NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F018760

Metagenome / Metatranscriptome Family F018760

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F018760
Family Type Metagenome / Metatranscriptome
Number of Sequences 233
Average Sequence Length 44 residues
Representative Sequence MNINMYVINAILILMVIRQIREHPLDLRSLAVPVLAVGCAAVLFL
Number of Associated Samples 167
Number of Associated Scaffolds 233

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 72.96 %
% of genes near scaffold ends (potentially truncated) 97.85 %
% of genes from short scaffolds (< 2000 bps) 90.13 %
Associated GOLD sequencing projects 159
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.090 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(33.906 % of family members)
Environment Ontology (ENVO) Unclassified
(41.202 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(36.481 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.42%    β-sheet: 0.00%    Coil/Unstructured: 46.58%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 233 Family Scaffolds
PF13302Acetyltransf_3 10.73
PF00291PALP 8.15
PF02806Alpha-amylase_C 1.29
PF01903CbiX 1.29
PF07366SnoaL 1.29
PF00920ILVD_EDD 0.86
PF00561Abhydrolase_1 0.86
PF02769AIRS_C 0.86
PF13676TIR_2 0.86
PF07690MFS_1 0.86
PF14117DUF4287 0.86
PF01906YbjQ_1 0.86
PF02481DNA_processg_A 0.86
PF01361Tautomerase 0.43
PF01425Amidase 0.43
PF03476MOSC_N 0.43
PF00589Phage_integrase 0.43
PF08031BBE 0.43
PF01638HxlR 0.43
PF00296Bac_luciferase 0.43
PF13560HTH_31 0.43
PF01022HTH_5 0.43
PF13380CoA_binding_2 0.43
PF01872RibD_C 0.43
PF13487HD_5 0.43
PF00931NB-ARC 0.43
PF12867DinB_2 0.43
PF16864Dimerisation2 0.43
PF01435Peptidase_M48 0.43
PF02073Peptidase_M29 0.43
PF02371Transposase_20 0.43
PF04655APH_6_hur 0.43
PF13549ATP-grasp_5 0.43
PF03729DUF308 0.43
PF00156Pribosyltran 0.43
PF00892EamA 0.43
PF00440TetR_N 0.43
PF02945Endonuclease_7 0.43
PF01734Patatin 0.43
PF00583Acetyltransf_1 0.43
PF12802MarR_2 0.43
PF03551PadR 0.43
PF06325PrmA 0.43
PF00891Methyltransf_2 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 233 Family Scaffolds
COG0758Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptakeReplication, recombination and repair [L] 1.72
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 1.72
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 1.29
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 1.29
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 1.29
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 0.86
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.86
COG2309Leucyl aminopeptidase (aminopeptidase T)Amino acid transport and metabolism [E] 0.43
COG1942Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.43
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.43
COG3217N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domainDefense mechanisms [V] 0.43
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.43
COG3547TransposaseMobilome: prophages, transposons [X] 0.43
COG3570Streptomycin 6-kinaseDefense mechanisms [V] 0.43
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.43
COG3897Protein N-terminal and lysine N-methylase, NNT1/EFM7 familyPosttranslational modification, protein turnover, chaperones [O] 0.43
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.43
COG2264Ribosomal protein L11 methylase PrmATranslation, ribosomal structure and biogenesis [J] 0.43
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.43
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.43
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.43
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.43
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.43
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.43
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.43
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.09 %
UnclassifiedrootN/A36.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559006|FI_contig09013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1075Open in IMG/M
3300002245|JGIcombinedJ26739_101187315All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300003368|JGI26340J50214_10087731Not Available808Open in IMG/M
3300004152|Ga0062386_100041354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora pleiomorpha3455Open in IMG/M
3300005187|Ga0066675_10066006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2285Open in IMG/M
3300005332|Ga0066388_103395815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia813Open in IMG/M
3300005434|Ga0070709_11644789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii523Open in IMG/M
3300005435|Ga0070714_101214427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300005436|Ga0070713_101570072Not Available639Open in IMG/M
3300005441|Ga0070700_100568754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria883Open in IMG/M
3300005441|Ga0070700_102023061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces hokutonensis500Open in IMG/M
3300005467|Ga0070706_100037326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4488Open in IMG/M
3300005467|Ga0070706_101020788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300005467|Ga0070706_101897212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii541Open in IMG/M
3300005471|Ga0070698_101482885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii629Open in IMG/M
3300005536|Ga0070697_100070228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2871Open in IMG/M
