10466843 | Not Available | 1001 | Open in IMG/M |
| 3300016747|Ga0182078_10967694 | Not Available | 709 | Open in IMG/M |
| 3300016797|Ga0182090_1020646 | Not Available | 1285 | Open in IMG/M |
| 3300016797|Ga0182090_1709160 | Not Available | 931 | Open in IMG/M |
| 3300017697|Ga0180120_10061881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1671 | Open in IMG/M |
| 3300017697|Ga0180120_10155297 | Not Available | 968 | Open in IMG/M |
| 3300017727|Ga0181401_1123189 | Not Available | 646 | Open in IMG/M |
| 3300017728|Ga0181419_1050643 | Not Available | 1084 | Open in IMG/M |
| 3300017733|Ga0181426_1060392 | Not Available | 752 | Open in IMG/M |
| 3300017737|Ga0187218_1008284 | All Organisms → Viruses → Predicted Viral | 2848 | Open in IMG/M |
| 3300017737|Ga0187218_1017156 | All Organisms → Viruses → Predicted Viral | 1910 | Open in IMG/M |
| 3300017744|Ga0181397_1078026 | Not Available | 886 | Open in IMG/M |
| 3300017744|Ga0181397_1123386 | Not Available | 672 | Open in IMG/M |
| 3300017745|Ga0181427_1172592 | Not Available | 521 | Open in IMG/M |
| 3300017746|Ga0181389_1087401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 869 | Open in IMG/M |
| 3300017758|Ga0181409_1143721 | Not Available | 699 | Open in IMG/M |
| 3300017769|Ga0187221_1167948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300017770|Ga0187217_1122392 | Not Available | 878 | Open in IMG/M |
| 3300017781|Ga0181423_1212898 | Not Available | 729 | Open in IMG/M |
| 3300017818|Ga0181565_10877596 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300017824|Ga0181552_10146240 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
| 3300017949|Ga0181584_10112389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1854 | Open in IMG/M |
| 3300017949|Ga0181584_10453412 | Not Available | 795 | Open in IMG/M |
| 3300017950|Ga0181607_10172743 | Not Available | 1292 | Open in IMG/M |
| 3300017951|Ga0181577_10048654 | All Organisms → Viruses → Predicted Viral | 3023 | Open in IMG/M |
| 3300017952|Ga0181583_10825361 | Not Available | 544 | Open in IMG/M |
| 3300017956|Ga0181580_10031105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 4125 | Open in IMG/M |
| 3300017964|Ga0181589_10045603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3303 | Open in IMG/M |
| 3300017964|Ga0181589_10053654 | Not Available | 3012 | Open in IMG/M |
| 3300017964|Ga0181589_10274908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 1144 | Open in IMG/M |
| 3300017967|Ga0181590_10141507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1848 | Open in IMG/M |
| 3300017967|Ga0181590_10439777 | Not Available | 919 | Open in IMG/M |
| 3300017968|Ga0181587_10095935 | Not Available | 2137 | Open in IMG/M |
| 3300017969|Ga0181585_10038604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 3790 | Open in IMG/M |
| 3300017969|Ga0181585_10128779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1871 | Open in IMG/M |
| 3300018036|Ga0181600_10397405 | Not Available | 670 | Open in IMG/M |
| 3300018039|Ga0181579_10665776 | Not Available | 533 | Open in IMG/M |
| 3300018410|Ga0181561_10414117 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300018417|Ga0181558_10672642 | Not Available | 528 | Open in IMG/M |
| 3300018423|Ga0181593_10203235 | Not Available | 1561 | Open in IMG/M |
| 3300018423|Ga0181593_10363623 | Not Available | 1089 | Open in IMG/M |
| 3300018423|Ga0181593_10928406 | Not Available | 601 | Open in IMG/M |
| 3300018423|Ga0181593_11029388 | Not Available | 564 | Open in IMG/M |
| 3300018428|Ga0181568_10056680 | All Organisms → Viruses → Predicted Viral | 3319 | Open in IMG/M |
| 3300018428|Ga0181568_10098781 | All Organisms → Viruses → Predicted Viral | 2455 | Open in IMG/M |
| 3300018876|Ga0181564_10728948 | Not Available | 521 | Open in IMG/M |
| 3300019267|Ga0182069_1203405 | Not Available | 525 | Open in IMG/M |
| 3300019280|Ga0182068_1731702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 817 | Open in IMG/M |
| 3300019459|Ga0181562_10313049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 778 | Open in IMG/M |
| 3300020053|Ga0181595_10047888 | All Organisms → Viruses → Predicted Viral | 2371 | Open in IMG/M |
| 3300020054|Ga0181594_10428455 | Not Available | 555 | Open in IMG/M |
| 3300020169|Ga0206127_1031011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3071 | Open in IMG/M |
| 3300020178|Ga0181599_1073656 | Not Available | 1612 | Open in IMG/M |
| 3300020178|Ga0181599_1119404 | Not Available | 1156 | Open in IMG/M |
| 3300020189|Ga0181578_10071507 | Not Available | 2066 | Open in IMG/M |
| 3300020194|Ga0181597_10080884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1869 | Open in IMG/M |
| 3300020336|Ga0211510_1022036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 1669 | Open in IMG/M |
| 3300020377|Ga0211647_10128247 | Not Available | 853 | Open in IMG/M |
| 3300020381|Ga0211476_10130533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 922 | Open in IMG/M |
| 3300020404|Ga0211659_10458971 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300020421|Ga0211653_10114400 | Not Available | 1197 | Open in IMG/M |
