| Basic Information | |
|---|---|
| Family ID | F018791 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 233 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MPARNDALKDRLSRYREINISVTGRKSGRTISIPVWFVL |
| Number of Associated Samples | 194 |
| Number of Associated Scaffolds | 233 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.14 % |
| % of genes near scaffold ends (potentially truncated) | 97.85 % |
| % of genes from short scaffolds (< 2000 bps) | 87.55 % |
| Associated GOLD sequencing projects | 182 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.974 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.893 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.639 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.91% β-sheet: 20.90% Coil/Unstructured: 61.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 233 Family Scaffolds |
|---|---|---|
| PF00248 | Aldo_ket_red | 27.04 |
| PF07883 | Cupin_2 | 12.88 |
| PF02627 | CMD | 7.30 |
| PF05163 | DinB | 3.86 |
| PF13924 | Lipocalin_5 | 3.86 |
| PF01361 | Tautomerase | 1.29 |
| PF08240 | ADH_N | 1.29 |
| PF00291 | PALP | 1.29 |
| PF12833 | HTH_18 | 0.86 |
| PF00490 | ALAD | 0.86 |
| PF01934 | HepT-like | 0.86 |
| PF02738 | MoCoBD_1 | 0.86 |
| PF02517 | Rce1-like | 0.86 |
| PF00107 | ADH_zinc_N | 0.86 |
| PF04075 | F420H2_quin_red | 0.86 |
| PF13561 | adh_short_C2 | 0.86 |
| PF07859 | Abhydrolase_3 | 0.86 |
| PF04365 | BrnT_toxin | 0.86 |
| PF00106 | adh_short | 0.86 |
| PF02311 | AraC_binding | 0.43 |
| PF13517 | FG-GAP_3 | 0.43 |
| PF03372 | Exo_endo_phos | 0.43 |
| PF03331 | LpxC | 0.43 |
| PF07731 | Cu-oxidase_2 | 0.43 |
| PF00158 | Sigma54_activat | 0.43 |
| PF08002 | DUF1697 | 0.43 |
| PF07676 | PD40 | 0.43 |
| PF04126 | Cyclophil_like | 0.43 |
| PF12893 | Lumazine_bd_2 | 0.43 |
| PF07690 | MFS_1 | 0.43 |
| PF00254 | FKBP_C | 0.43 |
| PF02416 | TatA_B_E | 0.43 |
| PF11199 | DUF2891 | 0.43 |
| PF03807 | F420_oxidored | 0.43 |
| PF01676 | Metalloenzyme | 0.43 |
| PF00903 | Glyoxalase | 0.43 |
| PF02604 | PhdYeFM_antitox | 0.43 |
| PF00582 | Usp | 0.43 |
| PF04255 | DUF433 | 0.43 |
| PF01081 | Aldolase | 0.43 |
| PF14833 | NAD_binding_11 | 0.43 |
| PF01177 | Asp_Glu_race | 0.43 |
| PF03551 | PadR | 0.43 |
| PF07694 | 5TM-5TMR_LYT | 0.43 |
| PF02566 | OsmC | 0.43 |
| PF03576 | Peptidase_S58 | 0.43 |
| PF13602 | ADH_zinc_N_2 | 0.43 |
| PF15919 | HicB_lk_antitox | 0.43 |
| PF00027 | cNMP_binding | 0.43 |
| PF12796 | Ank_2 | 0.43 |
| PF02900 | LigB | 0.43 |
| PF02974 | Inh | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 233 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 7.30 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 7.30 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.86 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.29 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.86 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 0.86 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.86 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 0.86 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 0.86 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.86 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.86 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.43 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.43 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.43 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.43 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.43 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.43 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.43 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.43 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.43 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.43 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.43 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.43 |
| COG0800 | 2-keto-3-deoxy-6-phosphogluconate aldolase | Carbohydrate transport and metabolism [G] | 0.43 |
| COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.40 % |
| Unclassified | root | N/A | 17.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0496264 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300000567|JGI12270J11330_10029242 | All Organisms → cellular organisms → Bacteria | 3254 | Open in IMG/M |
| 3300001131|JGI12631J13338_1012473 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300002911|JGI25390J43892_10097715 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10456910 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300004091|Ga0062387_100088213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1630 | Open in IMG/M |
| 3300005178|Ga0066688_10279861 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300005332|Ga0066388_105415464 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005332|Ga0066388_106675576 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005339|Ga0070660_101879168 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005355|Ga0070671_100071957 | All Organisms → cellular organisms → Bacteria | 2886 | Open in IMG/M |
| 3300005434|Ga0070709_10580097 | Not Available | 861 | Open in IMG/M |
| 3300005437|Ga0070710_10004844 | All Organisms → cellular organisms → Bacteria | 6365 | Open in IMG/M |
| 3300005529|Ga0070741_11340316 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005529|Ga0070741_11354192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300005538|Ga0070731_10387395 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300005541|Ga0070733_10155947 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300005542|Ga0070732_10369776 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005556|Ga0066707_11020641 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005557|Ga0066704_10879434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora olivasterospora | 555 | Open in IMG/M |