3300005543|Ga0070672_101735868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300005578|Ga0068854_100493762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1030Open in IMG/M
3300005610|Ga0070763_10925495Not Available520Open in IMG/M
3300005713|Ga0066905_100441343Not Available1067Open in IMG/M
3300005764|Ga0066903_100435625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2180Open in IMG/M
3300005764|Ga0066903_107116954All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300006028|Ga0070717_10100843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori2451Open in IMG/M
3300006028|Ga0070717_10917197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia797Open in IMG/M
3300006176|Ga0070765_100424454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1244Open in IMG/M
3300006176|Ga0070765_101589872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces615Open in IMG/M
3300006237|Ga0097621_100519179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1081Open in IMG/M
3300006358|Ga0068871_100766027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria888Open in IMG/M
3300006577|Ga0074050_11944991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia840Open in IMG/M
3300006796|Ga0066665_10910625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mobaraensis680Open in IMG/M
3300006797|Ga0066659_10765171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales795Open in IMG/M
3300006804|Ga0079221_11370872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces560Open in IMG/M
3300009672|Ga0116215_1311911Not Available683Open in IMG/M
3300009698|Ga0116216_10998567Not Available500Open in IMG/M
3300009762|Ga0116130_1249630Not Available564Open in IMG/M
3300009792|Ga0126374_10660269Not Available781Open in IMG/M
3300010048|Ga0126373_10402376Not Available1394Open in IMG/M
3300010048|Ga0126373_12867326Not Available538Open in IMG/M
3300010339|Ga0074046_10801034Not Available551Open in IMG/M
3300010371|Ga0134125_10071337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3863Open in IMG/M
3300010376|Ga0126381_104290027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia552Open in IMG/M
3300010376|Ga0126381_104771548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300010379|Ga0136449_101355198Not Available1103Open in IMG/M
3300010379|Ga0136449_101644590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300010379|Ga0136449_103421568Not Available607Open in IMG/M
3300010401|Ga0134121_11405724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
3300010401|Ga0134121_11483620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium692Open in IMG/M
3300010876|Ga0126361_11086633All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300011270|Ga0137391_11272295Not Available583Open in IMG/M
3300012189|Ga0137388_10666516All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300012199|Ga0137383_10239328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp.1330Open in IMG/M
3300012200|Ga0137382_10582776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii798Open in IMG/M
3300012209|Ga0137379_11368877Not Available612Open in IMG/M
3300012210|Ga0137378_10223830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1752Open in IMG/M
3300012211|Ga0137377_11853879Not Available521Open in IMG/M
3300012349|Ga0137387_11234171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia526Open in IMG/M
3300012350|Ga0137372_10018058All Organisms → cellular organisms → Bacteria6654Open in IMG/M
3300012354|Ga0137366_10271460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1253Open in IMG/M
3300012487|Ga0157321_1036646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii523Open in IMG/M
3300013765|Ga0120172_1123249All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300014165|Ga0181523_10479983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300014166|Ga0134079_10734082Not Available508Open in IMG/M
3300015374|Ga0132255_101017427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1243Open in IMG/M
3300016270|Ga0182036_11170040Not Available639Open in IMG/M
3300016357|Ga0182032_10888849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300016371|Ga0182034_11347074Not Available623Open in IMG/M
3300016387|Ga0182040_11375615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300016422|Ga0182039_10447184Not Available1106Open in IMG/M
3300016445|Ga0182038_10699034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium883Open in IMG/M
3300016445|Ga0182038_10763912Not Available845Open in IMG/M
3300016445|Ga0182038_11556730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus jiangxiensis594Open in IMG/M
3300017821|Ga0187812_1007361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae3812Open in IMG/M
3300017822|Ga0187802_10202257All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300017926|Ga0187807_1075256Not Available1053Open in IMG/M
3300017926|Ga0187807_1104503Not Available891Open in IMG/M
3300017926|Ga0187807_1291115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300017932|Ga0187814_10109646Not Available1020Open in IMG/M
3300017932|Ga0187814_10219760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Eremiobacterota → Candidatus Eremiobacteriia → Candidatus Eremiobacterales → Candidatus Eremiobacteraceae → Candidatus Eremiobacter → unclassified Candidatus Eremiobacter → Candidatus Eremiobacter sp. RRmetagenome_bin22716Open in IMG/M
3300017937|Ga0187809_10281224Not Available609Open in IMG/M
3300017943|Ga0187819_10218829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1120Open in IMG/M
3300017943|Ga0187819_10485688Not Available705Open in IMG/M