| 3300020430|Ga0211622_10243108 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300020430|Ga0211622_10512231 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300020438|Ga0211576_10145618 | Not Available | 1284 | Open in IMG/M |
| 3300020438|Ga0211576_10169920 | Not Available | 1172 | Open in IMG/M |
| 3300020440|Ga0211518_10336290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 707 | Open in IMG/M |
| 3300020451|Ga0211473_10384496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 718 | Open in IMG/M |
| 3300020463|Ga0211676_10055898 | Not Available | 2772 | Open in IMG/M |
| 3300020463|Ga0211676_10098168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1935 | Open in IMG/M |
| 3300020469|Ga0211577_10125125 | Not Available | 1756 | Open in IMG/M |
| 3300020469|Ga0211577_10331489 | Not Available | 956 | Open in IMG/M |
| 3300020595|Ga0206126_10462938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 550 | Open in IMG/M |
| 3300021087|Ga0206683_10548478 | Not Available | 564 | Open in IMG/M |
| 3300021365|Ga0206123_10244642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 781 | Open in IMG/M |
| 3300021375|Ga0213869_10265430 | Not Available | 745 | Open in IMG/M |
| 3300021389|Ga0213868_10075951 | All Organisms → Viruses → Predicted Viral | 2231 | Open in IMG/M |
| 3300021957|Ga0222717_10611353 | Not Available | 570 | Open in IMG/M |
| 3300021958|Ga0222718_10243327 | Not Available | 959 | Open in IMG/M |
| 3300021958|Ga0222718_10436433 | Not Available | 646 | Open in IMG/M |
| 3300021958|Ga0222718_10575122 | Not Available | 532 | Open in IMG/M |
| 3300021959|Ga0222716_10109003 | All Organisms → Viruses → Predicted Viral | 1860 | Open in IMG/M |
| 3300021959|Ga0222716_10111671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1833 | Open in IMG/M |
| 3300021960|Ga0222715_10528091 | Not Available | 622 | Open in IMG/M |
| 3300021964|Ga0222719_10033963 | Not Available | 3985 | Open in IMG/M |
| 3300022822|Ga0222646_107379 | All Organisms → Viruses → Predicted Viral | 1662 | Open in IMG/M |
| 3300022837|Ga0222711_1006333 | All Organisms → Viruses → Predicted Viral | 2145 | Open in IMG/M |
| 3300022851|Ga0222691_1014418 | Not Available | 1366 | Open in IMG/M |
| 3300022867|Ga0222629_1057743 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300022905|Ga0255756_1250034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → unclassified Halobacteriovoraceae → Halobacteriovoraceae bacterium | 598 | Open in IMG/M |
| 3300022928|Ga0255758_10144734 | Not Available | 1179 | Open in IMG/M |
| 3300022929|Ga0255752_10216543 | Not Available | 880 | Open in IMG/M |
| 3300022935|Ga0255780_10073926 | Not Available | 2100 | Open in IMG/M |
| 3300022935|Ga0255780_10350653 | Not Available | 676 | Open in IMG/M |
| 3300023087|Ga0255774_10254418 | Not Available | 871 | Open in IMG/M |
| 3300023105|Ga0255782_10160221 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1144 | Open in IMG/M |
| 3300023119|Ga0255762_10386511 | Not Available | 694 | Open in IMG/M |
| 3300023172|Ga0255766_10329016 | Not Available | 766 | Open in IMG/M |
| 3300023175|Ga0255777_10141091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1505 | Open in IMG/M |
| 3300023175|Ga0255777_10671476 | Not Available | 501 | Open in IMG/M |
| 3300023178|Ga0255759_10626043 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 608 | Open in IMG/M |
| 3300023180|Ga0255768_10078280 | Not Available | 2296 | Open in IMG/M |
| 3300023245|Ga0222655_1052340 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300023296|Ga0222664_1021750 | Not Available | 1301 | Open in IMG/M |
| 3300023296|Ga0222664_1037958 | Not Available | 860 | Open in IMG/M |
| 3300025120|Ga0209535_1018752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 3568 | Open in IMG/M |
| 3300025120|Ga0209535_1127272 | Not Available | 852 | Open in IMG/M |
| 3300025132|Ga0209232_1183137 | Not Available | 649 | Open in IMG/M |
| 3300025132|Ga0209232_1244711 | Not Available | 521 | Open in IMG/M |
| 3300025151|Ga0209645_1148277 | Not Available | 725 | Open in IMG/M |
| 3300025168|Ga0209337_1298481 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300025653|Ga0208428_1008130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 3762 | Open in IMG/M |
| 3300025680|Ga0209306_1138613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 697 | Open in IMG/M |
| 3300025687|Ga0208019_1013711 | All Organisms → Viruses → Predicted Viral | 3357 | Open in IMG/M |
| 3300025687|Ga0208019_1034926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED41 | 1842 | Open in IMG/M |
| 3300025687|Ga0208019_1045357 | All Organisms → Viruses → Predicted Viral | 1548 | Open in IMG/M |
| 3300025759|Ga0208899_1137936 | Not Available | 852 | Open in IMG/M |
| 3300025759|Ga0208899_1224035 | Not Available | 579 | Open in IMG/M |
| 3300025806|Ga0208545_1113286 | Not Available | 691 | Open in IMG/M |
| 3300025816|Ga0209193_1084648 | Not Available | 812 | Open in IMG/M |
| 3300025876|Ga0209223_10204984 | Not Available | 960 | Open in IMG/M |