| 3300005575|Ga0066702_10165821 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300005576|Ga0066708_10271773 | Not Available | 1081 | Open in IMG/M |
| 3300005598|Ga0066706_10154371 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
| 3300005598|Ga0066706_10259904 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300005610|Ga0070763_10018648 | All Organisms → cellular organisms → Bacteria | 3024 | Open in IMG/M |
| 3300005712|Ga0070764_10351583 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300005712|Ga0070764_10608971 | Not Available | 667 | Open in IMG/M |
| 3300005895|Ga0075277_1059971 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005993|Ga0080027_10111122 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300005994|Ga0066789_10304759 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300006028|Ga0070717_10034619 | All Organisms → cellular organisms → Bacteria | 4084 | Open in IMG/M |
| 3300006028|Ga0070717_10750610 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300006046|Ga0066652_100486025 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300006046|Ga0066652_101195564 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300006173|Ga0070716_100112488 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300006796|Ga0066665_11509493 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006854|Ga0075425_101750514 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300006872|Ga0101947_1051586 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300006954|Ga0079219_10646793 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300007076|Ga0075435_100614226 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300007258|Ga0099793_10442335 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 642 | Open in IMG/M |
| 3300007258|Ga0099793_10527135 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300007788|Ga0099795_10595120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009038|Ga0099829_10179484 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300009038|Ga0099829_11642617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300009089|Ga0099828_10716918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300009089|Ga0099828_10985939 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300009090|Ga0099827_11469155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300009143|Ga0099792_10496405 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300009545|Ga0105237_11011453 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300009639|Ga0116122_1069413 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300009643|Ga0116110_1209288 | Not Available | 631 | Open in IMG/M |
| 3300009665|Ga0116135_1130842 | Not Available | 927 | Open in IMG/M |
| 3300009700|Ga0116217_10062620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2641 | Open in IMG/M |
| 3300010048|Ga0126373_10241602 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300010048|Ga0126373_10419936 | Not Available | 1366 | Open in IMG/M |
| 3300010341|Ga0074045_10654420 | Not Available | 668 | Open in IMG/M |
| 3300010358|Ga0126370_10521277 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300010359|Ga0126376_11087300 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300010359|Ga0126376_11889685 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300010360|Ga0126372_10738668 | Not Available | 966 | Open in IMG/M |
| 3300010360|Ga0126372_11100365 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300010361|Ga0126378_10176954 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
| 3300010376|Ga0126381_103902235 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010396|Ga0134126_10222763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2245 | Open in IMG/M |
| 3300010937|Ga0137776_1629953 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300011270|Ga0137391_11426776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300012189|Ga0137388_11700881 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300012198|Ga0137364_10292244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1209 | Open in IMG/M |
| 3300012199|Ga0137383_10710897 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300012202|Ga0137363_10271204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1385 | Open in IMG/M |
| 3300012205|Ga0137362_10432549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
| 3300012205|Ga0137362_10436880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
| 3300012212|Ga0150985_103733935 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012285|Ga0137370_11041895 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012354|Ga0137366_10046070 | All Organisms → cellular organisms → Bacteria | 3358 | Open in IMG/M |
| 3300012359|Ga0137385_11655069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012361|Ga0137360_10205250 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300012363|Ga0137390_11495312 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300012582|Ga0137358_10861218 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012917|Ga0137395_10438959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
| 3300012917|Ga0137395_10751564 | Not Available | 706 | Open in IMG/M |
| 3300012924|Ga0137413_10735643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300012925|Ga0137419_10926557 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300012927|Ga0137416_10797322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300012927|Ga0137416_11933559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300012960|Ga0164301_11189746 | Not Available | 612 | Open in IMG/M |
| 3300013306|Ga0163162_12057826 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300014164|Ga0181532_10748696 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300014166|Ga0134079_10196941 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300014838|Ga0182030_11459799 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300015053|Ga0137405_1263096 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300015054|Ga0137420_1485362 | Not Available | 1671 | Open in IMG/M |
