NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F018775

Metagenome / Metatranscriptome Family F018775

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F018775
Family Type Metagenome / Metatranscriptome
Number of Sequences 233
Average Sequence Length 41 residues
Representative Sequence EYVGTSADNPYALEKQIPVFICRGAKFGTLAQLWPKVKRWR
Number of Associated Samples 197
Number of Associated Scaffolds 233

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.71 %
% of genes from short scaffolds (< 2000 bps) 92.70 %
Associated GOLD sequencing projects 181
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.845 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(19.313 % of family members)
Environment Ontology (ENVO) Unclassified
(30.043 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.206 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.59%    β-sheet: 10.14%    Coil/Unstructured: 78.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 233 Family Scaffolds
PF09900DUF2127 15.45
PF00171Aldedh 4.72
PF00009GTP_EFTU 4.29
PF04134DCC1-like 3.43
PF01764Lipase_3 3.43
PF02353CMAS 3.43
PF06778Chlor_dismutase 3.43
PF00290Trp_syntA 2.15
PF00704Glyco_hydro_18 1.29
PF16338AGL_N 1.29
PF13581HATPase_c_2 1.29
PF030614HBT 1.29
PF03144GTP_EFTU_D2 1.29
PF01432Peptidase_M3 0.86
PF07883Cupin_2 0.86
PF05649Peptidase_M13_N 0.86
PF02566OsmC 0.86
PF07238PilZ 0.86
PF13802Gal_mutarotas_2 0.86
PF13414TPR_11 0.43
PF01895PhoU 0.43
PF01261AP_endonuc_2 0.43
PF01053Cys_Met_Meta_PP 0.43
PF14534DUF4440 0.43
PF08206OB_RNB 0.43
PF03644Glyco_hydro_85 0.43
PF10387DUF2442 0.43
PF02518HATPase_c 0.43
PF13676TIR_2 0.43
PF12697Abhydrolase_6 0.43
PF04116FA_hydroxylase 0.43
PF07690MFS_1 0.43
PF14667Polysacc_synt_C 0.43
PF14310Fn3-like 0.43
PF15902Sortilin-Vps10 0.43
PF00669Flagellin_N 0.43
PF05015HigB-like_toxin 0.43
PF02604PhdYeFM_antitox 0.43
PF00581Rhodanese 0.43
PF01661Macro 0.43
PF00400WD40 0.43
PF01641SelR 0.43
PF11611DUF4352 0.43
PF04542Sigma70_r2 0.43
PF11138DUF2911 0.43
PF03486HI0933_like 0.43
PF13186SPASM 0.43
PF09107SelB-wing_3 0.43
PF04226Transgly_assoc 0.43
PF01609DDE_Tnp_1 0.43
PF04191PEMT 0.43
PF02586SRAP 0.43
PF03235DUF262 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 233 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 4.72
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 4.72
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 4.72
COG3011Predicted thiol-disulfide oxidoreductase YuxK, DCC familyGeneral function prediction only [R] 3.43
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 3.43
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 3.43
COG3253Coproheme decarboxylase/chlorite dismutaseCoenzyme transport and metabolism [H] 3.43
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 3.43
COG0159Tryptophan synthase alpha chainAmino acid transport and metabolism [E] 2.15
COG0493NADPH-dependent glutamate synthase beta chain or related oxidoreductaseAmino acid transport and metabolism [E] 0.86
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.86
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.86
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.86
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.86
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.86
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 0.86
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.43
COG2509FAD-dependent dehydrogenaseGeneral function prediction only [R] 0.43
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.43
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.43
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 0.43
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.43
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.43
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.43
COG3293TransposaseMobilome: prophages, transposons [X] 0.43
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.43
COG3549Plasmid maintenance system killer proteinDefense mechanisms [V] 0.43
COG3634Alkyl hydroperoxide reductase subunit AhpFDefense mechanisms [V] 0.43
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.43
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.43
COG4724Endo-beta-N-acetylglucosaminidase DCarbohydrate transport and metabolism [G] 0.43
COG4776Exoribonuclease IITranscription [K] 0.43
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.43
COG5421TransposaseMobilome: prophages, transposons [X] 0.43
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.43
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.43
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.43
COG0029Aspartate oxidaseCoenzyme transport and metabolism [H] 0.43
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.43
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.43
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.43
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.43
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.43
COG0446NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductaseLipid transport and metabolism [I] 0.43
COG0492Thioredoxin reductasePosttranslational modification, protein turnover, chaperones [O] 0.43
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.43
COG0557Exoribonuclease RTranscription [K] 0.43
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.43
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.43
COG2110O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domainTranslation, ribosomal structure and biogenesis [J] 0.43
COG1053Succinate dehydrogenase/fumarate reductase, flavoprotein subunitEnergy production and conversion [C] 0.43
COG1158Transcription termination factor RhoTranscription [K] 0.43
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.43
COG1249Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductaseEnergy production and conversion [C] 0.43
COG1278Cold shock protein, CspA familyTranscription [K] 0.43
COG1344Flagellin and related hook-associated protein FlgLCell motility [N] 0.43
COG1479DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domainsDefense mechanisms [V] 0.43
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.43
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.43
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.43