| 3300025886|Ga0209632_10239547 | Not Available | 934 | Open in IMG/M |
| 3300027687|Ga0209710_1017759 | All Organisms → Viruses → Predicted Viral | 3800 | Open in IMG/M |
| 3300027704|Ga0209816_1015566 | Not Available | 4219 | Open in IMG/M |
| 3300027704|Ga0209816_1173625 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300027752|Ga0209192_10010557 | Not Available | 5069 | Open in IMG/M |
| 3300027752|Ga0209192_10169106 | Not Available | 852 | Open in IMG/M |
| 3300027779|Ga0209709_10116573 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1367 | Open in IMG/M |
| 3300027779|Ga0209709_10433895 | Not Available | 508 | Open in IMG/M |
| 3300027788|Ga0209711_10025676 | All Organisms → Viruses → Predicted Viral | 3563 | Open in IMG/M |
| 3300027788|Ga0209711_10116007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 1331 | Open in IMG/M |
| 3300027788|Ga0209711_10336721 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027813|Ga0209090_10077145 | All Organisms → Viruses → Predicted Viral | 1830 | Open in IMG/M |
| 3300027813|Ga0209090_10440635 | Not Available | 619 | Open in IMG/M |
| 3300027844|Ga0209501_10325100 | Not Available | 936 | Open in IMG/M |
| 3300027847|Ga0209402_10084133 | All Organisms → Viruses → Predicted Viral | 2226 | Open in IMG/M |
| 3300028008|Ga0228674_1231998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 581 | Open in IMG/M |
| 3300029318|Ga0185543_1077411 | Not Available | 669 | Open in IMG/M |
| 3300029318|Ga0185543_1106037 | Not Available | 537 | Open in IMG/M |
| 3300031519|Ga0307488_10037531 | All Organisms → Viruses → Predicted Viral | 3828 | Open in IMG/M |
| 3300031598|Ga0308019_10120639 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300031621|Ga0302114_10235150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 750 | Open in IMG/M |
| 3300031622|Ga0302126_10004012 | Not Available | 8056 | Open in IMG/M |
| 3300031623|Ga0302123_10357489 | Not Available | 687 | Open in IMG/M |
| 3300031625|Ga0302135_10286727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 676 | Open in IMG/M |
| 3300031675|Ga0302122_10281247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 593 | Open in IMG/M |
| 3300031676|Ga0302136_1192825 | Not Available | 605 | Open in IMG/M |
| 3300031702|Ga0307998_1177832 | Not Available | 732 | Open in IMG/M |
| 3300031774|Ga0315331_10700710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 715 | Open in IMG/M |
| 3300032088|Ga0315321_10353790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales | 923 | Open in IMG/M |
| 3300032088|Ga0315321_10645681 | Not Available | 621 | Open in IMG/M |
| 3300032151|Ga0302127_10316247 | Not Available | 627 | Open in IMG/M |
| 3300032277|Ga0316202_10458482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 598 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 23.61% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.89% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.73% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.44% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.58% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.15% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.43% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 3.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.15% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.15% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.72% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.72% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.29% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.29% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.86% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.86% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.86% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.43% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.43% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.43% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.43% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.43% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.43% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.43% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.43% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.43% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000256 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - ample_F_10_SI03_120 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300003619 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005433 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006404 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300012969 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016745 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041411BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016797 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019267 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071402VT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019280 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020054 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020336 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022822 | Saline water microbial communities from Ace Lake, Antarctica - #293 | Environmental | Open in IMG/M |