| 3300016270|Ga0182036_11345806 | Not Available | 597 | Open in IMG/M |
| 3300016341|Ga0182035_11859349 | Not Available | 546 | Open in IMG/M |
| 3300016445|Ga0182038_10877770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300017823|Ga0187818_10171567 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300017925|Ga0187856_1031845 | All Organisms → cellular organisms → Bacteria | 2500 | Open in IMG/M |
| 3300017934|Ga0187803_10450292 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300017936|Ga0187821_10360654 | Not Available | 588 | Open in IMG/M |
| 3300017959|Ga0187779_10008697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5865 | Open in IMG/M |
| 3300017959|Ga0187779_10283335 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300017973|Ga0187780_10349679 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300017974|Ga0187777_10515062 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300018001|Ga0187815_10422290 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300018016|Ga0187880_1287299 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300018030|Ga0187869_10498746 | Not Available | 578 | Open in IMG/M |
| 3300018038|Ga0187855_10215139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1132 | Open in IMG/M |
| 3300018044|Ga0187890_10245944 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300018047|Ga0187859_10759756 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300018057|Ga0187858_10473572 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300018062|Ga0187784_10303231 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300018468|Ga0066662_11757188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300019284|Ga0187797_1272750 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300019789|Ga0137408_1134896 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300019887|Ga0193729_1213397 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300020170|Ga0179594_10365046 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300020579|Ga0210407_10388316 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300020579|Ga0210407_11255406 | Not Available | 555 | Open in IMG/M |
| 3300020580|Ga0210403_11025559 | Not Available | 644 | Open in IMG/M |
| 3300020582|Ga0210395_11189742 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300021086|Ga0179596_10105195 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300021088|Ga0210404_10039307 | All Organisms → cellular organisms → Bacteria | 2170 | Open in IMG/M |
| 3300021171|Ga0210405_10173981 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300021171|Ga0210405_11361417 | Not Available | 518 | Open in IMG/M |
| 3300021178|Ga0210408_10299285 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300021178|Ga0210408_10466174 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300021180|Ga0210396_11460392 | Not Available | 563 | Open in IMG/M |
| 3300021401|Ga0210393_10003086 | All Organisms → cellular organisms → Bacteria | 13467 | Open in IMG/M |
| 3300021401|Ga0210393_10179636 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300021402|Ga0210385_11421896 | Not Available | 530 | Open in IMG/M |
| 3300021404|Ga0210389_11219160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri | 579 | Open in IMG/M |
| 3300021405|Ga0210387_11864773 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300021407|Ga0210383_10009654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8261 | Open in IMG/M |
| 3300021407|Ga0210383_10920963 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300021432|Ga0210384_10160183 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
| 3300021432|Ga0210384_10479951 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300021432|Ga0210384_11900534 | Not Available | 501 | Open in IMG/M |
| 3300021433|Ga0210391_10019312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5496 | Open in IMG/M |
| 3300021474|Ga0210390_11375676 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300021477|Ga0210398_11416165 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300021478|Ga0210402_11484105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300021479|Ga0210410_11203312 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300024295|Ga0224556_1088034 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300024330|Ga0137417_1319095 | All Organisms → cellular organisms → Bacteria | 2339 | Open in IMG/M |
| 3300025612|Ga0208691_1111944 | Not Available | 615 | Open in IMG/M |
| 3300025906|Ga0207699_11272149 | Not Available | 544 | Open in IMG/M |
| 3300025911|Ga0207654_10339242 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300025928|Ga0207700_10216571 | Not Available | 1621 | Open in IMG/M |
| 3300025928|Ga0207700_10892518 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300025929|Ga0207664_11716353 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300025931|Ga0207644_11047324 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300025988|Ga0208141_1020184 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300026035|Ga0207703_10578995 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300026310|Ga0209239_1234549 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300026361|Ga0257176_1035263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae | 764 | Open in IMG/M |
| 3300026514|Ga0257168_1150994 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300026537|Ga0209157_1030911 | All Organisms → cellular organisms → Bacteria | 3100 | Open in IMG/M |
| 3300026547|Ga0209156_10051107 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
| 3300026547|Ga0209156_10205136 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300027050|Ga0209325_1025303 | Not Available | 702 | Open in IMG/M |