3300017955|Ga0187817_10171530All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300017955|Ga0187817_10265620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300017955|Ga0187817_10272114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CB013731079Open in IMG/M
3300017955|Ga0187817_11067046Not Available518Open in IMG/M
3300017966|Ga0187776_11348971Not Available541Open in IMG/M
3300017974|Ga0187777_10319383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1064Open in IMG/M
3300017995|Ga0187816_10052264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1709Open in IMG/M
3300018001|Ga0187815_10165295Not Available936Open in IMG/M
3300018007|Ga0187805_10021547Not Available2813Open in IMG/M
3300018007|Ga0187805_10648923Not Available500Open in IMG/M
3300018086|Ga0187769_10521515Not Available897Open in IMG/M
3300018088|Ga0187771_10163279Not Available1836Open in IMG/M
3300018482|Ga0066669_10251578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1398Open in IMG/M
3300021403|Ga0210397_10284929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1209Open in IMG/M
3300021406|Ga0210386_11620597All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300021475|Ga0210392_11130799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii587Open in IMG/M
3300021478|Ga0210402_10080983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2888Open in IMG/M
3300021478|Ga0210402_11610302Not Available576Open in IMG/M
3300021478|Ga0210402_11872054Not Available526Open in IMG/M
3300021560|Ga0126371_10268309Not Available1826Open in IMG/M
3300021560|Ga0126371_11709153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2568753Open in IMG/M
3300024283|Ga0247670_1040672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii837Open in IMG/M
3300025898|Ga0207692_10762198Not Available631Open in IMG/M
3300025905|Ga0207685_10608834Not Available587Open in IMG/M
3300025906|Ga0207699_10002073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae9471Open in IMG/M
3300025906|Ga0207699_10747268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii717Open in IMG/M
3300025910|Ga0207684_10006546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10610Open in IMG/M
3300025910|Ga0207684_10296941Not Available1393Open in IMG/M
3300025910|Ga0207684_11294796All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300025910|Ga0207684_11462540Not Available557Open in IMG/M
3300025915|Ga0207693_11150094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300025916|Ga0207663_10826514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia739Open in IMG/M
3300025916|Ga0207663_11373418Not Available569Open in IMG/M
3300025922|Ga0207646_11524399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii578Open in IMG/M
3300025949|Ga0207667_10381470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1436Open in IMG/M
3300026023|Ga0207677_12300381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii502Open in IMG/M
3300026041|Ga0207639_12249301Not Available507Open in IMG/M
3300026095|Ga0207676_10091880Not Available2495Open in IMG/M
3300026309|Ga0209055_1104112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1124Open in IMG/M
3300027090|Ga0208604_1001883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1977Open in IMG/M
3300027680|Ga0207826_1092034All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300027765|Ga0209073_10403068All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300027812|Ga0209656_10008379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6588Open in IMG/M
3300027812|Ga0209656_10357374Not Available663Open in IMG/M
3300027869|Ga0209579_10508468Not Available654Open in IMG/M
3300027875|Ga0209283_10763706All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300027911|Ga0209698_11244524All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300028047|Ga0209526_10659670All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300028450|Ga0189898_1026858All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium600Open in IMG/M
3300029954|Ga0311331_10460897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1259Open in IMG/M
3300031545|Ga0318541_10504827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia677Open in IMG/M
3300031549|Ga0318571_10329933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300031564|Ga0318573_10202223Not Available1053Open in IMG/M
3300031564|Ga0318573_10263452Not Available920Open in IMG/M
3300031572|Ga0318515_10734739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. WB9522Open in IMG/M
3300031573|Ga0310915_10540039Not Available828Open in IMG/M
3300031640|Ga0318555_10588360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300031680|Ga0318574_10358729Not Available850Open in IMG/M
3300031681|Ga0318572_10403506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria812Open in IMG/M
3300031682|Ga0318560_10272086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → unclassified Nitriliruptorales → Nitriliruptorales bacterium911Open in IMG/M
3300031713|Ga0318496_10568688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300031713|Ga0318496_10683112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia566Open in IMG/M
3300031718|Ga0307474_10331117Not Available1176Open in IMG/M
3300031723|Ga0318493_10067101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1740Open in IMG/M
3300031724|Ga0318500_10471910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia629Open in IMG/M
3300031744|Ga0306918_10517505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia934Open in IMG/M