| 3300022837 | Saline water microbial communities from Ace Lake, Antarctica - #1699 | Environmental | Open in IMG/M |
| 3300022851 | Saline water microbial communities from Ace Lake, Antarctica - #1237 | Environmental | Open in IMG/M |
| 3300022867 | Saline water microbial communities from Ace Lake, Antarctica - #1 | Environmental | Open in IMG/M |
| 3300022905 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300022935 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG | Environmental | Open in IMG/M |
| 3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300023245 | Saline water microbial communities from Ace Lake, Antarctica - #423 | Environmental | Open in IMG/M |
| 3300023296 | Saline water microbial communities from Ace Lake, Antarctica - #604 | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031623 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_32.1 | Environmental | Open in IMG/M |
| 3300031625 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surface | Environmental | Open in IMG/M |
| 3300031675 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCM | Environmental | Open in IMG/M |
| 3300031676 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20m | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032151 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_SCM | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LP_F_10_SI03_120DRAFT_10156743 | 3300000256 | Marine | MFFLPGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGEDE* |
| JGI11705J14877_100052151 | 3300001419 | Saline Water And Sediment | PIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQTIEGDEE* |
| JGI24003J15210_100087524 | 3300001460 | Marine | MFIIPGYVLGLQFTKLGFIINLLWFDLVFYGWVRAKQIIEGDDE* |
| JGI24003J15210_101454972 | 3300001460 | Marine | MFFIPGYFLGLQFTKLGFIINWLWFDLVFYGWFKAKQVIGDDE* |
| JGI26380J51729_101414021 | 3300003619 | Marine | FFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE* |
| Ga0055584_1009432463 | 3300004097 | Pelagic Marine | TMWLAMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAIEGDEE* |
| Ga0055584_1014068771 | 3300004097 | Pelagic Marine | MFWLVMFFIPGYFLGLHFTKLGFIINWLWFDIVFYGWYRAKQM |
| Ga0055584_1025173141 | 3300004097 | Pelagic Marine | FLPGYLLGLQFTKLGFIINWIWFDLVFYGWYRAKQMIGDDE* |
| Ga0066830_100097343 | 3300005433 | Marine | MFFIPGYFLGLQFTKLGFIINWLWFDLVFYGWYRAKQMIGDDE* |
| Ga0074648_10510831 | 3300005512 | Saline Water And Sediment | AMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQTMEGDDK* |
| Ga0008649_100435355 | 3300005838 | Marine | MFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE* |
| Ga0075108_100435944 | 3300005913 | Saline Lake | GLQFTKFGFIINLLWYDLIFYGWVRVKQKLGDDE* |
| Ga0075466_11905771 | 3300006029 | Aqueous | GLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE* |
| Ga0075441_100206791 | 3300006164 | Marine | MLVVMFILPTYLFGLQFTKFGFVVNLLWYDLIFYGWVRVKQRLGEDE* |
| Ga0075445_101081163 | 3300006193 | Marine | PQYLFGLQFTKLGFIMNLLWYDLIFYGWVRVKQQLGDDE* |
| Ga0075514_10299733 | 3300006403 | Aqueous | MFFLPGYILGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE* |
| Ga0075514_19296031 | 3300006403 | Aqueous | VRSYFFTMWLAMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE* |
| Ga0075515_109925571 | 3300006404 | Aqueous | FGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE* |
| Ga0098042_10481623 | 3300006749 | Marine | LFTFWLVMFFLPGYLLGLHFTKLGFIINWIWFDLVFYGWVRAKQTLGEDE* |
| Ga0098048_10330562 | 3300006752 | Marine | MFFLPGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE* |
| Ga0098048_10682402 | 3300006752 | Marine | MFFLPGYLLGLHFTKLGFIINWLWFDLVFYGWYRAKQIIGDDE* |
| Ga0070749_101943893 | 3300006802 | Aqueous | ILGLHFTKLGFIINMIWFDLVFYGWVRAKQMIGDDE* |
| Ga0075479_101492741 | 3300006870 | Aqueous | GLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDKE* |
| Ga0075479_103840393 | 3300006870 | Aqueous | FGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEQ* |
| Ga0066372_106646761 | 3300006902 | Marine | LVMFVIPTFIFGLQFTRLGFIINLIWYDLIFYGWVRVKQRLEGDDE* |
| Ga0070750_101804003 | 3300006916 | Aqueous | LPTYMLGLQFTKLGFIINWIWFDLVFYGWVRAKQMIGDDE* |
| Ga0070750_104291033 | 3300006916 | Aqueous | LGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE* |
| Ga0098050_10844102 | 3300006925 | Marine | MFFIPGYFLGLQFTKLGFIINWLWFDLVFYGWVRAKQMIEGDDE* |
| Ga0075444_101335643 | 3300006947 | Marine | GLQFTKFGFVVNLLWYDLIFYGWVRVKQRLGEDE* |
| Ga0098046_10041996 | 3300006990 | Marine | MFFIPGYFLGLQFTKLGFIINWLWFDLVFYGWYRAKQIIGDDE* |
| Ga0075468_100189434 | 3300007229 | Aqueous | MFFIPGYFLGLQFTKLGFIMNWLWFDLVFYGWFKAKQMIGDDE* |
| Ga0075460_101681781 | 3300007234 | Aqueous | IPMYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAIEGDE* |
| Ga0075463_102371702 | 3300007236 | Aqueous | MFFLPGYILGLHFTKLGFIINWLWFDIVFYGWYRAKQ |