| 3300027063|Ga0207762_1056486 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300027069|Ga0208859_1008999 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300027587|Ga0209220_1009116 | All Organisms → cellular organisms → Bacteria | 2652 | Open in IMG/M |
| 3300027635|Ga0209625_1068519 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300027643|Ga0209076_1015004 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300027648|Ga0209420_1085313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300027660|Ga0209736_1195313 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027667|Ga0209009_1027602 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300027678|Ga0209011_1130704 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300027768|Ga0209772_10019405 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
| 3300027787|Ga0209074_10425146 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300027825|Ga0209039_10117063 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300027846|Ga0209180_10156333 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300027846|Ga0209180_10293419 | Not Available | 932 | Open in IMG/M |
| 3300027879|Ga0209169_10493228 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300028536|Ga0137415_10030477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5311 | Open in IMG/M |
| 3300028536|Ga0137415_10334190 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300028536|Ga0137415_10551069 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300028762|Ga0302202_10074678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2041 | Open in IMG/M |
| 3300028780|Ga0302225_10183659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300028866|Ga0302278_10302950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 741 | Open in IMG/M |
| 3300028877|Ga0302235_10379507 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300028906|Ga0308309_11105606 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300029636|Ga0222749_10584887 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300029943|Ga0311340_10697858 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300029951|Ga0311371_12675075 | Not Available | 501 | Open in IMG/M |
| 3300029990|Ga0311336_11747218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300030007|Ga0311338_10268034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1908 | Open in IMG/M |
| 3300030007|Ga0311338_11721228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300030057|Ga0302176_10350525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300030294|Ga0311349_10043274 | All Organisms → cellular organisms → Bacteria | 4113 | Open in IMG/M |
| 3300030294|Ga0311349_10787078 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300030494|Ga0310037_10375605 | Not Available | 593 | Open in IMG/M |
| 3300031057|Ga0170834_103230485 | Not Available | 613 | Open in IMG/M |
| 3300031250|Ga0265331_10286191 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300031446|Ga0170820_13492685 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031525|Ga0302326_13593246 | Not Available | 513 | Open in IMG/M |
| 3300031680|Ga0318574_10613747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300031715|Ga0307476_10109488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1957 | Open in IMG/M |
| 3300031726|Ga0302321_103365931 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031753|Ga0307477_10808194 | Not Available | 623 | Open in IMG/M |
| 3300031754|Ga0307475_10108044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2179 | Open in IMG/M |
| 3300031754|Ga0307475_10203135 | Not Available | 1584 | Open in IMG/M |
| 3300031754|Ga0307475_10661711 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300031763|Ga0318537_10124315 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300031820|Ga0307473_10146523 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300031823|Ga0307478_10002892 | All Organisms → cellular organisms → Bacteria | 13174 | Open in IMG/M |
| 3300031902|Ga0302322_102439379 | Not Available | 644 | Open in IMG/M |
| 3300031941|Ga0310912_10259937 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300031942|Ga0310916_11071794 | Not Available | 670 | Open in IMG/M |
| 3300031954|Ga0306926_10938556 | Not Available | 1034 | Open in IMG/M |
| 3300031962|Ga0307479_11919961 | Not Available | 542 | Open in IMG/M |
| 3300031962|Ga0307479_12006091 | Not Available | 527 | Open in IMG/M |
| 3300032001|Ga0306922_11941427 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 575 | Open in IMG/M |
| 3300032174|Ga0307470_10414935 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300032205|Ga0307472_102539769 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300032783|Ga0335079_11609775 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300032783|Ga0335079_12135460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Paracidobacterium → Paracidobacterium acidisoli | 536 | Open in IMG/M |
| 3300032805|Ga0335078_10079346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4783 | Open in IMG/M |
| 3300032805|Ga0335078_10402051 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300032805|Ga0335078_10532870 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300032805|Ga0335078_12042271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Paracidobacterium → Paracidobacterium acidisoli | 612 | Open in IMG/M |
| 3300032828|Ga0335080_11433820 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300032828|Ga0335080_12028925 | Not Available | 556 | Open in IMG/M |
| 3300032828|Ga0335080_12353963 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300032829|Ga0335070_10769833 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300032893|Ga0335069_10211482 | All Organisms → cellular organisms → Bacteria | 2356 | Open in IMG/M |
| 3300032895|Ga0335074_10761492 | Not Available | 914 | Open in IMG/M |
| 3300033134|Ga0335073_10130727 | All Organisms → cellular organisms → Bacteria | 3205 | Open in IMG/M |
| 3300033808|Ga0314867_079819 | Not Available | 760 | Open in IMG/M |