3300031747|Ga0318502_10072282Not Available1863Open in IMG/M
3300031747|Ga0318502_10142361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1363Open in IMG/M
3300031748|Ga0318492_10631153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300031751|Ga0318494_10033406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2643Open in IMG/M
3300031751|Ga0318494_10076242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1815Open in IMG/M
3300031751|Ga0318494_10460121Not Available740Open in IMG/M
3300031751|Ga0318494_10812621Not Available548Open in IMG/M
3300031753|Ga0307477_10290777Not Available1129Open in IMG/M
3300031753|Ga0307477_10335998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1040Open in IMG/M
3300031765|Ga0318554_10148687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1329Open in IMG/M
3300031765|Ga0318554_10258524Not Available992Open in IMG/M
3300031765|Ga0318554_10684186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia576Open in IMG/M
3300031769|Ga0318526_10338614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300031770|Ga0318521_10628643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300031771|Ga0318546_10517557All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300031771|Ga0318546_10823225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria653Open in IMG/M
3300031778|Ga0318498_10285745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia741Open in IMG/M
3300031778|Ga0318498_10352679Not Available657Open in IMG/M
3300031779|Ga0318566_10005230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4939Open in IMG/M
3300031781|Ga0318547_10690364Not Available634Open in IMG/M
3300031782|Ga0318552_10378267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia721Open in IMG/M
3300031782|Ga0318552_10521918All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300031794|Ga0318503_10128208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium814Open in IMG/M
3300031794|Ga0318503_10179489Not Available685Open in IMG/M
3300031795|Ga0318557_10290836All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300031798|Ga0318523_10136775All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300031798|Ga0318523_10214717Not Available961Open in IMG/M
3300031798|Ga0318523_10638984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300031805|Ga0318497_10181133Not Available1160Open in IMG/M
3300031805|Ga0318497_10765259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300031819|Ga0318568_10513771Not Available747Open in IMG/M
3300031821|Ga0318567_10594626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Cj3628Open in IMG/M
3300031833|Ga0310917_10065113All Organisms → cellular organisms → Bacteria2272Open in IMG/M
3300031846|Ga0318512_10233883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia905Open in IMG/M
3300031860|Ga0318495_10169668All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300031860|Ga0318495_10521579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300031890|Ga0306925_10256165Not Available1886Open in IMG/M
3300031890|Ga0306925_12054085Not Available537Open in IMG/M
3300031890|Ga0306925_12259864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia504Open in IMG/M
3300031893|Ga0318536_10432347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia664Open in IMG/M
3300031894|Ga0318522_10068510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1281Open in IMG/M
3300031897|Ga0318520_10267314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium1024Open in IMG/M
3300031910|Ga0306923_11550865Not Available691Open in IMG/M
3300031910|Ga0306923_12291944Not Available539Open in IMG/M
3300031941|Ga0310912_11080405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria614Open in IMG/M
3300031941|Ga0310912_11271465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300031954|Ga0306926_10203929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2454Open in IMG/M
3300032001|Ga0306922_12322694Not Available514Open in IMG/M
3300032008|Ga0318562_10533272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia680Open in IMG/M
3300032009|Ga0318563_10177162All Organisms → cellular organisms → Bacteria → Terrabacteria group1147Open in IMG/M
3300032009|Ga0318563_10389666Not Available754Open in IMG/M
3300032009|Ga0318563_10449405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300032009|Ga0318563_10714277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mobaraensis538Open in IMG/M
3300032010|Ga0318569_10338248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300032039|Ga0318559_10368525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia669Open in IMG/M
3300032041|Ga0318549_10250022Not Available798Open in IMG/M
3300032052|Ga0318506_10185268Not Available917Open in IMG/M
3300032052|Ga0318506_10253989Not Available779Open in IMG/M
3300032054|Ga0318570_10074127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium1453Open in IMG/M
3300032054|Ga0318570_10463354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300032055|Ga0318575_10192739All Organisms → cellular organisms → Bacteria → Terrabacteria group1022Open in IMG/M
3300032055|Ga0318575_10316941Not Available789Open in IMG/M
3300032060|Ga0318505_10306861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia749Open in IMG/M
3300032066|Ga0318514_10006691All Organisms → cellular organisms → Bacteria4735Open in IMG/M
3300032076|Ga0306924_10574598Not Available1278Open in IMG/M
3300032076|Ga0306924_11789326All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300032076|Ga0306924_12307852Not Available545Open in IMG/M