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 0.43
COG2081Predicted flavoprotein YhiNGeneral function prediction only [R] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.85 %
UnclassifiedrootN/A8.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10460231Not Available756Open in IMG/M
3300001686|C688J18823_10181862All Organisms → cellular organisms → Bacteria → Acidobacteria1428Open in IMG/M
3300001867|JGI12627J18819_10280073All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium671Open in IMG/M
3300002074|JGI24748J21848_1043680All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300002245|JGIcombinedJ26739_101025066All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300003321|soilH1_10112637All Organisms → cellular organisms → Bacteria3836Open in IMG/M
3300004091|Ga0062387_100134176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1398Open in IMG/M
3300004463|Ga0063356_100259969All Organisms → cellular organisms → Bacteria2113Open in IMG/M
3300004635|Ga0062388_102261941Not Available567Open in IMG/M
3300004643|Ga0062591_101844518Not Available618Open in IMG/M
3300005093|Ga0062594_103291178Not Available507Open in IMG/M
3300005167|Ga0066672_10935698All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300005438|Ga0070701_11304246All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae519Open in IMG/M
3300005439|Ga0070711_101488447All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300005538|Ga0070731_10552645All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300005542|Ga0070732_10331143All Organisms → cellular organisms → Bacteria → Acidobacteria916Open in IMG/M
3300005545|Ga0070695_100048872All Organisms → cellular organisms → Bacteria → Acidobacteria2707Open in IMG/M
3300005546|Ga0070696_101185876All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300005556|Ga0066707_10727177All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300005561|Ga0066699_11148394All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300005563|Ga0068855_100125558All Organisms → cellular organisms → Bacteria2934Open in IMG/M
3300005564|Ga0070664_100513179All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300005586|Ga0066691_10766254All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300005598|Ga0066706_10621051Not Available858Open in IMG/M
3300005614|Ga0068856_101960149All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium596Open in IMG/M
3300005618|Ga0068864_100844161All Organisms → cellular organisms → Bacteria → Acidobacteria902Open in IMG/M
3300005841|Ga0068863_101522264All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300006046|Ga0066652_100820654All Organisms → cellular organisms → Bacteria → Acidobacteria889Open in IMG/M
3300006046|Ga0066652_101010471Not Available789Open in IMG/M
3300006102|Ga0075015_100174824All Organisms → cellular organisms → Bacteria → Acidobacteria1130Open in IMG/M
3300006174|Ga0075014_100437973All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300006176|Ga0070765_100871901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium851Open in IMG/M
3300006794|Ga0066658_10266343All Organisms → cellular organisms → Bacteria → Acidobacteria917Open in IMG/M
3300006796|Ga0066665_10946908All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300006804|Ga0079221_10235761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1029Open in IMG/M
3300006806|Ga0079220_11727449All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300006893|Ga0073928_10340161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1114Open in IMG/M
3300006914|Ga0075436_101375090All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300007255|Ga0099791_10543910All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300007258|Ga0099793_10051483All Organisms → cellular organisms → Bacteria1817Open in IMG/M
3300007265|Ga0099794_10782121All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300009088|Ga0099830_11703627All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300009089|Ga0099828_11642825All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300009111|Ga0115026_11170345All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300009137|Ga0066709_101611462All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300009137|Ga0066709_102287903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300009137|Ga0066709_104194063All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300009162|Ga0075423_10730675All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300009176|Ga0105242_10891868All Organisms → cellular organisms → Bacteria → Acidobacteria888Open in IMG/M
3300009545|Ga0105237_10566922All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300009635|Ga0116117_1045074All Organisms → cellular organisms → Bacteria → Acidobacteria1086Open in IMG/M
3300009645|Ga0116106_1063832All Organisms → cellular organisms → Bacteria → Acidobacteria1215Open in IMG/M
3300009764|Ga0116134_1318841All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300010043|Ga0126380_10720377All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300010325|Ga0134064_10110043All Organisms → cellular organisms → Bacteria → Acidobacteria916Open in IMG/M
3300010335|Ga0134063_10268531All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300010343|Ga0074044_10436992All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300010343|Ga0074044_10807239All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300010358|Ga0126370_10075494All Organisms → cellular organisms → Bacteria2245Open in IMG/M
3300010358|Ga0126370_10829654All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300010360|Ga0126372_10440368All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300010360|Ga0126372_12400831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300010360|Ga0126372_12479830All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300010376|Ga0126381_101589082All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae945Open in IMG/M
3300010376|Ga0126381_104460749All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010396|Ga0134126_10129258All Organisms → cellular organisms → Bacteria3080Open in IMG/M