| 3300034065|Ga0334827_043031 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300034090|Ga0326723_0509951 | Not Available | 553 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.01% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.43% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.15% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.15% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.15% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.15% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.86% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.86% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.86% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.43% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.43% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.43% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.43% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.43% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.43% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.43% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.43% |
| Drinking Water Pipes | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006872 | Biofilm microbial communities from drinking water pipes in Singapore | Engineered | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025988 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_04962641 | 2228664022 | Soil | MPAHSDTLKEKLARHREIKISVTGRKSGRTISNPVWFVVEGDTLD |
| JGI12270J11330_100292428 | 3300000567 | Peatlands Soil | VPTSKDTVKDRLARYREIKISVIGRKSGRTISIPVWFVLEGD |
| JGI12631J13338_10124733 | 3300001131 | Forest Soil | MSNKPAHKDTLKSRLSRSREIHISVTGRKSGRKISIPVWF |
| JGI25390J43892_100977152 | 3300002911 | Grasslands Soil | MPARNDALKDRLSRYREIQISVTGRNSGRTISIPVWFVLEGDQL |
| JGIcombinedJ51221_104569101 | 3300003505 | Forest Soil | MPKQNDTLKSRLARSREIHISVIGRKSGRTISIPVWFVFED |
| Ga0062387_1000882134 | 3300004091 | Bog Forest Soil | MSNKPTRNDALKDHLSRYREIKITLTGRKSGRSISIPVWFVFEDPT |
| Ga0066688_102798611 | 3300005178 | Soil | MPAQNDALKDLLSRNRQISVTVTGRRSGRTISNPVWFVLD |
| Ga0066388_1054154641 | 3300005332 | Tropical Forest Soil | MPARDDSLRNRLSQSSEITITVTGRKSGRSISNPVWFALDDKD |
| Ga0066388_1066755762 | 3300005332 | Tropical Forest Soil | MATQNTALKDGLSRSSEITITVTGRKSGRAISNPIWFVFEDG |
| Ga0070660_1018791682 | 3300005339 | Corn Rhizosphere | MPAHSDTLKNRLSRSREINIRVTGRKSGRAFSIPVWFIADDE |
| Ga0070671_1000719573 | 3300005355 | Switchgrass Rhizosphere | MPARNDALKDRLSQDSEITITVTGRKSGRSVSIPVWFVLDQDT |
| Ga0070709_105800972 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPARNDALKDGLSQDSEITITVTGRKSGRSVSIPVWFVLD |
| Ga0070710_100048446 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAQNDSLKDKLARYREIEISVTGRKSGRIISNPVWFVWEDER |
| Ga0070741_113403161 | 3300005529 | Surface Soil | MATTNESLNDRLSRYNEIHITVMGRKSGHAITNPVWFVFED |
| Ga0070741_113541922 | 3300005529 | Surface Soil | MATRDISLKDALSRASEIRISVIGRKSGRTISNPVWFAAD |
| Ga0070731_103873952 | 3300005538 | Surface Soil | MPAQKSPLKERLAKNNEITISVTGRRSGRTISIPVWFVAEGEKLYLLP |
| Ga0070733_101559471 | 3300005541 | Surface Soil | MSNKPKQNDALRDRLSRYREINISVIGRKSGRTISNPVWFVLDED |
| Ga0070732_103697761 | 3300005542 | Surface Soil | MPTQNDSLAERLSRYREIKITVTGRKSGRAISIPVWFVFEDGKL |
| Ga0066707_110206411 | 3300005556 | Soil | MPARNDALKDRLSRSREIKISVTGRKSGRTISIPVWFVLEGDTL |
| Ga0066704_108794341 | 3300005557 | Soil | MPARNEALKDRLSRYREINISVTGRKSGRSISIPVWFVLEDD |
| Ga0066702_101658212 | 3300005575 | Soil | VKENELKARLSRYHQIKLSVTGRKSGRMISMPVWFVLE |
| Ga0066708_102717731 | 3300005576 | Soil | MPTQTEELKDRLTRTDEIEISVVGRKTGRRISNPVWFV |
| Ga0066706_101543711 | 3300005598 | Soil | MPARNDALKDRLSRYREINISVTGRKSGRAISRPVWF |
| Ga0066706_102599041 | 3300005598 | Soil | MPAKNALQDRLSRYQQITITVTGRKSGRAISNPIW |
| Ga0070763_100186481 | 3300005610 | Soil | MSNKPAHKDTLKSRLSRSREIHISVTGRKSGRKISIPVWFV |
| Ga0070764_103515831 | 3300005712 | Soil | MPAKNNSLTDRLSRSREINLSVTGRKSGRTITIPVWFILEDAKL |
| Ga0070764_106089712 | 3300005712 | Soil | MPPHNNTLKDRLSRHREIDITVIGRKSGRSISIPVWF |
| Ga0075277_10599711 | 3300005895 | Rice Paddy Soil | MPAQNHALKDRLSTSSEIKITVTGRKSGRPISIQIWFV |
| Ga0080027_101111221 | 3300005993 | Prmafrost Soil | MAAQKGDLKDRLAVFEIDLSVTGRKSGRTISQPVWFV |
| Ga0066789_103047592 | 3300005994 | Soil | MPTHKNDLKDRLSRYREITITVTGRKSGRSISIPIWF |
| Ga0070717_100346197 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAQKGDLKDRLSRYREIELSVTGRKSGRTISQPVWFVWDEDKL |
| Ga0070717_107506103 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTANDALSDRFSRFSEIKITVTGRKSGRAISIPIWFVFEDDKLQLL |
| Ga0066652_1004860251 | 3300006046 | Soil | MPARNDALKHSLSTSSEITINVTGRKSGRTISNPVWFVFED |
| Ga0066652_1011955642 | 3300006046 | Soil | MPAQNHALKDLLSSSSEIKITVTGRKSGRPISIPIWFVFHV |
| Ga0070716_1001124881 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAPKDILKDRLSRYREINLSVTGRKSGRTISQPV |
| Ga0066665_115094931 | 3300006796 | Soil | MPAGNDALKDRLSRYRGIKITVTGRNSGRAISIPV |
| Ga0075425_1017505141 | 3300006854 | Populus Rhizosphere | MPVQIDTLKERLSQNDEITISVTGRKSGRTISNPVWFVL |
| Ga0101947_10515861 | 3300006872 | Drinking Water Pipes | MSNHPAQKDALKERLSQYREITISVIGRKSGRTISNPIWFV |
| Ga0079219_106467933 | 3300006954 | Agricultural Soil | MPTRKDALKDRLSRYREIHITVIGRKSGRTVTIPVWF |
| Ga0075435_1006142262 | 3300007076 | Populus Rhizosphere | MPAHSHTLKSRLSRSREINIRVTGRKSGRAFSIPVWFVA |
| Ga0099793_104423351 | 3300007258 | Vadose Zone Soil | MPARNDTLKDRLSRFREIKISVTGRNSGRTISIPVWFVLE |
| Ga0099793_105271351 | 3300007258 | Vadose Zone Soil | MPARNDDLKDRLSRYREINITVTGRKSGRAISIPVWFVLEDDT |
| Ga0099795_105951201 | 3300007788 | Vadose Zone Soil | MSNKPTRNDDVKNRLSRSREINITVTGRKSGRPISIPV |
| Ga0099829_101794841 | 3300009038 | Vadose Zone Soil | MPARNDVLKDRLPRYREINISVTGRKSGRTISIPVWFVLEDD |
| Ga0099829_116426172 | 3300009038 | Vadose Zone Soil | MPARNDTLKDRLSRFREIKISVTGRNSGRTISIPVWFVLEGEK |
| Ga0099828_107169181 | 3300009089 | Vadose Zone Soil | MPARNDALKDRLSRYREIKISVIGRNSGRTISIPVWFVLEDEK |