3300032089|Ga0318525_10659653Not Available533Open in IMG/M
3300032094|Ga0318540_10489390Not Available594Open in IMG/M
3300032160|Ga0311301_11127121Not Available1017Open in IMG/M
3300032174|Ga0307470_11342518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii587Open in IMG/M
3300032205|Ga0307472_101284315Not Available704Open in IMG/M
3300032205|Ga0307472_102098846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii568Open in IMG/M
3300032261|Ga0306920_100150700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3465Open in IMG/M
3300032261|Ga0306920_101546993Not Available945Open in IMG/M
3300032261|Ga0306920_102312279Not Available744Open in IMG/M
3300032261|Ga0306920_104078250Not Available529Open in IMG/M
3300032261|Ga0306920_104338324Not Available509Open in IMG/M
3300032770|Ga0335085_10847082All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300032770|Ga0335085_12212830Not Available552Open in IMG/M
3300032782|Ga0335082_10182101Not Available2009Open in IMG/M
3300032805|Ga0335078_10102555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4127Open in IMG/M
3300032805|Ga0335078_11044823Not Available962Open in IMG/M
3300032828|Ga0335080_11990254Not Available563Open in IMG/M
3300033158|Ga0335077_12000537Not Available538Open in IMG/M
3300033290|Ga0318519_10119093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1443Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil33.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.30%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment7.73%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.15%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.29%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.29%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.29%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.86%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.86%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.43%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.43%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.43%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.43%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.43%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.43%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.43%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.43%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.43%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.43%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.43%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.43%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012487Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510Host-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300027090Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028450Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FI_000106102166559006Grass SoilMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSVPVAATTPC
JGIcombinedJ26739_10118731513300002245Forest SoilMNINMYVINAVLILMVIRQIREHPLDLRSLAVPVLAVGCAAVLFLHSV
JGI26340J50214_1008773113300003368Bog Forest SoilMNINMYVINAILVLMVVRQIREHSLDLRSLAVPVLAVGAAAVMFLHSVPG
Ga0062386_10004135413300004152Bog Forest SoilMGAVRHAGGMNINMYVTNAILVLMVVRQIREHCLDLRSLAVPVLAVGAAAVMFLHSV
Ga0066675_1006600613300005187SoilMNINMYVINAILILMVIRQIREHPLDLRSLAVPVLAVGCAAVLFL
Ga0066388_10339581523300005332Tropical Forest SoilMNNATMYVINAILVLMVIRQIREHPLDLRSLAGPVLAVGAAAVL
Ga0070709_1164478913300005434Corn, Switchgrass And Miscanthus RhizosphereMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAA
Ga0070714_10121442723300005435Agricultural SoilMNTTSAYIVNAILILLVVRQIREHPMDLRGLAGPVLAVGAAAVFFLRS
Ga0070713_10157007213300005436Corn, Switchgrass And Miscanthus RhizosphereMTMYLINALLVLLVVRQVREHQLDARALAVVLAVAAAAVMFLHAVPAGGSDITLDL
Ga0070700_10056875423300005441Corn, Switchgrass And Miscanthus RhizosphereMNINMYVINAILILMVVRQVREHPLDLRSLAVPVLAVGCA
Ga0070700_10202306113300005441Corn, Switchgrass And Miscanthus RhizosphereMSNITTYLVSASLILLVIRQIREHPLDARSLATPVLAVGAAAVMFLHSVP
Ga0070706_10003732613300005467Corn, Switchgrass And Miscanthus RhizosphereMNINMYVINAILVLMVFRQIREHRLDLRALAVPVLAVGIAAVFFLHSVPAART*
Ga0070706_10102078813300005467Corn, Switchgrass And Miscanthus RhizosphereMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSVPGGG
Ga0070706_10189721223300005467Corn, Switchgrass And Miscanthus RhizosphereMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFL
Ga0070698_10148288513300005471Corn, Switchgrass And Miscanthus RhizosphereMNINMYVINAILILMVIRQIREHPLDLRSLAVPVLAVGCAAVLFLHSVP
Ga0070697_10007022863300005536Corn, Switchgrass And Miscanthus RhizosphereMNNTSMYVINAVLVLMVIRQIREHPLDLRSLAGPVLAVGAAAVLFLHSVP
Ga0070672_10173586823300005543Miscanthus RhizosphereMSNITTYLVSASLILLVIRQIREHPLDLRSLAIPVLAVGVAAFFFLHSVPF
Ga0068854_10049376213300005578Corn RhizosphereMSNITTYLVSASLILLVIRQIREHPLDARSLAVPVLAVGAAAVMFLHSVP
Ga0070763_1092549513300005610SoilMNNITMYLINASLILLVIRQIREHPLDARSLATPV
Ga0066905_10044134323300005713Tropical Forest SoilMDTTSAYIVNGILVLLVVRQIREHRMDLRGLAGPVLAVGA
Ga0066903_10043562513300005764Tropical Forest SoilMNNATMYVINAILVLMVIRQIREHPLDLRSLAGPVLAVGAAAVLFL
Ga0066903_10711695423300005764Tropical Forest SoilMNTTSAYLVNAILVLLVVRQILWHRMDLRGLAGPVLAVGA
Ga0070717_1010084313300006028Corn, Switchgrass And Miscanthus RhizosphereMYVINAILVLMVVRQIREHRLDLQALAVPVLAVGAAAVFFLHSVPGGGNDIALEL
Ga0070717_1091719723300006028Corn, Switchgrass And Miscanthus RhizosphereVPRGTLNGMNNITMYLVNSALILMVLRQVREHPLDLRSLAGPVVAV
Ga0070765_10042445423300006176SoilMNINMYVTNAVLVLMVIRQIREHPLDLRSLAVPVLA