3300010397|Ga0134124_12640293All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300010401|Ga0134121_10411289All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300011043|Ga0138528_146869All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300011089|Ga0138573_1194424All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300011120|Ga0150983_10733755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300011120|Ga0150983_16259614All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300011269|Ga0137392_10155325All Organisms → cellular organisms → Bacteria1850Open in IMG/M
3300011269|Ga0137392_10183465All Organisms → cellular organisms → Bacteria → Acidobacteria1705Open in IMG/M
3300011269|Ga0137392_10355892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1213Open in IMG/M
3300011269|Ga0137392_10528804All Organisms → cellular organisms → Bacteria → Acidobacteria979Open in IMG/M
3300011271|Ga0137393_10512232All Organisms → cellular organisms → Bacteria → Acidobacteria1029Open in IMG/M
3300011271|Ga0137393_11195376All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300011271|Ga0137393_11263682All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300012040|Ga0137461_1044069All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300012096|Ga0137389_10536122All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300012189|Ga0137388_10260966All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1579Open in IMG/M
3300012189|Ga0137388_10486631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1146Open in IMG/M
3300012199|Ga0137383_10475399All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300012201|Ga0137365_10957632All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300012202|Ga0137363_10178947All Organisms → cellular organisms → Bacteria → Acidobacteria1687Open in IMG/M
3300012203|Ga0137399_11661078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300012205|Ga0137362_11391824All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300012208|Ga0137376_11658206All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300012209|Ga0137379_11531683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300012350|Ga0137372_10318051All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300012351|Ga0137386_10229718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1333Open in IMG/M
3300012362|Ga0137361_10506160All Organisms → cellular organisms → Bacteria → Acidobacteria1109Open in IMG/M
3300012582|Ga0137358_10100314All Organisms → cellular organisms → Bacteria1960Open in IMG/M
3300012582|Ga0137358_10353950All Organisms → cellular organisms → Bacteria → Acidobacteria995Open in IMG/M
3300012917|Ga0137395_10104971All Organisms → cellular organisms → Bacteria1883Open in IMG/M
3300012917|Ga0137395_10569719All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300012917|Ga0137395_10742871All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300012918|Ga0137396_10330143All Organisms → cellular organisms → Bacteria → Acidobacteria1128Open in IMG/M
3300012924|Ga0137413_11008236All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300012925|Ga0137419_10132079All Organisms → cellular organisms → Bacteria → Acidobacteria1779Open in IMG/M
3300012925|Ga0137419_11062981All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300012927|Ga0137416_12139577All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300012930|Ga0137407_10160867All Organisms → cellular organisms → Bacteria → Acidobacteria1992Open in IMG/M
3300012977|Ga0134087_10195579All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300012986|Ga0164304_10049089All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2288Open in IMG/M
3300014494|Ga0182017_10447404All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300014501|Ga0182024_10818400All Organisms → cellular organisms → Bacteria → Acidobacteria1133Open in IMG/M
3300014501|Ga0182024_12452029All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300014745|Ga0157377_11065000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300014969|Ga0157376_10788078All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes962Open in IMG/M
3300015054|Ga0137420_1028859All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300015242|Ga0137412_10908515All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300015371|Ga0132258_13787887All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300017930|Ga0187825_10297937All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300017932|Ga0187814_10285801All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300017955|Ga0187817_10145354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1506Open in IMG/M
3300017955|Ga0187817_11059704All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300017973|Ga0187780_10540582All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300017995|Ga0187816_10040581Not Available1920Open in IMG/M
3300018006|Ga0187804_10187574All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium880Open in IMG/M
3300018012|Ga0187810_10177174All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium862Open in IMG/M
3300018017|Ga0187872_10172803All Organisms → cellular organisms → Bacteria → Acidobacteria1016Open in IMG/M
3300018030|Ga0187869_10306674All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300018046|Ga0187851_10153602All Organisms → cellular organisms → Bacteria1392Open in IMG/M
3300018047|Ga0187859_10251091Not Available950Open in IMG/M
3300018047|Ga0187859_10580771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300018085|Ga0187772_10732835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300018086|Ga0187769_11528969Not Available505Open in IMG/M
3300018088|Ga0187771_11810158All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300019786|Ga0182025_1150472Not Available1175Open in IMG/M
3300020199|Ga0179592_10111545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1256Open in IMG/M
3300020199|Ga0179592_10280289All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300020579|Ga0210407_10621428All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium841Open in IMG/M
3300021171|Ga0210405_10873773All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300021180|Ga0210396_10242941All Organisms → cellular organisms → Bacteria1602Open in IMG/M