| Ga0102951_10384063 | 3300007725 | Water | MFFLPGYILGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE* |
| Ga0099850_10462924 | 3300007960 | Aqueous | IIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE* |
| Ga0099850_11730851 | 3300007960 | Aqueous | IIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEQ* |
| Ga0075480_100582821 | 3300008012 | Aqueous | PIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQTMEGDEE* |
| Ga0075480_101424672 | 3300008012 | Aqueous | MFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE* |
| Ga0075480_102432693 | 3300008012 | Aqueous | VMFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQIIGDDE* |
| Ga0102831_12410861 | 3300008996 | Estuarine | WFVMFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE* |
| Ga0102960_12058061 | 3300009000 | Pond Water | MFFLPGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQML |
| Ga0102963_12597091 | 3300009001 | Pond Water | YILGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE* |
| Ga0115552_10251414 | 3300009077 | Pelagic Marine | MFFLPGYILGLHFTKLGFIINWLWFDLVFYGWFRAKQMIGDDE* |
| Ga0114995_100723341 | 3300009172 | Marine | LVTMLVVMFILPTYLLGLQFTKFGFVVNLLWYDLIFYGWVKVKQKLGEDE* |
| Ga0114995_100932434 | 3300009172 | Marine | FLPGYVLGLQFTKLGFVINLLWYDLIFYGWVRVKQQLGDDE* |
| Ga0114995_103264444 | 3300009172 | Marine | WLVLFILPTYLFGLQFTKFGFIINLLWYDLIFYGWVRVKQKLGDDE* |
| Ga0114996_103507033 | 3300009173 | Marine | MFVIPGYLLGMHFTKFGFVVNLLWYDLIFYGWVRVKQQLGDDK* |
| Ga0114996_106603692 | 3300009173 | Marine | MFVLPGYIFGLHFTKFGFIINLLWYDLVFYGWVRVKQQIGDDE* |
| Ga0115551_14476853 | 3300009193 | Pelagic Marine | RYLFTFWFVMFFLPGYILGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE* |
| Ga0114994_100241023 | 3300009420 | Marine | MFIIPGYVLGLQFTKLGFIMNLLWFDLVFYGWVRAKQIVEGDDE* |
| Ga0114994_108860281 | 3300009420 | Marine | MLVVMFILPTYLFGLQFTKLGFIINLLWYDLIFYGWVKVKQKLGDDE* |
| Ga0115548_10549406 | 3300009423 | Pelagic Marine | LGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGEDE* |
| Ga0114997_101397054 | 3300009425 | Marine | YLVTMLVVMFILPTYLLGLQFTKFGFVVNLLWYDLIFYGWVKVKQKLGEDE* |
| Ga0115547_11739612 | 3300009426 | Pelagic Marine | MFFLPGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE* |
| Ga0115547_11786011 | 3300009426 | Pelagic Marine | LFTFWLVMFFLPGYLLGLHFTKLGFIINWLWFDLVFYGWYRAKQMLGDDE* |
| Ga0115545_12405532 | 3300009433 | Pelagic Marine | MFFLPGYVLGLHFTKLGFIINWLWFDLVFYGWYRAKQMIGDDE* |
| Ga0115546_10572846 | 3300009435 | Pelagic Marine | LFTFWFVMFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE* |
| Ga0115556_11489441 | 3300009437 | Pelagic Marine | MFFLPGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLG |
| Ga0115553_12483113 | 3300009445 | Pelagic Marine | RRYLFTFWVVMFFIPGYFLGLQFTKLGFIINWLWFDLVFYGWFRAKQMIEGDDE* |
| Ga0115569_104750011 | 3300009497 | Pelagic Marine | IRRYLFTFWLVMFFLPGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE* |
| Ga0115003_101074644 | 3300009512 | Marine | LVVMFILPTYLFGLQFTKFGFVLNLLWYDLIFYGWVKVKQQIGDDE* |
| Ga0115003_102190353 | 3300009512 | Marine | VMFILPTYLLGLQFTKLGFVINLLWYDLIFYGWVRVKQQLGDDE* |
| Ga0115000_103208193 | 3300009705 | Marine | MFVIPGYLLGMHFTKFGFVVNLLWYDLIFYGWVRVKQQLGDDE* |
| Ga0115001_109913081 | 3300009785 | Marine | LPTYLFGLQFTKFGFIINLLWYDLIFYGWVRVKQQLGDDE* |
| Ga0114999_113500573 | 3300009786 | Marine | YLFGLQFTKFGLILNLLWYDLIFYGWVMAKQKLGDDE* |
| Ga0115012_100231213 | 3300009790 | Marine | MFFIPGFFLGLQFTKLGFIINWLWFDLVFYGWFRAKQMIGDDK* |
| Ga0115012_105320302 | 3300009790 | Marine | MFFMPGFIFGLQLTKLGFIINWLWFDLVFYGWLKAKQIVGGDE* |
| Ga0136656_10084638 | 3300010318 | Freshwater To Marine Saline Gradient | IPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEQ* |
| Ga0129324_100505664 | 3300010368 | Freshwater To Marine Saline Gradient | FIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE* |
| Ga0129324_102513651 | 3300010368 | Freshwater To Marine Saline Gradient | IIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDDE* |
| Ga0133547_100990791 | 3300010883 | Marine | RRYLFTLWLVMFVLPGYVFGLQFTKFGFIINLLWYDLIFYGWVRVKQQLGDDE* |
| Ga0133547_114001401 | 3300010883 | Marine | LFGLQFTKFGFIINLLWYDLIFYGWVRVKQKLGDDE* |
| Ga0151671_10555201 | 3300011253 | Marine | MFFLPGYFLGLHFTKLGFIMNWLWFDLVFYGWFRAKQLLGDD |
| Ga0163110_100020808 | 3300012928 | Surface Seawater | MFGLQFTKLGFIINWLWFDLIFYGWVRAKQMIGDDE* |
| Ga0163109_100097203 | 3300012936 | Surface Seawater | MFFMPGFIFGLQLTKLGFIINWIWFDLVFYGWVRARQMIGDDE* |
| Ga0163109_105714901 | 3300012936 | Surface Seawater | GLQFTKLGFIINWLWFDLVFYGWFRAKQMIGDDE* |
| Ga0163179_105951223 | 3300012953 | Seawater | MTFFLVMFFLPGYILGLQFTKLGFIINWLWLDLVFYGWFRAKQTLGDDE* |
| Ga0163111_124704433 | 3300012954 | Surface Seawater | WLVMFFIPGFFLGLQFTKLGFIINWLWFDLVFYGWFRAKQMIGDDK* |
| Ga0129332_11375691 | 3300012969 | Aqueous | LFTFWLVMFFIPGYFLGLQFTKLGFIINWLWFDLVFYGWFRAKQMLGDDK* |
| Ga0182093_17413121 | 3300016745 | Salt Marsh | RSYFFTMWLAMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE |
| Ga0182078_104668431 | 3300016747 | Salt Marsh | IFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEQ |
| Ga0182078_109676943 | 3300016747 | Salt Marsh | AMFIIPMYIFGLHFTKLGFIINLLWYDLVFYGWVRFKQMIEGDEQ |