Ga0070765_10158987213300006176SoilMNINMYVINAVLILMVIRQIREHPLDLRSLAAPVLAVGCAAV
Ga0097621_10051917923300006237Miscanthus RhizosphereMNNISMYLVNVSLILLVIRQIREHPLDARSLATPVLAVGVAAVMFLHSVPVGG
Ga0068871_10076602713300006358Miscanthus RhizosphereMNTTSAYIVNAILILLVVRQIREHPMDLRGLAGPVLAVGAAAVFFL
Ga0074050_1194499123300006577SoilVVRQIREHSLDLRSLAVPVLAVAAAAVMFLHSVPGGGSDIALELLGVLDR*
Ga0066665_1091062513300006796SoilMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAV
Ga0066659_1076517133300006797SoilMNIYLINALLILLVVRQIREHQLDLRALAVPVLAVGAATV
Ga0079221_1137087213300006804Agricultural SoilMSNTNVYVINALLVLLVIRQIREHPLDLRSLAVPVLAVGVA
Ga0116215_131191113300009672Peatlands SoilMNINMYVINAILVLMVVRQIREHSLDLRSLAVPVL
Ga0116216_1099856723300009698Peatlands SoilMNTTSAYIVNAILVLLVVRQIREHRMDLSSLAGPVLAVAAAA
Ga0116130_124963013300009762PeatlandMNNITMYLINASLILLVIRQIREHPLDARSLMAPVLAVGCAAVLFLHSVP
Ga0126374_1066026913300009792Tropical Forest SoilMSNITTYLISASLILLIIRQIREHPLDARSLATCKGSITG*
Ga0126373_1040237623300010048Tropical Forest SoilMDTTSAYIVNAILVLLVVRQIREHRMDLRGLAGPVLAVAAAAVFFLR
Ga0126373_1286732613300010048Tropical Forest SoilMTTTTAYLVNALLVLLVVRQVLWHRMDLRGLAGPV
Ga0074046_1080103413300010339Bog Forest SoilMGAVRHAGGMNINMYVINAILVMMVVRQIREHSLDLRALAVPVLAVGAAAVMF
Ga0134125_1007133763300010371Terrestrial SoilMNNTSMYVINAVLVLMVIRQIREHPLDLRSMAGPVLAVGAAAALFLHSV
Ga0126381_10429002733300010376Tropical Forest SoilMSNINVYVVNALLVLMVIRQIREHPLDLRSLAIPVLAVGVAAALFLHSV
Ga0126381_10477154813300010376Tropical Forest SoilMNNATMYVINAILVLMVIRQIREHPLDLRSLAGPVL
Ga0136449_10135519813300010379Peatlands SoilMSSINVYVINALLVLLVIRQIREHPLDLRSLAIPVLAV
Ga0136449_10164459013300010379Peatlands SoilMSMNMYLINAILVLMVIRQIREHSLDLRALAVPVLAVA
Ga0136449_10342156813300010379Peatlands SoilMNINVYVINAILILMVVRQIREHPLDLRSLAIPVLAVGVAAVLFLHSVPLGGSDAVLE
Ga0134121_1140572423300010401Terrestrial SoilMNTTTMYVINAVLVLMVIRQIREHPLDLRSLAGPVLAVGAAAVLFL
Ga0134121_1148362013300010401Terrestrial SoilMSNINVYVINALLVLLVIRQIREHPLDLRSLAIPVLAVGVAAFF
Ga0126361_1108663323300010876Boreal Forest SoilMNINMFVINAVLILMVIRQIREHALDLRSLAAPVLAVGCAAVLFLHSVPGCGPEL*
Ga0137391_1127229523300011270Vadose Zone SoilMNNTTMYVINAILVFMVIRQIREHPLDLRSLAGPVLAVG
Ga0137388_1066651613300012189Vadose Zone SoilMNINMYLINVALILLVIRQIREHPLDLRSLAVPVLAVGCAA
Ga0137383_1023932833300012199Vadose Zone SoilMNIYLINALLVLFVLRQIREHQLDLRALAVPVVAAA
Ga0137382_1058277623300012200Vadose Zone SoilMNINMYVINAILILMVIRQIREHPLDLRSLAIPVLAV
Ga0137379_1136887713300012209Vadose Zone SoilMNNITTYLVSASLILLVIRQIREHPLDARSLATPVLAVA
Ga0137378_1022383013300012210Vadose Zone SoilMNIYLVNALLILLVVRQIREHQLHLRALAVPVLAVAAAAVMFLHA
Ga0137377_1185387913300012211Vadose Zone SoilMSINMYVINAILILMVIRQIREHPLDARSLAAPVLAVAAAA
Ga0137387_1123417123300012349Vadose Zone SoilMNNITTYLISASLILLVIRQIREHPLDARSLATPVLAVAAAAVMF
Ga0137372_1001805853300012350Vadose Zone SoilMNIYLINAVLILLVVRQIREHQLDARALAVPVLAVAAAAVMFLHSVPG
Ga0137366_1027146023300012354Vadose Zone SoilMSNITTYLVSASLILLVIRQIREHPLDARSLATPVLAVGAAAVMFLHAVP
Ga0157321_103664623300012487Arabidopsis RhizosphereMNINMYVINAILILMVVRQVREHPLDLRSLAVPVLAVGC
Ga0120172_112324923300013765PermafrostMLAFMNTTSMYVINAILVLLVVRQIRERRLDLRGLAGRFT
Ga0181523_1047998313300014165BogMGAVRHADGMNINMYVINAILVLMVVRQIREHSLDLRALAVPVLAVGAAAVMFLHSVP
Ga0134079_1073408213300014166Grasslands SoilMNNFSMYLINASLILLVIRQIREHPLDARSLAVPALAVGCAAVMFLHSVPVG
Ga0132255_10101742723300015374Arabidopsis RhizosphereMNIYLINALLVLLVVRQIREHQLDLRVLAVPVLAVPVLAVPVLAV
Ga0182036_1117004013300016270SoilMSNINVYVINALLVLLVIRQIREHPLDLRSLAIPVLAVGAAAVLFLRSVP
Ga0182032_1088884913300016357SoilMNTISMYVINAALVLMVIRQIREHPLDLRSLAVPVLAVGAAAALFLHSVPVS
Ga0182034_1134707423300016371SoilMNIYLINALLILLVVRQVREHQLDLWALAVPVLAVAAA
Ga0182040_1137561513300016387SoilMNINMYVINAILILMVIRQIREHPLDLRSLAVPVLAV
Ga0182039_1044718423300016422SoilMNIYLINALLILLVVRQVREHQLDLWALAVPVLAVA
Ga0182038_1069903423300016445SoilMNINMYVVNAVLILLVVRQVREHPLDLRSLAVPVLAVGVAAVL
Ga0182038_1076391223300016445SoilMSNITTYLISASLILLVIRQIREHPLDARSLATPVLAVGA
Ga0182038_1155673013300016445SoilMNNITTYLISASLILLVIRQIREHPLDVRSLAVPVLAVGAAAVMFLHAVPAGGSD
Ga0187812_100736113300017821Freshwater SedimentMNINMYVINAVLILMVIRQIREHPLDLRSLAAPVLAVSCAAVLFL
Ga0187802_1020225713300017822Freshwater SedimentMNINVYVINAILVLMVIRQIREHPLDLRSLAVPVLAVGAA
Ga0187807_107525613300017926Freshwater SedimentMNNITMYLVNAILILMVIRQIREHPLDARSLATPVLAVGCAAVLFLHSVP
Ga0187807_110450313300017926Freshwater SedimentMSINMYVINAILVLMVIRQVREHPLDLRSLAASVLAVGAAAV
Ga0187807_129111523300017926Freshwater SedimentMNIYLINALLVLLVVRQIREHQLDARALAVPVLAVAAAAVMF
Ga0187814_1010964613300017932Freshwater SedimentMNIYLINALLVLLVIRQVREHQLDLRALAVPVAAVAAAAVLFLHSVPS
Ga0187814_1021976013300017932Freshwater SedimentMNINMYVINAVLVLMVIRQIREHPLDLRSLAVPVLAV
Ga0187809_1028122413300017937Freshwater SedimentMNIYLINALLVLLVVRQIREHQLDLRALAVPVLAVGA
Ga0187819_1021882913300017943Freshwater SedimentMYVINAILVLMVIRQIREHPLDLRAVAVPVLAVGC
Ga0187819_1048568813300017943Freshwater SedimentMNNITMYLINAILILMVIRQIREHPLDARSLVAPVLAVGCAAVLFLHSVP
Ga0187817_1017153043300017955Freshwater SedimentMNIYLINALLVLLVICQVREHQLDLQALAVPVAAV
Ga0187817_1026562013300017955Freshwater SedimentMGAVRHADGMNINMYVINAILVLMVVRQIREHSLDLRSLAVPVLAVGAAAVMFLHSV
Ga0187817_1027211413300017955Freshwater SedimentMNINMYVINAILVLMVVRQIRERSLDLRSLAVPVLAVAAAAVMFLHSVPGGGNDLALEL
Ga0187817_1106704613300017955Freshwater SedimentMYVINAILVLMVVRQIREHPLDLRSLAAPVFAVGCAAVLFLHSVPAG
Ga0187776_1134897113300017966Tropical PeatlandMNIYLINALLVLLVVRQIREHQLDLRALAVPVLAV