3300021181|Ga0210388_11162832All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300021344|Ga0193719_10345551All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300021405|Ga0210387_10367962All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300021407|Ga0210383_11598936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300021560|Ga0126371_11438526All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300021560|Ga0126371_11829713Not Available728Open in IMG/M
3300024330|Ga0137417_1144251All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300024330|Ga0137417_1495953All Organisms → cellular organisms → Bacteria → Acidobacteria1972Open in IMG/M
3300025812|Ga0208457_1036967All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1093Open in IMG/M
3300025885|Ga0207653_10350247All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300025906|Ga0207699_10773257All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300025913|Ga0207695_10062910All Organisms → cellular organisms → Bacteria3828Open in IMG/M
3300025913|Ga0207695_10749485All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300025914|Ga0207671_10290344All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300025914|Ga0207671_11199163All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300025916|Ga0207663_10822309All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300025927|Ga0207687_11827403All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300025949|Ga0207667_11117997All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Segetibacter → Segetibacter koreensis771Open in IMG/M
3300026088|Ga0207641_12272090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300026296|Ga0209235_1113567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1148Open in IMG/M
3300026313|Ga0209761_1348536All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300026318|Ga0209471_1303969All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300026325|Ga0209152_10278762All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300026332|Ga0209803_1220108All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300026377|Ga0257171_1105795All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300026523|Ga0209808_1242761All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300026528|Ga0209378_1134150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1032Open in IMG/M
3300026538|Ga0209056_10604333Not Available553Open in IMG/M
3300026548|Ga0209161_10253023All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes913Open in IMG/M
3300026550|Ga0209474_10017281All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5642Open in IMG/M
3300026557|Ga0179587_10380750All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium918Open in IMG/M
3300027064|Ga0208724_1014759All Organisms → cellular organisms → Bacteria → Acidobacteria764Open in IMG/M
3300027439|Ga0209332_1094234All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300027562|Ga0209735_1024203All Organisms → cellular organisms → Bacteria1254Open in IMG/M
3300027619|Ga0209330_1057420Not Available888Open in IMG/M
3300027641|Ga0208827_1081127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1003Open in IMG/M
3300027648|Ga0209420_1111446All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300027663|Ga0208990_1122270All Organisms → cellular organisms → Bacteria → Acidobacteria706Open in IMG/M
3300027671|Ga0209588_1035472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1603Open in IMG/M
3300027678|Ga0209011_1121144All Organisms → cellular organisms → Bacteria → Acidobacteria750Open in IMG/M
3300027684|Ga0209626_1138448All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300027729|Ga0209248_10155711All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium681Open in IMG/M
3300027857|Ga0209166_10535784All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300027867|Ga0209167_10670030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300027884|Ga0209275_10005623All Organisms → cellular organisms → Bacteria → Acidobacteria5211Open in IMG/M
3300027889|Ga0209380_10017990All Organisms → cellular organisms → Bacteria → Acidobacteria4006Open in IMG/M
3300027905|Ga0209415_10213717Not Available1797Open in IMG/M
3300028536|Ga0137415_10584314All Organisms → cellular organisms → Bacteria → Acidobacteria927Open in IMG/M
3300028552|Ga0302149_1189843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria537Open in IMG/M
3300028560|Ga0302144_10143663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300028574|Ga0302153_10315809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → Phenylobacterium zucineum534Open in IMG/M
3300028731|Ga0302301_1085831All Organisms → cellular organisms → Bacteria → Acidobacteria818Open in IMG/M
3300028747|Ga0302219_10145182Not Available907Open in IMG/M
3300028748|Ga0302156_10104162Not Available1433Open in IMG/M
3300028906|Ga0308309_11392522All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300029903|Ga0247271_100354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae12909Open in IMG/M
3300029943|Ga0311340_10068986All Organisms → cellular organisms → Bacteria → Acidobacteria4056Open in IMG/M
3300029951|Ga0311371_10953974All Organisms → cellular organisms → Bacteria → Acidobacteria1028Open in IMG/M
3300029999|Ga0311339_11123321All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300030057|Ga0302176_10158179All Organisms → cellular organisms → Bacteria → Acidobacteria899Open in IMG/M
3300030399|Ga0311353_10007271All Organisms → cellular organisms → Bacteria13720Open in IMG/M
3300030503|Ga0311370_10521703All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1449Open in IMG/M
3300030693|Ga0302313_10094762All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300030813|Ga0265750_1005279All Organisms → cellular organisms → Bacteria → Acidobacteria1362Open in IMG/M
3300030878|Ga0265770_1004313All Organisms → cellular organisms → Bacteria → Acidobacteria1939Open in IMG/M
3300031010|Ga0265771_1009043All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300031234|Ga0302325_12307995All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300031234|Ga0302325_12687076All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300031247|Ga0265340_10124845Not Available1183Open in IMG/M
(restricted) 3300031248|Ga0255312_1133100All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300031525|Ga0302326_13530763Not Available519Open in IMG/M