| Ga0099828_109859393 | 3300009089 | Vadose Zone Soil | MPTRNDALKDRLSRYREVNITVTGRKSGRTISIPVWFALEDDK |
| Ga0099827_114691552 | 3300009090 | Vadose Zone Soil | MQKRKLGVSKDDALKDRLSRSREINISVTGRKSGRTVSIPVWFVFEKENL |
| Ga0099792_104964052 | 3300009143 | Vadose Zone Soil | MPARNDALKDRLSRYREINISVTGRKSGRTISIPVWF |
| Ga0105237_110114531 | 3300009545 | Corn Rhizosphere | MPAPKDILKDRLSRYREINLSVTGRKSGRTISQPVWFVWDD |
| Ga0116122_10694133 | 3300009639 | Peatland | MPTPQDDLKARLTRYREINITVVGRKSGKTISIPVWFVLEGEKL |
| Ga0116110_12092882 | 3300009643 | Peatland | MPTRNDALKDRLSRYREINITVTGRKSGRTISIPVWFVLED |
| Ga0116135_11308423 | 3300009665 | Peatland | MSKKPTSRKPARNDALRERLARSREINISVMGRKSGRSI |
| Ga0116217_100626201 | 3300009700 | Peatlands Soil | VHTPAQRDVVKERLSRYREIKIMVTGRKSGSVISIPIWLVLEG |
| Ga0126373_102416021 | 3300010048 | Tropical Forest Soil | MPAQKDALKDRLSRSREINITVTGRKSGRAISIPVWFVL |
| Ga0126373_104199361 | 3300010048 | Tropical Forest Soil | VKNSELKDRLARYRQIKLSVRGRKSGRTISIPVWFVLEDEK |
| Ga0074045_106544201 | 3300010341 | Bog Forest Soil | MPTRKDSLFDRLSRASEINITVTGRKSGRKISIPVWF |
| Ga0126370_105212771 | 3300010358 | Tropical Forest Soil | MPAQNDALRELLSKSSELNITVTGRKSGRTISLPI |
| Ga0126376_110873002 | 3300010359 | Tropical Forest Soil | MPAKHDSLTDRLSRYNQITISVTGRKSGQTSSRPVWFVL |
| Ga0126376_118896853 | 3300010359 | Tropical Forest Soil | MEVNMPAQIETLKERLSHNDEITISVTGRKSGPTIS |
| Ga0126372_107386682 | 3300010360 | Tropical Forest Soil | MPVGNNVFKDRLSRSHEITISVVGRKSGRSISNPVWFVWDE |
| Ga0126372_111003652 | 3300010360 | Tropical Forest Soil | MAARNDALKDRLSRYREITITVTGRKSGRTISIPVWFVFDDKL |
| Ga0126378_101769544 | 3300010361 | Tropical Forest Soil | MPSPNDSLKSHLSRSDEITINVIGRKSGRTISNPVWFVLEGD |
| Ga0126381_1039022351 | 3300010376 | Tropical Forest Soil | MASQSDALKDHLARYREIIITVTGRKSGRDISNPV |
| Ga0134126_102227633 | 3300010396 | Terrestrial Soil | MASGNDSLKSALSRANEIHISVTGRKSGKTISNPVWFASDEDKL |
| Ga0137776_16299531 | 3300010937 | Sediment | MEVAMPVQIDTLKERLSQNDEITISVTGRKSGRTISNPVWFVL |
| Ga0137391_114267761 | 3300011270 | Vadose Zone Soil | MPKRNDALKDRLSRNREINITVTGRKSGRTISIPVW |
| Ga0137388_117008811 | 3300012189 | Vadose Zone Soil | MPKRNDALKDRLSRNREINITVTGRKSGRTISIPVWFVLE |
| Ga0137364_102922441 | 3300012198 | Vadose Zone Soil | MPAGNDALKDRLSRYRGIKITVTGRNSGRAISIPVW |
| Ga0137383_107108971 | 3300012199 | Vadose Zone Soil | MPARNDALKSRLSRYREIKIKVTGRNSGRVVSIPV |
| Ga0137363_102712043 | 3300012202 | Vadose Zone Soil | MPARNDALKDRLSRYREINISVTGRKSGRTISIPVWFVLE |
| Ga0137362_104325491 | 3300012205 | Vadose Zone Soil | MAARNDALKDRLSRYREINITVTGRKSGRAISIPVW |
| Ga0137362_104368801 | 3300012205 | Vadose Zone Soil | MSSKPTRNDDLKNRLSRSREINITVTGRKSGRPISIPVWFV |
| Ga0150985_1037339351 | 3300012212 | Avena Fatua Rhizosphere | MAAQDHALKDRLSTSREIKITVTGRKSGRPTSIPIWFVFHVDTIYL |
| Ga0137370_110418952 | 3300012285 | Vadose Zone Soil | MPARNDDLKDRLSRYREINITVTGRKSGRTISIPVWFVVEDDT |
| Ga0137366_100460701 | 3300012354 | Vadose Zone Soil | MPARSDALTDRLYRYREIEITVIGRKSRRAISIPVW |
| Ga0137385_116550691 | 3300012359 | Vadose Zone Soil | MPARNDALKDHLSRLREIELSVTGRSSGRTISIPVWFVWEGEKLY |
| Ga0137360_102052501 | 3300012361 | Vadose Zone Soil | MSNKPTRSDPLKDRLSRSREVNITVTGRKSGRSISIPVWFVSEDNKL |
| Ga0137390_114953122 | 3300012363 | Vadose Zone Soil | VTAPKGSIKERLSRYREIKLSVTGRKSGQTISIPVWFV |
| Ga0137358_108612181 | 3300012582 | Vadose Zone Soil | MPTRNDTLNDRLSRSREINITVTGRKSGRTISIPVWFVL |
| Ga0137395_104389591 | 3300012917 | Vadose Zone Soil | MSNNQTRNEALRDRLSRYREITITVTGRKSGRTISIPVWFVFE |
| Ga0137395_107515643 | 3300012917 | Vadose Zone Soil | MSTKPKRSDALETRLSRLSEITITVTGRKSGRTISIPVWFALEE |
| Ga0137413_107356431 | 3300012924 | Vadose Zone Soil | MSNKPTRNEALKNRLSRSREINITVTGRKSGRPISIPVWFV |
| Ga0137419_109265572 | 3300012925 | Vadose Zone Soil | MSNKPARNDALRDRLSRSREIDISVIGRKSGRTISNPVWFVLDED |
| Ga0137416_107973222 | 3300012927 | Vadose Zone Soil | MSSKPTRNDDLKDRLSRFREINITVTGRKSGRPISIPVWFALEGD |
| Ga0137416_119335591 | 3300012927 | Vadose Zone Soil | MPAPNDSLKDRLSRYREINLSVTGRKSGRTISQPVWFVYD |
| Ga0164301_111897461 | 3300012960 | Soil | MPARNDALKDGLSQDSEITITVSGRKSGRSVSIPV |
| Ga0163162_120578261 | 3300013306 | Switchgrass Rhizosphere | MTTQNESFKDRLSRYREINLTVTGRKSGRAISNPVWFVFED |
| Ga0181532_107486962 | 3300014164 | Bog | MPKPNDAVRKNLSQSTELNITVTGRRSGRKISIPVWFVLDGDKLY |
| Ga0134079_101969411 | 3300014166 | Grasslands Soil | MPTRNNALQDRLSRYRQINLSVTGRKSGRLISVPVWFVLE |
| Ga0182030_114597991 | 3300014838 | Bog | MSKKPTNDSLKDHLARSSELNITVTGRKSGRAISIPV |
| Ga0137405_12630963 | 3300015053 | Vadose Zone Soil | MPARNDALKDRLSRHREINISVTGRKSGRSISIPVWFVLEDDK |
| Ga0137420_14853622 | 3300015054 | Vadose Zone Soil | MSTKPAHINALKNRLSRSREINITVTGRKSGRPISIPIWFVFEDNSSTSYR* |
| Ga0182036_113458061 | 3300016270 | Soil | VQSSNEGLKERLARYRQIKISVTGRKSGRTISIPVWFVLEG |
| Ga0182035_118593492 | 3300016341 | Soil | VAATSDSLKDRLSRYNEIKITVTGRKSGQPTSRPVWFVFEDPKL |
| Ga0182038_108777701 | 3300016445 | Soil | MPARNDTLKDRLSRRREINITVTGRKSGRAISIPVWFVLED |
| Ga0187818_101715671 | 3300017823 | Freshwater Sediment | MPARKDALTDRLSRYREINISVTGRKSGRTISIPV |
| Ga0187856_10318454 | 3300017925 | Peatland | MAVRNDTLKDRLSRFREIKISVTGRKSGRTISNPV |
| Ga0187803_104502921 | 3300017934 | Freshwater Sediment | MPTRNEVLTARLSRTREINIRVVGRKSGRIISNPVWFVLNEDNLYLLP |
| Ga0187821_103606541 | 3300017936 | Freshwater Sediment | MPARNDSLKDRLSHASEITITVTGRKSGRTISIPV |
| Ga0187779_100086979 | 3300017959 | Tropical Peatland | MPAKDSLKDRLSRYRQITITVTGRKSGRAISIPVWFVMDDKLYLL |
| Ga0187779_102833351 | 3300017959 | Tropical Peatland | MPARNDSLEDRFSRYREIQLSVTGRISGRTISVPVWFIHE |
| Ga0187780_103496793 | 3300017973 | Tropical Peatland | MPARNDSLEDRFSRYREIQLSVTGRISGRTISVPVWFIQE |
| Ga0187777_105150621 | 3300017974 | Tropical Peatland | MPEGNDSLIDRLSRYREINLSVTGRKSGRTISIPVWFVL |
| Ga0187815_104222902 | 3300018001 | Freshwater Sediment | MPARNDALKDRLSRYREINISVTGRKSGRTISIPVWFVL |
| Ga0187880_12872991 | 3300018016 | Peatland | MAKRKDVLEDRLSEDREITITVTGRKSGRTISLPIWFVW |