Ga0187777_1031938333300017974Tropical PeatlandMSNINVYVINALLILMVIRQIREHPLDLRSLAGPVLAVGVAAILFLHSVPLGG
Ga0187816_1005226413300017995Freshwater SedimentMNINVYVINAILVLMVIRQIREHPLDLRFLAVPLLAVGAAAALFLHSVPL
Ga0187815_1016529533300018001Freshwater SedimentMNINVYVINAVLVLMVIRQIREHALDLRSLAVPVLAVGVA
Ga0187805_1002154713300018007Freshwater SedimentMNINVYVINAILILMVVRQIREHPLDLRSLAIPVLAVGVAAVLFLHSVP
Ga0187805_1064892313300018007Freshwater SedimentMNNITMYLINAILILMVIRQIREHPLDARSPVAPVLAVGCAA
Ga0187769_1052151523300018086Tropical PeatlandMSNITTYLISASLILLVIRQIREHSLDARSLAVPVLAVGAAAV
Ga0187771_1016327943300018088Tropical PeatlandMARHCSGMNINVYVVNAVLILLVIRQVREHPLDLRSMGVPVLAVGVAAVLFLHSVPL
Ga0066669_1025157833300018482Grasslands SoilMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVG
Ga0210397_1028492923300021403SoilMNNTTMYVINAVLVLMVVRQIREHPLDLRSLAGPVLAVGAAAVLFLHSVPGGGTD
Ga0210386_1162059723300021406SoilMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSL
Ga0210392_1113079913300021475SoilMNINMYVINAILILMVIRQVREHPLDLRSLAVPVL
Ga0210402_1008098343300021478SoilMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLF
Ga0210402_1161030223300021478SoilMNINVYVINAILILMVVRQIREHPLDLRSLAIPVLAVGVAAVLFLHSVPLGG
Ga0210402_1187205413300021478SoilMNTISAYIVNAILVLLVVRQIREHRMDLRGLAGPVLAVGAAAV
Ga0126371_1026830923300021560Tropical Forest SoilMSNINVYVINALLVLLVIRQIREHPLDLRSLAIPVLAVG
Ga0126371_1170915313300021560Tropical Forest SoilMNNITMYLVNASLILLGIRQIREHPLDARSLMAPVLAVGCAAVLFLHSVPA
Ga0247670_104067213300024283SoilMNINMYVINAILILMVVRQVREHPLDLRSLAVPVLAVAAP
Ga0207692_1076219823300025898Corn, Switchgrass And Miscanthus RhizosphereMNINMYVINAILILMVIRQIREHPLDLRSLAVPVL
Ga0207685_1060883413300025905Corn, Switchgrass And Miscanthus RhizosphereMSNITMYLVSASLILLVIRQIREHPLDARSLATPVLAVGAAAV
Ga0207699_1000207393300025906Corn, Switchgrass And Miscanthus RhizosphereMNNTSMYVINAVLVLMVIRQIREHPLDLRSLAGPVL
Ga0207699_1074726813300025906Corn, Switchgrass And Miscanthus RhizosphereMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAALFLHSVPGG
Ga0207684_1000654683300025910Corn, Switchgrass And Miscanthus RhizosphereMNINMYVINAILVLMVFRQIREHRLDLRALAVPVLAVGIAAVFFLHSVPAART
Ga0207684_1029694123300025910Corn, Switchgrass And Miscanthus RhizosphereMDNITMYLVNASLILLVIRQIREHPLDARSLMAPVLAVGCAAVMFLHS
Ga0207684_1129479613300025910Corn, Switchgrass And Miscanthus RhizosphereMNVNMYVINAILILMVIRQVREHPLDLRSLAVPVLAVG
Ga0207684_1146254013300025910Corn, Switchgrass And Miscanthus RhizosphereMSNITTYLVSASLILLVIRQIREHPLDARSLATPVLAVGAAAV
Ga0207693_1115009423300025915Corn, Switchgrass And Miscanthus RhizosphereMNNTSMYVINAVLVLMVVRQIREHPLDLRSLAGPVLAV
Ga0207663_1082651423300025916Corn, Switchgrass And Miscanthus RhizosphereMNTTSAYIVNAFLILLVVRQIREHPMDLRGLAGPVLVVGTAAVFFLHSVPA
Ga0207663_1137341813300025916Corn, Switchgrass And Miscanthus RhizosphereMNTATMYVINAILVLMVIRQIREHPLDLRSLAGPV
Ga0207646_1152439913300025922Corn, Switchgrass And Miscanthus RhizosphereMNINMYVINAILILMVVRQVREHPLDLRSLAVPVLAVGCAAVLFLH
Ga0207667_1038147013300025949Corn RhizosphereMNINMYVINAILILMVVRQVREHPLDLRSLAVPVLAVGCAAVLFLHSV
Ga0207677_1230038123300026023Miscanthus RhizosphereMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSVP
Ga0207639_1224930113300026041Corn RhizosphereMSNINVYVINALLVLLVIRQIREHPLDLRSLAIPVLAV
Ga0207676_1009188013300026095Switchgrass RhizosphereMNTTSAYIVNAILILLVVRQIREHPMDLRGLAGPVLAVGAAAVFFLR
Ga0209055_110411213300026309SoilMNIYLINALLILLVVRQIREHQLDLRALAVPVLAVAAAAVMFLHAVPA
Ga0208604_100188313300027090Forest SoilMSSINVYVVNAILILMVVRQIREHPLDLRSMAIPVLAVGAAAFLFLHSVPLGGHDVALEA
Ga0207826_109203423300027680Tropical Forest SoilMSSINVYVINALLVLMVIRQIREHPLDLRNLAIPVLAVGVTAALFLHSVPLGG
Ga0209073_1040306813300027765Agricultural SoilMNNISMYLVNVSLILLVIRQIREHPLDARSLATPVLAVGVAAVMFLH
Ga0209656_1000837913300027812Bog Forest SoilMNIYLINALLVLLVVRQIREHQLDLRALAVPVLAVGAAAV
Ga0209656_1035737413300027812Bog Forest SoilMNINMYVINAVLILMVIRQIREHPLDLRSLAVPVLAVGCAA
Ga0209579_1050846813300027869Surface SoilMNNISVYLVNASLILLVIRQIREHSLDARSLATPVLAVAAAAVLFL
Ga0209283_1076370623300027875Vadose Zone SoilMNNITMYVINSALILMVLRQVREHPLDLRSLAGPVVAVGVAAVLF
Ga0209698_1124452413300027911WatershedsMNINMYVINAVLILMVIRQIREHPLDLRSLAAPVLAVGCAAVLF
Ga0209526_1065967023300028047Forest SoilMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSVPGGGNDVQ
Ga0189898_102685813300028450Peatlands SoilMNINVYVINALLILMVIRQIREHRLDLRSLSVPLLA
Ga0311331_1046089713300029954BogMNNITMYLINASLILLVIRQIREHPLDARSLMAPVL
Ga0318541_1050482713300031545SoilMGMNINVYVINAILVLMVVRQIREHPLDLRSLAIPVLAVGAAAV
Ga0318571_1032993313300031549SoilMNINVYVINAILVLLVVRQIREHPLDLRSLAIPVLAVGAAAV
Ga0318573_1020222323300031564SoilMSNITTYLISAGLILLVIRQIREHPLDARSLATPVLAVAAAAVMFLH
Ga0318573_1026345213300031564SoilMSNITTYLISASLILLVIRQIREHPLDARSLATPVLAVGAAAVMF
Ga0318515_1073473923300031572SoilMNIYLINALLVLLVVRQIREHQLDLRALAIPVLAVVAAAVMFLH
Ga0310915_1054003913300031573SoilMSNINVYVINALLVLMVIRQIREHPLDLRNLAIPVLAVGAAAAL
Ga0318555_1058836013300031640SoilMNTISMYVINAALVLMVIRQIREHPLDLRSLAVPVLAVG
Ga0318574_1035872933300031680SoilMSNFNVYLINALLVLMVIRQIREHPLDLRNLAIPVLAVGAAAALFLL
Ga0318572_1040350613300031681SoilMTTATMYVINAILVLMVIRQIREHPLDVRSLAGPVLAVGAAAVLFLRS
Ga0318560_1027208613300031682SoilMNIYLINALLILLVVRQIREHQLDLRALAVPVLAVAAAAVMFLHAGQV
Ga0318496_1056868813300031713SoilMTTATMYVINAILVLMVIRQIREHPLDLRSLAGPVL
Ga0318496_1068311213300031713SoilMSNITTYLVSASLILLVIRQIREHPLDARSLATPVLA
Ga0307474_1033111723300031718Hardwood Forest SoilMNNITVYLINASLILLVIRQIREHPLDARSLMAPVLAVG
Ga0318493_1006710113300031723SoilMNINMYVINAILILMVVRQIREHPLDLRSMAAPVIAVGAAAVLFLRSVPL