3300031708|Ga0310686_102874765All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1671Open in IMG/M
3300031708|Ga0310686_105953598All Organisms → cellular organisms → Bacteria → Acidobacteria1213Open in IMG/M
3300031708|Ga0310686_109802180All Organisms → cellular organisms → Bacteria3522Open in IMG/M
3300031708|Ga0310686_114213427All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300031712|Ga0265342_10100910All Organisms → cellular organisms → Bacteria1644Open in IMG/M
3300031753|Ga0307477_10122167All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300031754|Ga0307475_10086272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2428Open in IMG/M
3300031820|Ga0307473_10466884All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300031820|Ga0307473_11401704All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300031823|Ga0307478_10720102All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300031823|Ga0307478_11226890All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300031912|Ga0306921_11534229All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300031962|Ga0307479_11305064All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300032043|Ga0318556_10219217All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus991Open in IMG/M
3300032126|Ga0307415_100348582All Organisms → cellular organisms → Bacteria → Acidobacteria1245Open in IMG/M
3300032160|Ga0311301_12451348All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300032783|Ga0335079_12278222All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300032805|Ga0335078_10429980All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1722Open in IMG/M
3300032805|Ga0335078_11049509All Organisms → cellular organisms → Bacteria → Acidobacteria959Open in IMG/M
3300032805|Ga0335078_11187369All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300032895|Ga0335074_11007228All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300032898|Ga0335072_11370304All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300032898|Ga0335072_11731486All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300033402|Ga0326728_10789883All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300034090|Ga0326723_0231918All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300034282|Ga0370492_0025695Not Available2420Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.30%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.58%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.15%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.43%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.15%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.15%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.15%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.72%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.72%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.72%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.29%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.29%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.29%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.29%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.86%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.86%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.86%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.86%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.86%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.43%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.43%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.43%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.43%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.43%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.43%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.43%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.43%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.43%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.43%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.43%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.43%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.43%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002074Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011043Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011089Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025812Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027064Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes)EnvironmentalOpen in IMG/M
3300027439Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027684Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028552Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028731Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029903Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030693Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2EnvironmentalOpen in IMG/M
3300030813Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030878Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031010Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1046023113300001593Forest SoilFDSVQFVGISPDNPYALETEIGVDICRGPKFGTLAQLWPALKKWR*
C688J18823_1018186233300001686SoilVQYVGTSADNPYALEKKLDVFICRGSKFGTLADLWPKLKKWR*
JGI12627J18819_1028007313300001867Forest SoilLWEHVQYVGTSADNPYALEKRIDVFLCKGAKFGTLSQLWPRLKKWG*
JGI24748J21848_104368013300002074Corn, Switchgrass And Miscanthus RhizosphereKVEYAGRSADNPYALEKEIPFFIVHGPKFGSLQEAWPRLKKWR*
JGIcombinedJ26739_10102506613300002245Forest SoilSAPNPYALEAEISVNICHGAKFGTMADLWPKIKHWR*
soilH1_1011263713300003321Sugarcane Root And Bulk SoilLRKLFNTVQYVGTSADNPYALEKEIPVYICRGSKFGTMEQLWPRLKHWR*
Ga0062387_10013417613300004091Bog Forest SoilVGTSAPNPYALEQQIDVYICRGPKFGTLAQIWPKIKHWR*
Ga0063356_10025996913300004463Arabidopsis Thaliana RhizosphereEQKFDKVEYAGRSADNPYALEKEIPFFIVHGPKFGSLQEAWPRLKKWR*
Ga0062388_10226194113300004635Bog Forest SoilLETYFDSVQFVGISADNPYALEKEIGVDICRGRKFGTLAQMWPELKKWR*
Ga0062591_10184451823300004643SoilFEHVELVGTSDNPYALERNITVWICKGSKFGSLAQLWPKLKKWR*
Ga0062594_10329117813300005093SoilEFVGTSDNPYALERNITVWLCKGAKFGSLQQLWPKLKKWR*
Ga0066672_1093569813300005167SoilEHIEYVGKSADNPYALEREIPIFICRGAKFGTLAELWPRLKKWR*