| Ga0187869_104987462 | 3300018030 | Peatland | MGMSNNQTRNDALKDRLSRYREINITVTGRKSGRAI |
| Ga0187855_102151393 | 3300018038 | Peatland | MAKKNDPLKDHLSRYREIHISVIGRKSGRTISIPVWFVFEDDKLYLV |
| Ga0187890_102459441 | 3300018044 | Peatland | MAKQKDALEGRLAREREITISVTGRKSGHTISLPILFVWD |
| Ga0187859_107597562 | 3300018047 | Peatland | MADAFRDHLSRSQEIKVGVTGRKSGRRISIPVWFVVDDE |
| Ga0187858_104735723 | 3300018057 | Peatland | MAVRNDTLKDRLSRFREIKISVTGRKSGRTISNPVWFVLDGD |
| Ga0187784_103032311 | 3300018062 | Tropical Peatland | MPAQNDPLKDRLSRFREISISVKGRKSGRTITNPVWF |
| Ga0066662_117571881 | 3300018468 | Grasslands Soil | MPAGDDALKDRLSRYRGIKIPVTGRNSGSAISIPFWCVLHLENLYLLQVQVS |
| Ga0187797_12727502 | 3300019284 | Peatland | MPVRSDGLRERLSRYREISITVTGRKSGRPISIPVWFVLE |
| Ga0137408_11348961 | 3300019789 | Vadose Zone Soil | MPARNDDLKTRLSRSREIKISVIGRKSGRTISIPVWFVLE |
| Ga0193729_12133971 | 3300019887 | Soil | MPARNDDLKARLSRSREINITVTGRKSGRAISIPVWFVLE |
| Ga0179594_103650461 | 3300020170 | Vadose Zone Soil | MPTRNDALTARLARSREINISVIGRKSGRTISNPVWFVLDGDK |
| Ga0210407_103883162 | 3300020579 | Soil | MPARNDALKDRLSRYREINITVTGRKSGRTISIPVWFVLE |
| Ga0210407_112554062 | 3300020579 | Soil | MSNKPTRNDSLKDRLSRSREINITVTGRKSGHSIS |
| Ga0210403_110255592 | 3300020580 | Soil | MTGSNDTLKNHLSRSQEINITVTGRKSGKAISNPVWFVLDKDKDED |
| Ga0210395_111897421 | 3300020582 | Soil | MPARDESLKDRLSRYNEIKITVTGRKSGRSISVPVWF |
| Ga0179596_101051951 | 3300021086 | Vadose Zone Soil | MSNKPARSDALRDRLSRSREINISVIGRKSGRTISNPVWFV |
| Ga0210404_100393074 | 3300021088 | Soil | MTSHNEALKERLSRNREIKLSVTGRKSGKTISIPVWFVSEG |
| Ga0210405_101739811 | 3300021171 | Soil | MGNKLTRNDALKDRLSRYREINITVTGRKSGRAISIPVWF |
| Ga0210405_113614172 | 3300021171 | Soil | MSNKPTRNDSLKDRLSRSREITISVTGRKSGRTISIHVWFG |
| Ga0210408_102992851 | 3300021178 | Soil | MTGSNEALRNHLSRSQEINITVTGRKSGKAISNPIWFVLDKD |
| Ga0210408_104661741 | 3300021178 | Soil | MASPNNSLKDRLSRSSEIQITVTGRKSGRAISIPIWFAFDDE |
| Ga0210396_114603921 | 3300021180 | Soil | MTSHNEALKERLSRNREIKLSVTGRKSGKTISIPVWFVSEGD |
| Ga0210393_100030861 | 3300021401 | Soil | MPARNDALKDRLSRYREITISVTGRKSGRIISIPVW |
| Ga0210393_101796364 | 3300021401 | Soil | MSNKPAKGDSLIDRLSRYNEIKITVTGRKSGRAISNPVWFVFEDP |
| Ga0210385_114218961 | 3300021402 | Soil | VATTIEKLKTLLARDREIEISVMGRKSGKKISRPVWFVLDE |
| Ga0210389_112191602 | 3300021404 | Soil | MPGQNQAFKDRLSQVEEIEITVTGRKSGRSISIPVWF |
| Ga0210387_118647731 | 3300021405 | Soil | MAARNDTLKDRLSRYQEINISVTGRKSGRTISIPVWFVLE |
| Ga0210383_100096543 | 3300021407 | Soil | MPAQNDGLKDRLSRYREIKITVTGRKSGRSISIPVWFVFRAR |
| Ga0210383_109209631 | 3300021407 | Soil | MSNKAARKDDIRERLSRSREINISVTGRKSGRTISIPIWFVAD |
| Ga0210384_101601831 | 3300021432 | Soil | MPAQKDVLKDRLSRVREIEISVTGRNSGRTISIPV |
| Ga0210384_104799511 | 3300021432 | Soil | MTSHNEALKERLSRNREIKLSVTGRKSGKTISIPVWFVSE |
| Ga0210384_119005341 | 3300021432 | Soil | MPTRNDALRDRLSRYREITISVTGRTPGRTISNPLWFVLN |
| Ga0210391_100193126 | 3300021433 | Soil | MATRSDSLEDRLSRYREITITVTGRKSGRAISKPVWFV |
| Ga0210390_113756763 | 3300021474 | Soil | MAKRNDDLKDRLSRLSEINISVTGRKSGRTISNPVW |
| Ga0210398_114161651 | 3300021477 | Soil | MPKQNDTLKSRLARSREIHITVIGRKSGRTISIPVWFVFED |
| Ga0210402_114841052 | 3300021478 | Soil | MPARKDALKDRLSRVREIEIRVTGRNSGRTISIPVWFVLEGE |
| Ga0210410_112033121 | 3300021479 | Soil | MPARNDALKDRLSRSREINITVTGRKSGRAISIPVW |
| Ga0224556_10880342 | 3300024295 | Soil | MSKKPTNDSLKDHLARSSELNITVTGRKSGRAISIPVWFASDDAT |
| Ga0137417_13190953 | 3300024330 | Vadose Zone Soil | MRNKPARNDALKDHLSRSREINISVIGRKSGRTISNPVWF |
| Ga0208691_11119442 | 3300025612 | Peatland | MTKKPTHNDKLKETLSGTSEVKITVTGRRSGRTISNPVW |
| Ga0207699_112721492 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSTKDALRDRLSQASEINITVTGRKSGRAIAIPVWFA |
| Ga0207654_103392421 | 3300025911 | Corn Rhizosphere | MPAPKDILKDRLSRYREINLSVTGRKSGRTISQPVWFVWDDDKV |
| Ga0207700_102165711 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRRIDSLKDRLSRYRQINLTVTGRKSGRSITNPVWFVFDDKLYL |
| Ga0207700_108925182 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTNNETFKDRLSKSNEITITVTGRKSGRSISIPVWFVAE |
| Ga0207664_117163532 | 3300025929 | Agricultural Soil | MPRRIDSLKDRLSRYRQINLTVTGRKSGRAITNPVWFVFDD |
| Ga0207644_110473242 | 3300025931 | Switchgrass Rhizosphere | MTTKNESFKDRLSRYREIHLTVTGRKSGRAISNPVWFVF |
| Ga0208141_10201842 | 3300025988 | Rice Paddy Soil | MPTRNDALKTRLSRRREINITVTGRKSGRAISNPV |
| Ga0207703_105789951 | 3300026035 | Switchgrass Rhizosphere | MPAQNYALKNRLSQSSELNLTVTGRKSGRPLTIPVWFVLEDNIL |
| Ga0209239_12345492 | 3300026310 | Grasslands Soil | MPTRNDALKDRLSRSREINITVTGRKSGRSISIPVW |
| Ga0257176_10352631 | 3300026361 | Soil | MPARNDALKDRLSRHPEINIAVTGRKSGRSISIPVWF |
| Ga0257168_11509943 | 3300026514 | Soil | MPARSDALKDGLSRSREINIRVTGRNSGRAISIPVRFVSDDQKLYLLPAY |
| Ga0209157_10309115 | 3300026537 | Soil | MPAQDDALKDRLSRYRQINLSVTGRRSGRTISQPVWF |
| Ga0209156_100511075 | 3300026547 | Soil | MPAQNDALKDRLSRYREINIIVTGRKSGRTISIPV |
| Ga0209156_102051361 | 3300026547 | Soil | VRKDDLRDRLLRFREINIMVTGRKSGRAISIPVWFVLD |
| Ga0209325_10253031 | 3300027050 | Forest Soil | MSARKDALTDRLSRSREITITVTGRKSGRTISIPVWFVWNDDKL |
| Ga0207762_10564861 | 3300027063 | Tropical Forest Soil | MAKANDSLKDRLARYREITINVTGRKSGRTISNPVWFVS |
| Ga0208859_10089993 | 3300027069 | Forest Soil | MSNKPTQNDSLKDRLSRSSEITIGVTGRNSGRTISIPVWFVFED |
| Ga0209220_10091165 | 3300027587 | Forest Soil | MPARNDALKDRLSRYREINITVTGRKSGRAISIPVWFALEDDKL |
| Ga0209625_10685191 | 3300027635 | Forest Soil | MSKKSSSIDVLKNRLSRLNEITITVTGRKSGRPISVPVWFVLEDGK |
| Ga0209076_10150045 | 3300027643 | Vadose Zone Soil | MPARNDTLKDRLSRFREIKISVTGRNSGRTISIPVWFVL |
| Ga0209420_10853131 | 3300027648 | Forest Soil | MSNKRTHNDALKDRLSRYREIKITVTGRKSGRPIS |
| Ga0209736_11953131 | 3300027660 | Forest Soil | VTAPTGSTKERLSRYREIKLRVTGRKSGKTISIPVWFVLDGDK |
| Ga0209009_10276021 | 3300027667 | Forest Soil | MPSSKDSLKDRLSRSGEINITVTGRKSGKAISIPVWFVLDKDEDKLYL |
| Ga0209011_11307042 | 3300027678 | Forest Soil | MAARNDALKDRLSRNREINISVTGRKSGRSISIPVWFALEDD |