| Ga0182090_10206461 | 3300016797 | Salt Marsh | LFTFWFVMFFLPGYILGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE |
| Ga0182090_17091604 | 3300016797 | Salt Marsh | VLGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE |
| Ga0180120_100618813 | 3300017697 | Freshwater To Marine Saline Gradient | FTMWLAMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE |
| Ga0180120_101552973 | 3300017697 | Freshwater To Marine Saline Gradient | VMFFLPGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0181401_11231891 | 3300017727 | Seawater | MFFLPGYILGLQFTKLGFIINWLWFDIVFYGWYRAKQMLGEDE |
| Ga0181419_10506433 | 3300017728 | Seawater | GYLLGLHFTKLGFITNWLWFDLVFYGWVRAKQTLGDDE |
| Ga0181426_10603923 | 3300017733 | Seawater | YVLTFWLVMFFIPGFLFGLHFTKLGFIINWLWFDLVFYGWFKAKQTLGDDE |
| Ga0187218_10082849 | 3300017737 | Seawater | GYLLGLHFTKLGFIINWLWFDLVFYGWVRAKQMLGDDE |
| Ga0187218_10171562 | 3300017737 | Seawater | MFFMPGFIFGLQLTKLGFIINWIWFDLVFYGWVRAKQMIGDDE |
| Ga0181397_10780263 | 3300017744 | Seawater | FGLQLTKLGFIINWIWFDLVFYGWVRAKQMIGDDE |
| Ga0181397_11233863 | 3300017744 | Seawater | FFLPGYLLGLHFTKLGFITNWLWFDLVFYGWVRAKQTLGDDE |
| Ga0181427_11725921 | 3300017745 | Seawater | KRILGLHFTKLGFIINWLWFDLVFYGWFKAKQTLGDDE |
| Ga0181389_10874012 | 3300017746 | Seawater | MFFLPGYLLGLHFTKLGFIINWLWFDLVFYGWYRAKQMLGDDE |
| Ga0181409_11437213 | 3300017758 | Seawater | LGLQFTKLGFIINWLWFDLVFYGWYRAKQIIGDDE |
| Ga0187221_11679481 | 3300017769 | Seawater | PGYFLGLQFTKLGFIINWLWFDLVFYGWFKAKQMIGDDE |
| Ga0187217_11223921 | 3300017770 | Seawater | ITFWVVMFFLPGYILGLHFTKLGFIINWLWFDLVFYGWFKAKQTLGDDE |
| Ga0181423_12128983 | 3300017781 | Seawater | FWLVMFFLPGYLLGLHFTKLGFIINWLWFDLVFYGWVRAKQMLGDDE |
| Ga0181565_108775963 | 3300017818 | Salt Marsh | FMFWLVMFFLPTYMLGLQFTKLGFIINWIWFDLVFYGWVRAKQMLGDDE |
| Ga0181552_101462403 | 3300017824 | Salt Marsh | MFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDK |
| Ga0181584_101123891 | 3300017949 | Salt Marsh | FFTMWLAMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQTMEGDEE |
| Ga0181584_104534121 | 3300017949 | Salt Marsh | FGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE |
| Ga0181607_101727433 | 3300017950 | Salt Marsh | MFFLPGYILGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0181577_100486547 | 3300017951 | Salt Marsh | MFWLVMFFLPTYFLGLQFTKLGFIINWIWFDLVFYGWVRAKQILGDDE |
| Ga0181583_108253611 | 3300017952 | Salt Marsh | FFLPTYFLGLQFTKLGFIINWIWFDIVFYGWVRAKQMLGDDE |
| Ga0181580_100311056 | 3300017956 | Salt Marsh | YIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE |
| Ga0181589_100456037 | 3300017964 | Salt Marsh | GLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEQ |
| Ga0181589_100536545 | 3300017964 | Salt Marsh | TMWLAMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQTMEGDEE |
| Ga0181589_102749083 | 3300017964 | Salt Marsh | AMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE |
| Ga0181590_101415071 | 3300017967 | Salt Marsh | MWLAMFIIPMYIFGLNFTKLGLIINLLWYDLVFYGWVRAKQTMEGDEE |
| Ga0181590_104397774 | 3300017967 | Salt Marsh | FWFVMFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQIIGDDE |
| Ga0181587_100959355 | 3300017968 | Salt Marsh | FGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEQ |
| Ga0181585_100386041 | 3300017969 | Salt Marsh | IFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE |
| Ga0181585_101287794 | 3300017969 | Salt Marsh | FTMWLAMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQTMEGDEE |
| Ga0181600_103974053 | 3300018036 | Salt Marsh | VMFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE |
| Ga0181579_106657761 | 3300018039 | Salt Marsh | PIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE |
| Ga0181561_104141171 | 3300018410 | Salt Marsh | LFTFWFVMFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0181558_106726422 | 3300018417 | Salt Marsh | FTFWFVMFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRTKQMLGDDE |
| Ga0181593_102032353 | 3300018423 | Salt Marsh | RRYIFMFWLVMFFLPTYFLGLQFTKLGFIINWIWFDLVFYGWVMAKQMLGDDE |
| Ga0181593_103636231 | 3300018423 | Salt Marsh | RSYFFTMWLAMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQTMEGDEE |
| Ga0181593_109284061 | 3300018423 | Salt Marsh | MFFLPGYVLGLHFTKLGFIINWLWFDLVFYGWVRAKQMIEGDDE |
| Ga0181593_110293881 | 3300018423 | Salt Marsh | MYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAIEGDEE |
| Ga0181568_100566801 | 3300018428 | Salt Marsh | TFWLVMFFLPGYLLGLHFTKLGFIINWIWFDLVFYGWVRAKQTLGEDE |
| Ga0181568_100987817 | 3300018428 | Salt Marsh | FWLVMFFLPTYMLGLQFTKLGFIINWIWFDLVFYGWVRAKQMIGDDE |
| Ga0181564_107289483 | 3300018876 | Salt Marsh | VMFFLPTYFLGLQFTKLGFIINWLWFDLVFYGWVKAKQMIGDDE |
| Ga0182069_12034051 | 3300019267 | Salt Marsh | WLVMFFIPTYFLGLQFTKLGFIINWIWFDLVFYGWVRAKQMIEGDEE |
| Ga0182068_17317023 | 3300019280 | Salt Marsh | WFVMFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE |
| Ga0181562_103130493 | 3300019459 | Salt Marsh | MFFLPTYMFGLQFTKLGFIINWIWFDLVFYGWVRAKQM |