Ga0070701_1130424623300005438Corn, Switchgrass And Miscanthus RhizosphereEYVGTSEDNPYALEKNIDVFICKGAKFGTLAQLWPKLKHWR*
Ga0070711_10148844723300005439Corn, Switchgrass And Miscanthus RhizosphereVGTSADNPYALEKKIDVHICKGPKFGTLAQLWPKLKRWR*
Ga0070731_1055264513300005538Surface SoilGDSADNPYALEKDIPVFICRGAKFGTMAQLWPRIKRWR*
Ga0070732_1033114313300005542Surface SoilLFYDVQYVAESNSPYALENHIPVFLCRGKKFSSLAALWPRLKKWD*
Ga0070695_10004887213300005545Corn, Switchgrass And Miscanthus RhizosphereFDHVEYVGSSDNPYALERHIPVFICKGAKFGSLAKLWPQLKKWR*
Ga0070696_10118587623300005546Corn, Switchgrass And Miscanthus RhizosphereHVEYVGSSDSPYALERNIPVFICKGAKFGSLAQIWPQLKKWR*
Ga0066707_1072717723300005556SoilEYVGKSSDNPYAMEREIPVFICRGAKFGSLAGIWPRLKRWR*
Ga0066699_1114839423300005561SoilSYFEHVEYVGKSSDNPYAMEREIPVFICRGAKFGSLADIWPQLKKWR*
Ga0068855_10012555813300005563Corn RhizosphereSADNPYALEKDIPVFICHGSKFGTMQQLWPRLKKWR*
Ga0070664_10051317913300005564Corn RhizosphereDNPYALEKNIDVFICKGAKFGTLTQLWPKLKRWR*
Ga0066691_1076625423300005586SoilADNPYALEKQIDVFICRGSKFGTLADLWPMLKHWR*
Ga0066706_1062105123300005598SoilTSADNPYALEKNIDVFICRGTKFGTMADLWPKADIKKWR*
Ga0068856_10196014923300005614Corn RhizosphereFVGTSDNPHALERNIPVFICKGSKFGSLTTLWPKLKHWR*
Ga0068864_10084416113300005618Switchgrass RhizosphereTSADNPYALEREVPFYIVHGPKFGSLQEVWPRLKKWR*
Ga0068863_10152226423300005841Switchgrass RhizosphereDQVEYAGTSADNPYALEREVPFFIVSGPKFGSLQEVWPRLKKWR*
Ga0066652_10082065413300006046SoilLEGYFDHVEYVGKSTDNPYAMEREIPVFICRGARFGTLADIWPRLKKWR*
Ga0066652_10101047123300006046SoilHVELVGTSADNPYALEKQLDVFICRGSKFGKLPELWPRLKKWR*
Ga0075015_10017482413300006102WatershedsSEFEHVEYVGMSDNPYALEREIPVFICRGAKFGTLADIWPRLKKWR*
Ga0075014_10043797323300006174WatershedsDNPYALERQIPVFICRGTKFGTLAQVWPRLKKWR*
Ga0070765_10087190123300006176SoilVEYVGTSADNPYALEKLIPVYICRGAKFGSLEKLWPQVKRWR*
Ga0066658_1026634323300006794SoilGTSADNPYALEKQIDVFLCKGAKFGTLTQLWPKLKRWR*
Ga0066665_1094690823300006796SoilYVGTSADNPYALEKQIDVFLCKGAKFGTLTQLWPKLKRWR*
Ga0079221_1023576123300006804Agricultural SoilVEYVGTSTDNPYALERRIPVYICRGAKFGTLEKVWPALKKWS*
Ga0079220_1172744913300006806Agricultural SoilGRSPDNPYALERKIPVFICHGAKFGSLTQLWPKLKKWA*
Ga0073928_1034016113300006893Iron-Sulfur Acid SpringLFEHVEFVGTSADNPYALERQIPVFICRGAKFGTLEKVWPQLKKWR*
Ga0075436_10137509023300006914Populus RhizosphereDNRYALERNIPVFLCHGAKFGSLAKLWPQLKKWD*
Ga0099791_1054391013300007255Vadose Zone SoilLFERVEFVGTSDNPYALERNIPVFLCKGAKFGSLEKVWPQLKKWR*
Ga0099793_1005148333300007258Vadose Zone SoilSPDNPYAMEREITVFICRGAKFGSLAEIWPRLKRWR*
Ga0099794_1078212123300007265Vadose Zone SoilVGTSADNPYALEREIDVFICKGSKFGTLSQLWPTVKRWR*
Ga0099830_1170362723300009088Vadose Zone SoilFEHVEYLGKSADNPYALEREIPVFICRGAKFGSLAAIWPRVKKWH*
Ga0099828_1164282513300009089Vadose Zone SoilADNPYALEREISVFICHGAKFGSLADVWPQLKKWR*
Ga0115026_1117034523300009111WetlandSRFDHVEYLDTSAPNPYALESTVPVYICRGAKFGTPADLWPKVKHWR*
Ga0066709_10161146223300009137Grasslands SoilVEYVGTSADNPYALEKQIDVFICRGPKFGTLADLWPKVKRWR*
Ga0066709_10228790313300009137Grasslands SoilERVEFVGKSANNPYALERQIPVFICRGAKFGSLAALWPRLKKWR*
Ga0066709_10419406313300009137Grasslands SoilESVGRSADNPYALEQEIPVFICKGAKFGSLTQLWPKVKRWR*
Ga0075423_1073067513300009162Populus RhizosphereRNTLEQKFDKVEYVGRSADNPYALEKEIPFFIVHGPKFGSLQEAWPRLKKWR*
Ga0105242_1089186833300009176Miscanthus RhizosphereFEQVEYVGASDNPYALERNIPVYLCRGAKFGSLQELWPQIKKWR*
Ga0105237_1056692223300009545Corn RhizosphereKLFNTVQYVGTSADNPYALEKDIPVFICHGSKFGAMQQLWPRLKKWR*
Ga0116117_104507423300009635PeatlandADNPYALEKQIAVYICRGPKFGTLDQLWPQLKRWR*
Ga0116106_106383213300009645PeatlandADNPYALEKQIDVYICRGPKFGTLAQLWPELKRWR*
Ga0116134_131884113300009764PeatlandGQSADNPYALEKQIDVYICRGPKFGTLAQLWPELKRWR*
Ga0126380_1072037723300010043Tropical Forest SoilVEYVGTSADNPYALEKQIDVFICRGSKFGTMANLWSTKVKKWR*
Ga0134064_1011004333300010325Grasslands SoilYVGTSADNPYALEKQIDVFLCKDAKFGTLTQLWPKLKRWR*
Ga0134063_1026853123300010335Grasslands SoilQEMFEKVEYVGRSVDNPYALERRIPVFICKGAKFGTLTQLWPEFKKWR*
Ga0074044_1043699223300010343Bog Forest SoilDFVGTSRDNPYALESQLPVFICRGSKFGTLAQLWPSLKKWR*
Ga0074044_1080723913300010343Bog Forest SoilQLWNNVQYVGDSADNPWALEKDIPVFICRGAKFGKLTQLWPELKRWR*
Ga0126370_1007549433300010358Tropical Forest SoilLWEHVEYVGTSADNPYALEKQIDVFLCKGAKFGTLAQLWPKVKRWR*
Ga0126370_1082965413300010358Tropical Forest SoilNQLFENVKYVGTSANNPYALEKNISVFICTGPKFGTLQDLWPSIKRWR*
Ga0126372_1044036843300010360Tropical Forest SoilLFQRVELVGISDNPLALERHIPVFVCRGAKFGSLAQLWPRLKFWG*
Ga0126372_1240083113300010360Tropical Forest SoilTTPENPYALEKLLPVYLCRGAKFGTLAALWPQLKKWR*
Ga0126372_1247983013300010360Tropical Forest SoilADNPYALEKQIDVFLCKGAKFGTLAQLWPKVKRWR*
Ga0126381_10158908233300010376Tropical Forest SoilSDNPLALERHIPVFVCRGAKFGSLAQLWPRLKFWG*
Ga0126381_10446074923300010376Tropical Forest SoilLNELFREVKYVGTSANNPYALERNIPVFICTGSKFGTLKELWPNTKRWR*
Ga0134126_1012925813300010396Terrestrial SoilLWKNVQYVGTSADNPYALEKQIDVFICRGSKFGSWAGLWPDLKRWR*
Ga0134124_1264029323300010397Terrestrial SoilTSADNPYALEKKIEVFICRGPKFGTLAQLWPKLKRWR*
Ga0134121_1041128913300010401Terrestrial SoilSEDNPYALEKNIDVFICKGAKFGTLTQLWPKLKRWR*
Ga0138528_14686923300011043Peatlands SoilDNPYALEREIPVFICRGAKFGTLAKVWPQLKKWR*
Ga0138573_119442423300011089Peatlands SoilVGDSADNPYALEREIPVFICRGAKFGTLAKVWPQLKKWR*
Ga0150983_1073375513300011120Forest SoilVEYVGMSADNPYALERQIAVYVCRGARFGTLEKVWPQLKKWR*
Ga0150983_1625961423300011120Forest SoilEREFERVEYVGKSSDSPYAMEREIPVFICRGAKFGSLAEMWPRLKKWR*
Ga0137392_1015532513300011269Vadose Zone SoilLFEDVEYVGKSGDNPYALEREIPVFICRGAKFGSLAELWPQLKKWR*
Ga0137392_1018346543300011269Vadose Zone SoilYVGKSSDNPYAMEREIPVFICRGAKFGSLAEMWPRLKKWR*
Ga0137392_1035589233300011269Vadose Zone SoilEHVEYVGKSSDNPYAMEREIPVFICRGAKFGSLAEIWPRLKRWR*
Ga0137392_1052880413300011269Vadose Zone SoilDNPYALEREIPVFICRGAKFGSLAELWPRLKKWR*
Ga0137393_1051223233300011271Vadose Zone SoilYEQVEYVGASDNPYALERNIPVFICRKAKFGSLAELWPQLKKWR*
Ga0137393_1119537613300011271Vadose Zone SoilGASDNPYALERNIPVFICRKAKFGSLAELWPQLKKWR*
Ga0137393_1126368223300011271Vadose Zone SoilVGSSRDNPYALERDLPVFICRGAKFGSLAKLWPSLKKWN*
Ga0137461_104406923300012040SoilFEHVEYVGSSANNPYALEREVPVFLCRGPKFGSLAQLWPQLKKWR*
Ga0137389_1053612213300012096Vadose Zone SoilEYVGTSADNPYALEKQIPVFICRGAKFGTLAQLWPKVKRWR*
Ga0137388_1026096643300012189Vadose Zone SoilADNPYALEKQIDVFFCKGAKFGTLAQLWPKVKRWR*
Ga0137388_1048663113300012189Vadose Zone SoilKDNPYALEREIPVFICKGSKFGSLTDLWPKLKKWR*