| Ga0209772_100194051 | 3300027768 | Bog Forest Soil | MPARNNSLKDRLSRSREINLSVTGRKSGRTISIPVWFAL |
| Ga0209074_104251461 | 3300027787 | Agricultural Soil | MPARKNNLRDRLSRNREINITVTGRKSGKAITNPVWFIS |
| Ga0209039_101170631 | 3300027825 | Bog Forest Soil | MSNKEARKAPLKDHLSRSREINISVTGRKSGRTISIPIWFV |
| Ga0209180_101563331 | 3300027846 | Vadose Zone Soil | MGNKPTRNDTLKDRLSRSREINISVTGRKSGRTISIPVWFVLEDDK |
| Ga0209180_102934192 | 3300027846 | Vadose Zone Soil | MPARNEAVKDRLSRYREIKISVTGRNSGRTISIPVWFVLEGEKLYL |
| Ga0209169_104932282 | 3300027879 | Soil | MAKKNDSLKDHLSRYREIKISVTGRKSGRTISIPVWFVFEDDKLY |
| Ga0137415_100304778 | 3300028536 | Vadose Zone Soil | MSNQPARKDALRDHLAQSREINISVIGRKSGRTISNP |
| Ga0137415_103341905 | 3300028536 | Vadose Zone Soil | MPARNDTLKDRLSRFREIKISVTGRNSGRTISIPVWFVLEGEKLYLL |
| Ga0137415_105510694 | 3300028536 | Vadose Zone Soil | MPARNDTLKDRLSRFREIKLSVTGRNSGRTISIPVWFVLEGEKLYLL |
| Ga0302202_100746781 | 3300028762 | Bog | MPAPNDTLKDRLSRDHEINLSVTGRKSGKTISQPVWFVWDD |
| Ga0302225_101836592 | 3300028780 | Palsa | MPVSKDNLKDRLARYREIRISVTGRKSGKTISVPV |
| Ga0302278_103029501 | 3300028866 | Bog | MSDAAMRNKTLKARLAEASEIRITVTGRKSGRAISIPIWFVLQD |
| Ga0302235_103795072 | 3300028877 | Palsa | MSDKQAQNRALTDRLSRSREISISVIGRKSGRNISNPVWFVWNEDKLYL |
| Ga0308309_111056061 | 3300028906 | Soil | MSKTHMPEQNDTLKDSLSRYREIKITVTGRKSGRAISNPVWFVSED |
| Ga0222749_105848872 | 3300029636 | Soil | MSNKPPANDALKSRLSRSREINITVTGRKSGRAISIPVWFVLED |
| Ga0311340_106978581 | 3300029943 | Palsa | MPIPKVALKNRLSRYREINLSVTGRKSGKTISQPVWFVLDED |
| Ga0311371_126750752 | 3300029951 | Palsa | MSNKPTRIDPSNALKDRLSRSREIKISLTGRKSGR |
| Ga0311336_117472181 | 3300029990 | Fen | MPSKNDSLTERLSRDSEITITVTGRKSGRTISIPIWFV |
| Ga0311338_102680344 | 3300030007 | Palsa | MSNKPTRIDPSNALKDRLSRSREIKISLTGRKSGRTISNPVWFVLDGNK |
| Ga0311338_117212282 | 3300030007 | Palsa | MPAINDALKSHLSTDREITITVTGRKTGRAIPVLVWFALDDSTLWLL |
| Ga0302176_103505252 | 3300030057 | Palsa | MSERTGQNAALKDRLARASEINLTVTGRKSGRTISQPVWFVL |
| Ga0311349_100432741 | 3300030294 | Fen | MSNKPTPNEALRDRLSQSSEITITVTGRTSGRNISIPIWLVFEDP |
| Ga0311349_107870781 | 3300030294 | Fen | MPAKNDALRDRLSRSSEITITVSGRTSGRSISIPI |
| Ga0310037_103756051 | 3300030494 | Peatlands Soil | MSNKPTQNHSLKDRLSRSREINICVIGRKSGRTIS |
| Ga0170834_1032304851 | 3300031057 | Forest Soil | MPAPKGDLKDRLSRYNEIDLRVTGRKSGRTISLPV |
| Ga0265331_102861913 | 3300031250 | Rhizosphere | MAKRSDDLKDRLSRSSEINITVTGRKSGRIISNPVW |
| Ga0170820_134926852 | 3300031446 | Forest Soil | MSSKQTQNLALIDHLSRYREINITVTGRKSGRSISIPVWFVFDDDK |
| Ga0302326_135932461 | 3300031525 | Palsa | MSNKPAHKDTLKSRLSRSREIHISVTGRKSGRKISIPVWFVL |
| Ga0318574_106137471 | 3300031680 | Soil | MPTPNDMLKDRLSRYSDISIGVIGRKSGRAITNTVWFVFEDDTINLLP |
| Ga0307476_101094881 | 3300031715 | Hardwood Forest Soil | MEKGSNALKDRLSRSREINVSVTGRKSGRTISNPVWFVSEG |
| Ga0302321_1033659312 | 3300031726 | Fen | MPAKNDALRDRLSRSSEITITVSGRTSGRSISIPIWFVF |
| Ga0307477_108081941 | 3300031753 | Hardwood Forest Soil | MSNKPTRSDPLKDRLSRSREINITVTGRKSGRAIS |
| Ga0307475_101080441 | 3300031754 | Hardwood Forest Soil | MSNKSAQNVSLKERLSRYREINISVIGRKSGRTISNPVWAVF |
| Ga0307475_102031352 | 3300031754 | Hardwood Forest Soil | MHMPARNNALRDRLSRSREITITVTGRESGRAISIPV |
| Ga0307475_106617111 | 3300031754 | Hardwood Forest Soil | MPTQKDALKDHLSRYRQIKISVIGRKSGRTISNPVWFVL |
| Ga0318537_101243151 | 3300031763 | Soil | MPGKNDSLRDRLARYREIKITVTGRKSGRAISNPV |
| Ga0307473_101465231 | 3300031820 | Hardwood Forest Soil | MPARKDDLRDRLSRYREINITVTGRKSGQAITNPVWFV |
| Ga0307478_100028925 | 3300031823 | Hardwood Forest Soil | MAERKHVSNDALKDRLSRYREINLGVTGRKSRRTISRPVGSY |
| Ga0302322_1024393791 | 3300031902 | Fen | MSNNPATNDAVINRLALSSEITITVTGRSSGRSISIPIWFAFGE |
| Ga0310912_102599374 | 3300031941 | Soil | MPAKNDSLKDRLSRYNEIKITVTGRKSGQPTSRPVW |
| Ga0310916_110717941 | 3300031942 | Soil | MPMRNDALKDRLSRYREIEINVIGRKSGHTISIPVWF |
| Ga0306926_109385564 | 3300031954 | Soil | MPTRNDALTARLARSREINISVIGRKSGRTISNPVWFVLDEDKLYL |
| Ga0307479_119199611 | 3300031962 | Hardwood Forest Soil | MSNKPTRNDTLKDRLSRSSEINISVTGRKSGRTISVPVWFV |
| Ga0307479_120060912 | 3300031962 | Hardwood Forest Soil | MPARNVALKDRLSRYREIEISVTGRNSGRMISIPVWFVL |
| Ga0306922_119414272 | 3300032001 | Soil | MPAHNNDLKDRLSRYREIKITVTGRKSGRKISNPVWFVFE |
| Ga0307470_104149351 | 3300032174 | Hardwood Forest Soil | MEKGSNALKDRLSRSREINVSVTGRKSGRTISNPVWF |
| Ga0307472_1025397691 | 3300032205 | Hardwood Forest Soil | MPARNDDLKARLTRSREIKISVTGRKSGRTISIPVSFVLEDD |
| Ga0335079_116097751 | 3300032783 | Soil | MPVQANSLKDHLSRSSEINITVVGRKSGRKSSRPVW |
| Ga0335079_121354602 | 3300032783 | Soil | MPIKNDDLKKRLARSSELNITVTGRKSGRPITIPIWFV |
| Ga0335078_100793467 | 3300032805 | Soil | MPKERESLTDRLSRYREITISVTARKSGRTISNPVWFVYDDNKLF |
| Ga0335078_104020511 | 3300032805 | Soil | MSPKPTHGDTLKDRLARYREIHITVTGRKSGRTISNPVWFVLDEGEG |
| Ga0335078_105328704 | 3300032805 | Soil | MPTKSATLKDQFSRVHEIHITVTGRKSGRAITNPIWFVF |
| Ga0335078_120422711 | 3300032805 | Soil | MPAQNDTLKDRLSRYSEIKITVTGRKSGRKISNPVWFVFEG |
| Ga0335080_114338201 | 3300032828 | Soil | MAVRNDSLPERLARYSEITISVTGRKSGRTISNPVWFAFD |
| Ga0335080_120289251 | 3300032828 | Soil | MPGKHDALVDRLSRYREIKLTVTGRKSGKPISRPVWFVFEDGTL |
| Ga0335080_123539632 | 3300032828 | Soil | MTGKGDSLKGRLSQSREIEITVTGRKSGHAIRVPVWFV |
| Ga0335070_107698331 | 3300032829 | Soil | MSARNDTLKDRLSRYREIQITVTGRKSGRAISIPIWFVW |
| Ga0335069_102114821 | 3300032893 | Soil | MPARSHDSNDLKERLSRYREITISVTGRKSGRTISTPVWFVFEDGT |
| Ga0335074_107614921 | 3300032895 | Soil | MAARNDALKDRLSRFREIEIHVKGRKSGRTISIPVWFVFEGEK |
| Ga0335073_101307271 | 3300033134 | Soil | MPAQKESLKDRLSRYREIKITVTGRKSGRAITNPVWF |
| Ga0314867_079819_630_758 | 3300033808 | Peatland | MKSSDLKDRLSRDREIKLSVTGRKSGKTISVPVWFVLDDDKLY |
| Ga0334827_043031_3_116 | 3300034065 | Soil | MPTPKDALKDRLSRYQEITLSVTGRKSGRTISQPVWFV |
| Ga0326723_0509951_2_106 | 3300034090 | Peat Soil | MSNKPTRNDSLKGRLSRFREINISVTGRKSGRTIS |
| ⦗Top⦘ |