| Ga0181595_100478886 | 3300020053 | Salt Marsh | MFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0181594_104284553 | 3300020054 | Salt Marsh | IPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE |
| Ga0206127_10310111 | 3300020169 | Seawater | FLGLQFTKLGFIINWLWFDLVFYGWYRAKQMIGDDE |
| Ga0181599_10736563 | 3300020178 | Salt Marsh | VMFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0181599_11194045 | 3300020178 | Salt Marsh | TFWFVMFFLPGYILGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0181578_100715071 | 3300020189 | Salt Marsh | FFTMWLAMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEQ |
| Ga0181597_100808841 | 3300020194 | Salt Marsh | ILGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0211510_10220363 | 3300020336 | Marine | MFFLPGYLLGLQFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0211647_101282473 | 3300020377 | Marine | LWLVMFFMPGFIFGLQLTKLGFIINWIWFDLVFYGWVRARQMIGDDE |
| Ga0211476_101305331 | 3300020381 | Marine | MFFLPTYIFGLQFTKFGFIINWIWFDLVFYGWVRAKQMIGDDK |
| Ga0211659_104589712 | 3300020404 | Marine | MFFIPGYFLGLQFTKLGFIINWLWFDLVFYGWFRAKQMIGDDE |
| Ga0211653_101144001 | 3300020421 | Marine | FFIPGYFLGLQFTKLGFIINWLWFDLVFYGWYRAKQMIGDDE |
| Ga0211622_102431084 | 3300020430 | Marine | TLCLVMFIIPNYLFGLYFTKIGFIINLLWYDMIFYGWVRVKQTLGGDKE |
| Ga0211622_105122312 | 3300020430 | Marine | MPGFIFGLQLTKLGFIINWIWFDLVFYGWVRARQMIGDDE |
| Ga0211576_101456181 | 3300020438 | Marine | YFLGLQFTKLGFIINWLWFDLVFYGWYRAKQIIGDDE |
| Ga0211576_101699202 | 3300020438 | Marine | MFFLPGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGEDE |
| Ga0211518_103362902 | 3300020440 | Marine | MFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE |
| Ga0211473_103844963 | 3300020451 | Marine | MTFFLVMFFLPGYILGLQFTKLGFIINWLWLDLVFYGWFRAKQTLGDDE |
| Ga0211676_100558985 | 3300020463 | Marine | WVVMFFLPGYILGLQFTKLGFIINWLWFDLVFYGWFKAKQTLGDDQ |
| Ga0211676_100981684 | 3300020463 | Marine | WVVMFFLPGYILGLQFTKLGFIINWLWFDLVFYGWFRAKQTLGDDQ |
| Ga0211577_101251251 | 3300020469 | Marine | PGYLLGLHFTKLGFITNWLWFDLVFYGWVRAKQTLGDDE |
| Ga0211577_103314894 | 3300020469 | Marine | RYLFTFWLVMFFLPGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDD |
| Ga0206126_104629382 | 3300020595 | Seawater | MFFLPGYILGLHFTKLGFIINWLWFDLVFYGWVRAKQMIGDDE |
| Ga0206683_105484781 | 3300021087 | Seawater | FGLQFTRLGFIINLIWYDLIFYGWVRVKQRLEGDDE |
| Ga0206123_102446422 | 3300021365 | Seawater | MFFIPGYFLGLQFTKLGFIMNWLWFDLVFYGWFKAKQMIGDDE |
| Ga0213869_102654301 | 3300021375 | Seawater | LGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0213868_100759511 | 3300021389 | Seawater | PGYIFGLHFTKLGFIINWIWFDIVFYGWYRAKQIIGEDK |
| Ga0222717_106113533 | 3300021957 | Estuarine Water | PGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0222718_102433271 | 3300021958 | Estuarine Water | SYFFTMWLAMFIIPMYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDDK |
| Ga0222718_104364331 | 3300021958 | Estuarine Water | MFFLPGYILGLHFTKLGFIINWLWFDIVFYGWYRAKQMIEGDDE |
| Ga0222718_105751223 | 3300021958 | Estuarine Water | VMFFIPVYFLGLQFTKLGFIINWLWFDIVFYGWFRAKQMIGDDE |
| Ga0222716_101090035 | 3300021959 | Estuarine Water | MFFLPGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE |
| Ga0222716_101116713 | 3300021959 | Estuarine Water | RYLFTFWLVMFFLPGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0222715_105280911 | 3300021960 | Estuarine Water | MFFLPGYLLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0222719_100339632 | 3300021964 | Estuarine Water | MFFLPGYLLGLHFTKLGFIINWLWFDLVFYGWVRAKQMLGDDE |
| Ga0222646_1073795 | 3300022822 | Saline Water | PTYLFGLQFTKFGFIINLLWYDLIFYGWVRVKQKLGDDE |
| Ga0222711_10063334 | 3300022837 | Saline Water | WLVLFILPGYVLGLQFTKFGFIINLLWYDLIFYGWVRVKQKLGDDE |
| Ga0222691_10144181 | 3300022851 | Saline Water | LGLQFTKFGFVINLLWYDLIFYGWVRVKQQLGDDE |
| Ga0222629_10577433 | 3300022867 | Saline Water | LFTLWVVMFFLPGYVLGLQFTKFGFIINLLWYDLIFYGWVRVKQQLGDDE |
| Ga0255756_12500343 | 3300022905 | Salt Marsh | TFWFVMFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDK |
| Ga0255758_101447343 | 3300022928 | Salt Marsh | IFMFWLVMFFLPTFFLGLQFTKLGFIINWLWFDLVFYGWVRAKQMIGDD |
| Ga0255752_102165433 | 3300022929 | Salt Marsh | LWLVMFVIPPYLLGIDFTKLGFVVNLLWYDLVFYGWVKVKQQLEGDDK |
| Ga0255780_100739261 | 3300022935 | Salt Marsh | LAMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQTMEGDEE |
| Ga0255780_103506533 | 3300022935 | Salt Marsh | IFGLHFTKLGFIINLLWYDLVFYGWVRAKQTMEGDEE |
| Ga0255774_102544181 | 3300023087 | Salt Marsh | PGYILGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0255782_101602213 | 3300023105 | Salt Marsh | MFFLPGYLLGLHFTKLGFIINWIWFDLVFYGWVRAKQTLGEDE |
| Ga0255762_103865111 | 3300023119 | Salt Marsh | IFMFWLVMFFLPTYMLGLQFTKLGFIINWIWFDLVFYGWVRAKQMLGDDE |
| Ga0255766_103290161 | 3300023172 | Salt Marsh | FGLHFTKLGFIINLLWYDLVFYGWVRAKQLMEGDEQ |
| Ga0255777_101410913 | 3300023175 | Salt Marsh | RRYLFTFWFVMFFLPGYILGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE |
| Ga0255777_106714761 | 3300023175 | Salt Marsh | RRYLFTFWFVMFFLPGYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDK |
| Ga0255759_102426294 | 3300023178 | Salt Marsh | LFGIQFTKMGFILNLLWYDLIFYGWYRVKKQIEGD |
| Ga0255759_106260431 | 3300023178 | Salt Marsh | YMLGLQFTKLGFIINWIWFDLVFYGWVRAKQMIGDDE |
| Ga0255768_100782801 | 3300023180 | Salt Marsh | VRSYFFTMWLAMFIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQTMEGDEE |
| Ga0222655_10523403 | 3300023245 | Saline Water | YLFTLWLVLFILPGYVLGLQFTKFGFIINLLWYDLIFYGWVRVKQKLGDDE |
| Ga0222664_10217504 | 3300023296 | Saline Water | FLPGYVLGLQFTKFGFIINLLWYDLIFYGWVRVKQQLGDDK |
| Ga0222664_10379581 | 3300023296 | Saline Water | LPTYLFGLQFTKFGFIINLLWYDLIFYGWVRVKQKLGDDE |
| Ga0209535_10187523 | 3300025120 | Marine | MWLVMLILPGYVLGLQFTKLGFIINLLWFDLVFYGWVKVKQQIEGDDE |
| Ga0209535_11272721 | 3300025120 | Marine | VTMLVVMFIIPTYLLGLQFTKLGFVINLLWYDLIFYGWVRVKQQLGDDK |
| Ga0209232_11831372 | 3300025132 | Marine | MFFIPGYFLGLQFTKLGFIINWLWFDLVFYGWFRAKQIIGDDE |
| Ga0209232_12447111 | 3300025132 | Marine | FFIPGYFLGLQFTKLGFIINWLWFDLVFYGWFRAKQTIGDDK |
| Ga0209645_11482773 | 3300025151 | Marine | RRYLVMFWLVMFFIPGYFLGLQFTKLGFIINWLWFDLVFYGWYRAKQMIGDDK |
| Ga0209337_12984813 | 3300025168 | Marine | FVIPGYLFGLHFTKLGFIINLLWYDVVFYGWVRVKQTLGDDE |
| Ga0208428_10081306 | 3300025653 | Aqueous | GYILGLHFTKLGFIINWLWFDIVFYGWYRAKQMIGDDE |
| Ga0209306_11386132 | 3300025680 | Pelagic Marine | MFFLPGYILGLHFTKLGFIINWLWFDLVFYGWFRAKQMIGDDE |
| Ga0208019_10137118 | 3300025687 | Aqueous | FIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE |
| Ga0208019_10349264 | 3300025687 | Aqueous | MYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEE |
| Ga0208019_10453571 | 3300025687 | Aqueous | FIIPIYIFGLHFTKLGFIINLLWYDLVFYGWVRAKQAMEGDEQ |
| Ga0208899_11379361 | 3300025759 | Aqueous | YILGLHFTKLGFIINWLRFDIVFYGWYRAKQMIGDDE |
| Ga0208899_12240351 | 3300025759 | Aqueous | FGLHFTKLGFIINLLWYDLVFYGWVRAKQAIEGDE |
| Ga0208545_11132864 | 3300025806 | Aqueous | GYVLGLHFTKLGFIINWLWFDIVFYGWYRAKQMLGDDE |
| Ga0209193_10846484 | 3300025816 | Pelagic Marine | YLFTFWIVMFFIPGYFLGLQFTKLGFIINWLWFDLVFYGWFRAKQMIEGDDE |
| Ga0209223_102049843 | 3300025876 | Pelagic Marine | FFLPGYVLGLQFTKFGFIINLLWYDLIFYGWVRVKQQLGDDE |
| Ga0209632_102395474 | 3300025886 | Pelagic Marine | TFWLVMFFIPGYFLGLQFTKLGFIINWLWFDLVFYGWFRAKQMIGDDE |
| Ga0209710_10177599 | 3300027687 | Marine | RYLVTMLVVMFILPTYLLGLQFTKFGFVVNLLWYDLIFYGWVKVKQKLGEDE |
| Ga0209816_10155661 | 3300027704 | Marine | LFGLQFTKFGFVVNLLWYDLIFYGWVRVKQRLGEDE |
| Ga0209816_11736253 | 3300027704 | Marine | MFVLPGYVFGLQFTKFGFIINLLWYDLIFYGWVMAKQKLGDDE |
| Ga0209192_1001055711 | 3300027752 | Marine | LVTMLVVMFILPTYLLGLQFTKFGFVVNLLWYDLIFYGWVKVKQKLGEDE |
| Ga0209192_101691061 | 3300027752 | Marine | LWLVLFILPTYLFGLQFTKFGFIINLLWYDLIFYGWVRVKQQLGDDE |
| Ga0209709_101165731 | 3300027779 | Marine | YLVTMLVVMFILPTYLLGLQFTKFGFVVNLLWYDLIFYGWVKVKQKLGEDE |
| Ga0209709_104338952 | 3300027779 | Marine | MFVIPGYLLGMHFTKFGFVVNLLWYDLIFYGWVRVKQQLGDDE |
| Ga0209711_100256761 | 3300027788 | Marine | TMLVVMFILPTYLLGLQFTKFGFVVNLLWYDLIFYGWVKVKQKLGEDE |
| Ga0209711_101160073 | 3300027788 | Marine | LVVMFILPTYLFGLQFTKFGFVLNLLWYDLIFYGWVKVKQQIGDDE |
| Ga0209711_103367213 | 3300027788 | Marine | YLFTLWLVMFVLPGYVFGLQFTKFGFIINLLWYDLIFYGWFRIKQQLGDDE |
| Ga0209090_100771451 | 3300027813 | Marine | LPGYVFGLQFTKFGFIINLLWYDLIFYGWVRVKQQLGDDE |
| Ga0209090_104406353 | 3300027813 | Marine | VTMLVVMFILPTYLLGLQFTKFGFVVNLLWYDLIFYGWVKVKQKLGEDE |
| Ga0209501_103251002 | 3300027844 | Marine | MFVLPGYIFGLHFTKFGFIINLLWYDLVFYGWVRVKQQIGDDE |
| Ga0209402_100841335 | 3300027847 | Marine | YLFGLQFTKFGFIMNLLWYDLIFYGWVRVKQQLGDDE |
| Ga0228674_12319982 | 3300028008 | Seawater | MFFLPGYLLGLHFTKLGFIINWLWFDLVFYGWVRAKQMIEGDDE |
| Ga0185543_10774111 | 3300029318 | Marine | LVMFFLPTYMFGLQFTKLGFIINWLWFDLVFYGWVRAKQTLGDDK |
| Ga0185543_11060373 | 3300029318 | Marine | LQFTKLGFIMNWIWFDIVFYGWVRAKQTLGGDDESNNME |
| Ga0307488_100375319 | 3300031519 | Sackhole Brine | TYLFGLQFTKFGLIINLLWYDLIFYGWVRVKQKLGDDE |
| Ga0308019_101206391 | 3300031598 | Marine | PTYLFGLQFTKFGFVVNLLWYDLIFYGWVRVKQRLGEDE |
| Ga0302114_102351501 | 3300031621 | Marine | LVMFILPTYLLGLQFTKLGFVINLLWYDLIFYGWVRVKQQLGDDE |
| Ga0302126_100040121 | 3300031622 | Marine | FILPTYLFGLQFTKFGLIINLLWYDLIFYGWVSVKQKLGDDE |
| Ga0302123_103574893 | 3300031623 | Marine | LFGMQFTKLGFVINLLWYDLIFYGWVRVKQQIGDDE |
| Ga0302135_102867271 | 3300031625 | Marine | LFGIQFTKIGFVINLLWYDLIFYGWVRVKQQLGDD |
| Ga0302122_102812471 | 3300031675 | Marine | LPTYLFGLQFTKFGFVLNLLWYDLIFYGWVKVKQQIGDDE |
| Ga0302136_11928253 | 3300031676 | Marine | FVLPGYVLGLQFTKFGFIINLLWYDLIFYGWVSVKQKLGDDE |
| Ga0307998_11778321 | 3300031702 | Marine | FTLWLVLFILPTYLFGLQFTKFGFIINLLWYDLIFYGWVRVKQQLGDDE |
| Ga0315331_107007102 | 3300031774 | Seawater | MFFLPGYILGLHFTKLGFIINWLWFDLVFYGWFKAKQTLGDDE |
| Ga0315321_103537902 | 3300032088 | Seawater | MFFIPGYFLGLQFTKLGFIINWLWFDLVFYGWFRAKQMIEGDEE |
| Ga0315321_106456813 | 3300032088 | Seawater | YILGLQFTKLGFIINWLWLDLVFYGWFRAKQTLGDDE |
| Ga0302127_103162471 | 3300032151 | Marine | MFVLPGYVFGLQFTKFGFIINLLWYDLIFYGWFRIKQQLGDDE |
| Ga0316202_104584822 | 3300032277 | Microbial Mat | MFFLPGYILGLHFTKLGFIINWLWFDIVFYGWYRAKQIIGDDE |
| ⦗Top⦘ |