Ga0137383_1047539933300012199Vadose Zone SoilSADNIYAIEREIPVFSCRGAKFGSLTEVWPQLKKWR*
Ga0137365_1095763213300012201Vadose Zone SoilNNVEYVGTSADNPYALEKNIDVFICRGSRFGTMTDLWPKPAIKRWR*
Ga0137363_1017894723300012202Vadose Zone SoilEHVEYVGKSADNPYALEREIPVFLCRGAKFGSLAKIWPRLKKWS*
Ga0137399_1166107823300012203Vadose Zone SoilWDHVEYVGTSADNPYALEKQIDVFICHGAKFGTLAEFWPEVKKWR*
Ga0137362_1139182423300012205Vadose Zone SoilWEHVEYVGTSADNPYALEKQIDVFLCKGAKFGTLTQLWPQLKRWR*
Ga0137376_1165820623300012208Vadose Zone SoilEHVEYAGKSDNPYALERNIPVFICKGAKFGSLTQLWPQLKKWQ*
Ga0137379_1153168323300012209Vadose Zone SoilYVGTSADNPYALEKQIDVYICRGPKFGTLADLWPRLKHWR*
Ga0137372_1031805113300012350Vadose Zone SoilADNPYALEKEIPVFICKGSKFGTLAEVWPRVKHWR*
Ga0137386_1022971833300012351Vadose Zone SoilVGKSADNPYALERQIPVFICRGAKFGSLAAIWPRLKKWR*
Ga0137361_1050616033300012362Vadose Zone SoilYEQVEYVGASDNPYALERNIPVFICRKGKFGSLAELWPQLKKWR*
Ga0137358_1010031413300012582Vadose Zone SoilKSPDNPYAMEREIPVFICRGAKFGSLAEIWPRLKKWR*
Ga0137358_1035395013300012582Vadose Zone SoilHVEYVGKSPDNPYAMEREITVFICRGAKFGSLAEIWPRLKRWR*
Ga0137395_1010497133300012917Vadose Zone SoilVEYVGKSTDNPYAMEREIPVFICRGAKFGTLADIWPRLKKWR*
Ga0137395_1056971913300012917Vadose Zone SoilYVGTSADNPYALEKQIDVFLCKGAKFGTLTQLWPQLKRWR*
Ga0137395_1074287113300012917Vadose Zone SoilSHVEYVGTSADNPYALEKQIDVFICRGAKFGTLAELWPQIKRWR*
Ga0137396_1033014313300012918Vadose Zone SoilFEHVEYVGMSDNPYALERNIPVFICRGAKFGSLADIWPHLKKWR*
Ga0137413_1100823613300012924Vadose Zone SoilSVEYIGNSANNPYALEREIPVFICKGAKFGSLEQLWPQVKLWR*
Ga0137419_1013207943300012925Vadose Zone SoilYFEHVEYVGKSSDNPYAMEREIPLFICRGAKFGSLAEFWPQLKKWR*
Ga0137419_1106298113300012925Vadose Zone SoilKSPDNPYAMEREIPVFICRGAKFGSLAGIWLRLKRWR*
Ga0137416_1213957713300012927Vadose Zone SoilEYVGISANPYALERNIPVYLCKGAKFGSLQKLWPKLKKWY*
Ga0137407_1016086713300012930Vadose Zone SoilDNPYALERNIPVFLCKGAKFGSLLALWPKLKKWR*
Ga0134087_1019557933300012977Grasslands SoilDNPYALEKQIDVFLCKGAKFGTLTQLWPKLKRWR*
Ga0164304_1004908943300012986SoilSSDNPYALERNIPVYICRGAKFGSLAQIWPQLKKWR*
Ga0182017_1044740423300014494FenWKVDYAGTSAANPYALEQQLPVFICRGAKFGTLAQFWPTLKHWR*
Ga0182024_1081840023300014501PermafrostSADNPYALEKQIDVFICRGAKFGTLTQLWPALKRWR*
Ga0182024_1245202923300014501PermafrostGDSADNPYALEKEISVWICRNPKFGTLAQLWPSLKRWR*
Ga0157377_1106500033300014745Miscanthus RhizosphereFQQVEYVGSADNPYALERHIPVFLCRGAKFGTLTQLWPNLKRWR*
Ga0157376_1078807813300014969Miscanthus RhizosphereTSDNPYALERNIPVYLCKGAKFGSLVELWPELKKWQ*
Ga0137420_102885923300015054Vadose Zone SoilSDNPYAMEREISVFICRGAKFGSLAEIWPRLKRWR*
Ga0137412_1090851513300015242Vadose Zone SoilVEYVGTSADNPYALEREIDVFICKGSKFGTLSQLWPTVKRWR*
Ga0132258_1378788713300015371Arabidopsis RhizosphereLWDNVEYVGTSADNPYALEREVDVFICQGAKFGTLTQLWPKVKRWR*
Ga0187825_1029793723300017930Freshwater SedimentNHVEYVGASADNPYALEREVPIFICKGAKFGSLSQLWPKVKNWS
Ga0187814_1028580113300017932Freshwater SedimentHVEYVGTSADNPYASEKEIPVFICRGPKFATLAQIWPMLKRWR
Ga0187817_1014535413300017955Freshwater SedimentSADNPYALEKEIGVFICRGPKFGTLAQLWPQLKRWH
Ga0187817_1105970413300017955Freshwater SedimentFEHVEYVGTSADNPYALEREIPVFICRGAKFGTLAKVWPQLKKWR
Ga0187780_1054058223300017973Tropical PeatlandEFVGTSEDNPYALEREIPVFICRGAKFGTLEKVWPQLKKWR
Ga0187816_1004058113300017995Freshwater SedimentADNPWALESQIEVYICHKPKFGRLSEIWPKVKRWR
Ga0187804_1018757423300018006Freshwater SedimentSADNRYASEKEIPVFICRGPKFASLGQIWPMVKRWR
Ga0187810_1017717413300018012Freshwater SedimentADNSYALEKQIDVFLCKGAKFGTLAQFWPKVKRWR
Ga0187872_1017280323300018017PeatlandEYVGTSADNPYALEKEIDVYICRGAKFGALAQLWPQLKRWR
Ga0187869_1030667423300018030PeatlandEYLGNSPPNSYALETEISVNICRGSKFGTLADLWPKLKHWR
Ga0187851_1015360223300018046PeatlandLEQLFDHVEYLGRSAPNPYALENELPIFICRGSKFGSLKELWPRLKKWR
Ga0187859_1025109113300018047PeatlandEYLGESADNPYALEKQIDVYICRGSKFGTLTQLWPQLKRWR
Ga0187859_1058077113300018047PeatlandKLFNQVEYVGTSAASPYALEQQIDVYICRGAKFGTLTQIWTRLKHWR
Ga0187772_1073283513300018085Tropical PeatlandEYVGNSTPNPYALESKLPIFICRGPKFGTLADVWPKMKRWR
Ga0187769_1152896913300018086Tropical PeatlandADNPWALEKKIGFYICRKPKFGSLADLWPKVKHWR
Ga0187771_1181015823300018088Tropical PeatlandGTSADNPYALETGIAVWICRGPKLGTLAQLWPRIKKWR
Ga0182025_115047213300019786PermafrostQIPNIGTSAANPYALEQRIDVYICRGAKFGTLTQLWPHLKRWR
Ga0179592_1011154513300020199Vadose Zone SoilFEHVEYVGTSDANPYALEQQIPVFICRGAKFGTLEKVWPQLKRWR
Ga0179592_1028028913300020199Vadose Zone SoilLFERVEYIGKSADNPYGLEREIPVFICRGAKFGSLAELWPRLKKWG
Ga0210407_1062142813300020579SoilDRVEYVGTSADNPYALEKQIDVFICRGAKFGTLDQLWPQIKRWR
Ga0210405_1087377313300021171SoilYVGTSAASPYALEQQIDVYICRGAKFGTLTQLWPQLKRWR
Ga0210396_1024294113300021180SoilFEHVEYVGTSADNPYALERLIPVYICRGAKFGSLEKIWQQVKRWR
Ga0210388_1116283213300021181SoilNSAPNPYVLETEISVNICRGAKFGTMADLWPKIKHWR
Ga0193719_1034555123300021344SoilLWDNVEYVGTSADNPYALEKRIDVFICRGAKFGTLAQLWPKLKHWR
Ga0210387_1036796213300021405SoilVGLSADNPYALEREIPVFICRGAKFGTLGNIWPQLKKWR
Ga0210383_1159893613300021407SoilADNPYALEKQIDLYICRGARFGSFTQLWPQIKRWR
Ga0126371_1143852623300021560Tropical Forest SoilSSDNPYALERNIPVFICKGAKFGTLADLWPKVKKWR
Ga0126371_1182971313300021560Tropical Forest SoilHVEYVGTSADNPWALERGIDVFLCKGKKFDTLAQLWPRVKRWR
Ga0137417_114425123300024330Vadose Zone SoilKSPDNPYAMEREITVFICRGAKFGSLAEIWPRLKRWR
Ga0137417_149595313300024330Vadose Zone SoilKSADNPYALEREIPVFICRGAKFGTLADLWPRLKKWR
Ga0208457_103696713300025812PeatlandVEYVGTSGDNPYALEKQIGVFICRGAKFGTLAQLWPQLKRWR
Ga0207653_1035024723300025885Corn, Switchgrass And Miscanthus RhizosphereSSDSPYALERNIPVFICKGAKFGSLAQIWPQLKKWR
Ga0207699_1077325713300025906Corn, Switchgrass And Miscanthus RhizosphereVGTSTDNRYALEKNIDVFICRGSKFGTMADLWPKPNIKKWR
Ga0207695_1006291013300025913Corn RhizosphereKLFNTVQYVGTSADNPYALEKDIPVFICHGSKFGAMQQLWPRLKKWR
Ga0207695_1074948523300025913Corn RhizosphereADNSYALEKQIDVFICRGSKFGSWAGLWPDLKRWR
Ga0207671_1029034433300025914Corn RhizosphereFVGTSADNPYALEKKIEVFICRGPKFGTLAQLWPKLKRWR
Ga0207671_1119916313300025914Corn RhizosphereQQVDYVGTSADNPWALEKNIDVFICHGPKFGTLAELWPKLKNWR
Ga0207663_1082230913300025916Corn, Switchgrass And Miscanthus RhizosphereFVGTSADNPYALEKKIDVHICKGPKFGTLAQLWPKLKRWR
Ga0207687_1182740313300025927Miscanthus RhizosphereSDSPYALERNIPVYICKGAKFGSLAQIWPELKKWR
Ga0207667_1111799713300025949Corn RhizosphereVGTSADNPYALEKEIPVFICHRPKFGTLAELWTKLKKWR
Ga0207641_1227209023300026088Switchgrass RhizosphereEYVGSSDSPYALERNIPVFICKGAKFGSLAQIWPQLKKWR
Ga0209235_111356723300026296Grasslands SoilGKSADNPYALERQIPVFICRGAKFGSLAALWPRLKKWR
Ga0209761_134853613300026313Grasslands SoilVDNPYALERQIPVFICKGAKFGTLTQLWPQFKKWR
Ga0209471_130396923300026318SoilGLFERVEYVGKSTDNHYALERELSVFICRGAKFGTLADLWPRLKKWS
Ga0209152_1027876223300026325SoilVGTSADNPYALEKQIDVFLCKGAKFGTLTQLWPKLKRWR
Ga0209803_122010813300026332SoilVEYIGTSDNPYALERHIPVFLCRGSKFGSLANLWPGLKKWD
Ga0257171_110579513300026377SoilGTSADNPYALEREIPVFICKGAKFGSLAQLWPKLKKWS
Ga0209808_124276113300026523SoilNSVEYVGTSADNPYALEKNIDVFICRGAKFGTMADLWPKPGVKRWR
Ga0209378_113415013300026528SoilYVGTSADNPYALEKQIDVFLCKGAKFGTLTQLWPKLKRWR
Ga0209056_1060433313300026538SoilGTSADNPYALEKQIDVFLCKGAKFGTLDRLWPKVKHWR
Ga0209161_1025302313300026548SoilKVEYVGTSDNRYALERNIPVFLCHGAKFGSLAKLWSRLKKWD
Ga0209474_1001728173300026550SoilLWEHVEYVGTSADNPYALEKQIDVFLCKDAKFGTLTQLWPKLKRWR
Ga0179587_1038075013300026557Vadose Zone SoilWQYVEYVGASADNPYALEKQIDVFICRGSKFGTLADIWPNLKRWR
Ga0208724_101475923300027064Forest SoilSSDNPYALETEISVNICRGPRFGTLTDLWPQVKHWR
Ga0209332_109423413300027439Forest SoilQLWQHVEYVGTSADNPYALEKQIDVFICRGPRFGSMAELWPEIKRWR
Ga0209735_102420313300027562Forest SoilTSRGNPYALEQELPVYICRGAKFGTLAQLWPRLKKWR
Ga0209330_105742013300027619Forest SoilLWDHVEYVGTSADNPYALEKQIDVYICRGSKFGSLTQLWPQIKRWR
Ga0208827_108112713300027641Peatlands SoilFVGTSADNPWALESEIGVYICRGPKFGTLSQGWPMVKRWR
Ga0209420_111144613300027648Forest SoilTSADNSYALEKEIDVYICRGAKFGTLAELWPQLKRWR
Ga0208990_112227023300027663Forest SoilTSADNPYALEREIPIFICRGAKFGSLAAIWPQLKKWR
Ga0209588_103547233300027671Vadose Zone SoilEHVEYAGQSADNPYALERKIPVFICRGAKFGSLAALWPKLKKWG
Ga0209011_112114423300027678Forest SoilKSSDNPYAMEREIPVFICRGAKFGSLAEIWPRLKRWR
Ga0209626_113844813300027684Forest SoilGTSADNPYALEKQIDVFLVRGPKFGTLAQLWPEVKRWR
Ga0209248_1015571113300027729Bog Forest SoilGEADNPYALEREISVYICRGAKFGSLAAIWPELKKWR
Ga0209166_1053578413300027857Surface SoilYVGTSADNRYALEKEIPVFVCKRAKFGSFAEFWPKLKKWR
Ga0209167_1067003013300027867Surface SoilYVGTSADNPYALEKEIDVFICKGAKFGTFAQLWPKLKRWR
Ga0209275_1000562363300027884SoilYVGTSADNPYALEKEIAVYICRGAKFGTLEKLWPQLKKWR
Ga0209380_1001799013300027889SoilWNHVEYVGTSADNPYALEKRIDVFICRGAKFGNLAELWPQVKHWR
Ga0209415_1021371713300027905Peatlands SoilLSRDNPYALERRVPVFICRGAKFGTLAQIWPKLKHWR
Ga0137415_1058431423300028536Vadose Zone SoilHVESVGRSADNPYALEREIPVFICKGAKFGSLTELWPKVKKWR
Ga0302149_118984313300028552BogYVGTSADNPYALEREIAVYICRGPKFGTLAELWPQVKKWR
Ga0302144_1014366313300028560BogSTDNPYALEREIAVYICRGPKFGTLAELWPQVKKWR
Ga0302153_1031580923300028574BogLFEHVEYVGTSADNPYALEREIAVYICRGPKFGTLAELWPQVKKWR
Ga0302301_108583123300028731PalsaGDSADNPYALEKEIAVYICRRPKFGTLDQLWPEVKRWR
Ga0302219_1014518213300028747PalsaSADNPYALEKQIDVYICHGSKFGTLTDLWPELKRWR
Ga0302156_1010416213300028748BogSADNPYALEREIAVYICRGPKFGTLAELWPQVKKWR
Ga0308309_1139252213300028906SoilEQVDYRGNSAPNPYALETEISVNICHGPKFGTLADLWPKIKHWR
Ga0247271_10035433300029903SoilXQVEFVGISADNPWALETGISVNICRGPKFGTLTQLWPQLKRWR
Ga0311340_1006898613300029943PalsaEYVGQSADNPYALEKQIDVYICRGPKFGTFAELWPQIKRWR
Ga0311371_1095397423300029951PalsaEYVGTSADNPYALEKQIDVFFCKGKKFGTLAQLWPELKRWR
Ga0311339_1112332113300029999PalsaTSADNPYALEKEIGVFICRGAKFGTLAQLWPQLKHWH
Ga0302176_1015817923300030057PalsaGQSADNPYALEKQIDVYICRGPKFGTFAELWPQIKRWR
Ga0311353_1000727113300030399PalsaSADNSYALEKGIGVDICRGPKFGTLAQLWPGFKKWR
Ga0311370_1052170313300030503PalsaIGTSADNPYALEKEIGVFICRGAKFGTLAQLWPQLKHWH
Ga0302313_1009476243300030693PalsaKLFDHVEYVGTSADNPYALEKQIDVFICRGAKFGTLAKIWPALKRWR
Ga0265750_100527923300030813SoilGTSADNPYALEKEIAVYICRGAKFGTLEKIWPELKKWR
Ga0265770_100431333300030878SoilADNSYALEKEIAVYICRGAKFGTLEKIWPELKKWR
Ga0265771_100904313300031010SoilGTSADNSYALEKEIAVYICRGAKFGTLEKIWPELKKWR
Ga0302325_1230799523300031234PalsaKLFEQVDFVGTSRDNPYALERELPVFICRRAKFGSLAELWPQLKKWR
Ga0302325_1268707623300031234PalsaQLWDHVEYVGTSADNPYALEKQIDVYICRGSKFGTLTQLWPQLKRWR
Ga0265340_1012484513300031247RhizosphereYVGTSADNPWALESQIGVYICKGAKFGTLTQIWPQLKRWR
(restricted) Ga0255312_113310013300031248Sandy SoilLWENVEYVGRSADNPYALEKQIDVFICRGSKFGALAQLWPEVKHWR
Ga0302326_1353076313300031525PalsaEYVGTSADNPYALEKQIDVYICRGSKFGTLTQLWPQLKRWR
Ga0310686_10287476523300031708SoilVEYVGQSADNPYALEKQIDVYICRGAKFGTLAQLWPQLKRWR
Ga0310686_10595359833300031708SoilVGTSADNPYALEKEIPVYICRGAKFSTMAGLWPQIKRWR
Ga0310686_10980218013300031708SoilFDSVQFVGISADNPYALETEIGVDICRGPKFGTLAQLWPGLKKWR
Ga0310686_11421342713300031708SoilEQLFNSVQYVGTSADNPYALETEISVYICRGPKFGTLAELWPQLKKWR
Ga0265342_1010091013300031712RhizosphereVGTSADNPWALESQIGVYICKGAKFGTLTELWPQLKRWR
Ga0307477_1012216713300031753Hardwood Forest SoilYVGLSADNPWALESGISVNICHGAKFGSLSQLWPQLKRWR
Ga0307475_1008627213300031754Hardwood Forest SoilVFVGKSDNPYALERNIPVYICKGAKFGTLAQFWPQLKKWR
Ga0307473_1046688423300031820Hardwood Forest SoilYVGKSTDNPYAMEREIPVFICRGARFGTLADIWPRLKKWR
Ga0307473_1140170413300031820Hardwood Forest SoilGTSDNRYALERNISVFLCHGAKFGSLAKFWPQLKKWD
Ga0307478_1072010213300031823Hardwood Forest SoilSADNPYALEKNIDVFICRGAKFGTLADLWPKLKRWR
Ga0307478_1122689023300031823Hardwood Forest SoilWDHVEYVGTSADNPYALEKQIDVFICHGAKFGTLAQLWPELKRWR
Ga0306921_1153422913300031912SoilSDNPFALERNIRIFYCRGAKFGTLARIWPQLKRWR
Ga0307479_1130506423300031962Hardwood Forest SoilVEYVGTSADNPYALERDIDVFICKGAKFGTLAQLWPTVKRWR
Ga0318556_1021921733300032043SoilFQRVELVGISDNPLALERHIPVFVCRGAKFGSLAQLWPRLKFWG
Ga0307415_10034858223300032126RhizosphereEQLFEHIELVGTSDHPYALEREIPVWLCKGSKFGTLEQLWPKLKKWR
Ga0311301_1245134813300032160Peatlands SoilSDNPYALERHIPVFVCHGARFGALAELWPRLKVWD
Ga0335079_1227822213300032783SoilSVQYVGTSADNPYALETGIAVWICRGPKFGTLSELWPRIKKWR
Ga0335078_1042998013300032805SoilFDHVEMITTSAPNPYALEQQLPVYLCRGLKFGSLQQLWPQIKRWR
Ga0335078_1104950913300032805SoilPEILHQLFKSVAYIGRSNNSYALEGHIPVFLCRGAKFGSLAQIWPRLKKWD
Ga0335078_1118736923300032805SoilLFDSVQYVGTSADNPYALETGIAVWICRGPKFGTLSELWPRIKKWR
Ga0335074_1100722823300032895SoilSNVQYVGDSADNPYALEKEISVFICRGAKFGTLAQLWPELKRWR
Ga0335072_1137030423300032898SoilSNVQYVGTSADNPYALEKKIPVFICRGPKFGTMADLWPQVKKWR
Ga0335072_1173148613300032898SoilGTSEDNPYALEREIPVFICRGSKFGTLADLWPKLKKWR
Ga0326728_1078988323300033402Peat SoilRDNPYALEKELPVFICRGAKFGTLAQVWPKLKKWR
Ga0326723_0231918_685_8133300034090Peat SoilVEYVGTSADNPYALEKQIDVFLCKGAKFGTLAQLWPKVKRWR
Ga0370492_0025695_14_1423300034282Untreated Peat SoilVEYVGISADNEYAQETQIAVYICRRPKFGTLADLWPQIKRWR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.