Ga0318500_1047191013300031724SoilMNIYLINALLVLLVVRQVREHQLDARALAIPVLAVAA
Ga0306918_1051750513300031744SoilMNTATMYVINAILVLMVIRQIREHPLDFRSLAGPVLAVGAAAVL
Ga0318502_1007228243300031747SoilMNINVYVINAILVLMVIRQIREHSLDLRSLAIPVLAVGAAAVLF
Ga0318502_1014236133300031747SoilMKDINVYVINALLVLMVVRQIREHPLDLRNLAIPV
Ga0318492_1063115313300031748SoilMNNTTMYVINAILVLLVIRQVREHPLDLRSLAGPVLAVGAAAVLF
Ga0318494_1003340613300031751SoilMTTATMYVINAILVLMVIRQIREHPLDLRSLAGPV
Ga0318494_1007624233300031751SoilMNINVYVINAILVLMVVRQIREHPLDLRSLAIPVLAVGAAAVLFLH
Ga0318494_1046012113300031751SoilMSNITTYLISAGLILLVIRQIREHPLDARSLATPVLA
Ga0318494_1081262113300031751SoilMSNINVYVINALLVLMVIRQIREHPLDLRSLAIPVLAVGVAAAL
Ga0307477_1029077713300031753Hardwood Forest SoilMNNISVYLINASLILLVIRQIREHPLDARSLATPVL
Ga0307477_1033599813300031753Hardwood Forest SoilMTNITMYLINASLILLVIRQIREHPLDARSLATPVLAVGC
Ga0318554_1014868733300031765SoilMNNTTMYVINAVLVLMVIRQIREHPLDLRSLAGPVLAVGAAAVLFLH
Ga0318554_1025852413300031765SoilMNNITTYLVSASLILLVIRQIREHPLDARSLAVPVLA
Ga0318554_1068418613300031765SoilMNNITTYLISASLILLVIRQIREHPLDTRSLAVPVLAVGAAAVMFLH
Ga0318526_1033861413300031769SoilMTTATMYVINAILVLMVIRQIREHPLDLRSLAGPVLA
Ga0318521_1062864313300031770SoilMGMNINVYVINAILVLMVVRQIREHPLDLRSLAIPVLAVGAAAVLFLH
Ga0318546_1051755713300031771SoilMNIYLINALLVLLVVRQIREHQLDARALAIPVLAVAAA
Ga0318546_1082322513300031771SoilVHADGMNNTTMYVINAILVLLVIRQIREHPLDLRSLAGPVLAVGAAAVLFL
Ga0318498_1028574523300031778SoilMSNITTYLVSASLILLVIRQIREHPLDARSLATPVLAVGAAAVMFLHSVPAD
Ga0318498_1035267913300031778SoilMNIYLINALLVLLVIRQIREHQLDARALAIPVLAVAAAAVMFLHA
Ga0318566_1000523013300031779SoilMNNTTMYVINAVLVLMVIRQIREHPLDLRSLAVPVLAVGAAAALF
Ga0318547_1069036413300031781SoilMNINVYVINAILVLMVVRQIREHPLDLRSLAIPVLAVGAAAVLFLHSVPLGGN
Ga0318552_1037826723300031782SoilMNIYLINALLVLVVIRQIREHQLDTRALAVPVLAVAAAAVMFLHAVPG
Ga0318552_1052191823300031782SoilMNINMYVINAILILMVVRQIREHPLDLRSMAAPVIAVGAAAVLFLHSVPLGGSDIALEAA
Ga0318503_1012820823300031794SoilMNINMYVVNAVLILLVVRQVREHPLDLRSLAVPVLAVGVAAVLFLH
Ga0318503_1017948923300031794SoilMNINVYVINAILVLMVIRQTREHPLDLRSLAIPVLAVGAAAVLFLHSVPLGGNDI
Ga0318557_1029083613300031795SoilMNIYLINALLVLLVVRQIREHQLDARALAIQDLAV
Ga0318523_1013677533300031798SoilMSNINVYVINALLVLLVIRQIREHPLDLRSLAIPVLAVGAAAVLFLRSV
Ga0318523_1021471713300031798SoilMSNITTYLISASLILLVIRQIREHPLDARSLATPVLAVGAAAV
Ga0318523_1063898423300031798SoilMSNINVYVINALLVLMVIRQIREHPLDLRSLAIPVLAVGVAAVLFLRSVP
Ga0318497_1018113323300031805SoilMNIYLINALLVLLVVRQIREHQLDARALAVPVLAVAAAAVMFLHAVPGGGHG
Ga0318497_1076525923300031805SoilMNTATMYVINAVLVLMVIRQIREHPLDLRSLAVPVLA
Ga0318568_1051377113300031819SoilMNNITTYLISASLILLVIRQIREHPLDTRSLAVPVLAVGAAAVM
Ga0318567_1059462623300031821SoilMNNITTYLISASLILLVIRQIREHPLDTRSLAVPVLADLADDQE
Ga0310917_1006511313300031833SoilMNIYLINALLILLVVRQIREHQLDLRALAVPVLAVAAAAVMFLHTVP
Ga0318512_1023388323300031846SoilMNTITMYVINAILVLMVIRQIREHPLDLRSLAVPVLAVGAAAV
Ga0318495_1016966823300031860SoilMNINMYVINAILILMVVRQIREHPLDLRSMAAPVIAVGAAAVLFLRSVPIGGSDIALE
Ga0318495_1052157923300031860SoilVHADGMNNTTMYVINAILVLLVIRQIREHPLDLRSLAGPVLAVGAAAVLF
Ga0306925_1025616523300031890SoilMSNITTYLISAGLILLVIRQIREHPLDARSLATPVLAVAAAAVMFLHSVPAGGS
Ga0306925_1205408513300031890SoilMNNITTYLVSASLILLVIRQIREHPLDARSLAVPVLAVGAAAVMFLHSVPAGGS
Ga0306925_1225986413300031890SoilMNINVYVINAILVLMVVRQIREHPLDLRSLAIPVLAVGAAAVLFLHSVPLGGNDV
Ga0318536_1043234713300031893SoilMNINVYVINAILVLMVVRQIREHPLDLRSLAIPVLAVGAAAVLFLHSV
Ga0318522_1006851033300031894SoilMNINMYVINAILILMVIRQIREHPLDLRSLAVPVLAVG
Ga0318520_1026731423300031897SoilMSNITTYLISAGLILLVIRQIREHPLDARSLATPVLAV
Ga0306923_1155086523300031910SoilMAHGSGMKDINVYVINALLVLMVVRQIREHPLDLRNLAIPVLAVGAAA
Ga0306923_1229194413300031910SoilMSNINVYVINALLVLMVIRQIREHPLDLRSLGIPVLAVGAAAALFLHSVP
Ga0310912_1108040513300031941SoilMNTITMYVINAILVLMVIRQIREHPLDLRSLAVPVLAVGAAAALFLHSVPVSG
Ga0310912_1127146523300031941SoilMNTATMYVINAVLVLMVIRQIREHPLDLRSLAGPVLA
Ga0306926_1020392963300031954SoilMNNTTMYVINAVLVLMVIRQIREHPLDLRSLAGPV
Ga0306922_1232269413300032001SoilMNIYLINALLVLLVVRQVREHQLDARALAIPVLAVAAAAVMFLH
Ga0318562_1053327223300032008SoilMKDINVYVINALLVLMVIRQIREHPLDLRNLAIPVLAVGAAAALF
Ga0318563_1017716223300032009SoilMNINMYVVNAVLILLVVRQVREHPLDLRSLAVPVLAVGVAAVLF
Ga0318563_1038966613300032009SoilMSNITTYLISAGLILLVIRQIREHPLDARSLATPVLAVA
Ga0318563_1044940523300032009SoilMNTATMYVINAILVLMVIRQIREHPLDLRSLAVPVLAVGAAAALFL
Ga0318563_1071427713300032009SoilMKDINVYVINALLVLMVVRQIREHPLDLRNLAIPVLAVGAAAALFLRSVPLGGNDIA
Ga0318569_1033824813300032010SoilVHADGMNNTTMYVINAILVLLVIRQIREHPLDLRSLA
Ga0318559_1036852513300032039SoilMNIYLINALLVLLVIRQIREHQLDARALAVPVLAVAA
Ga0318549_1025002233300032041SoilMSNFNVYLINALLVLMVIRQIREHPLDLRNLAIPVLAVGAAAA
Ga0318506_1018526823300032052SoilMSNITTYLISASLILLVIRQIREHPLDARSLATPVLAVGAADG
Ga0318506_1025398923300032052SoilMNINVYVINAILVLMVIRQIREHPLDLRSLAIPVLAVGAAAVLF
Ga0318570_1007412713300032054SoilMSNITTYLISAGLILLVIRQIREHPLDARSLATPVLAVGAAAVMFLHSVPAGGSDL
Ga0318570_1046335413300032054SoilMNNTTMYVINAVLVLMVIRQIREHPLDLRSLAGPVLAVGAAAVLFLHSVP
Ga0318575_1019273933300032055SoilMNNITTYLISASLILLVIRQIREHPLDVRSLAVPVLA
Ga0318575_1031694123300032055SoilMSNITTYLISASLILLVIRQIREHPLDARSLATPVLAVGAAAVMFLHSVPVGGSD
Ga0318505_1030686133300032060SoilMKDINVYVINALLVLMVVRQIREHPLDLRNLAIPVLAVGAAA
Ga0318514_1000669153300032066SoilMNIYLINALLILLVVRQIREHQLDLRALAVPVLAVAAAAVMFLHAVPS
Ga0306924_1057459833300032076SoilMNINVYVINAILVLMVIRQTREHSLDLRSLAIPVLAVGAAAVLFLHSVPLGE
Ga0306924_1178932613300032076SoilMNINMYVINAILILMVIRQIREHPLDARSLAAPVLAV
Ga0306924_1230785213300032076SoilMNTTTAYLVNAILVLLVVRQVFWHRMDLRGLAGPVLAVGAAA
Ga0318525_1065965313300032089SoilMSNINVYVINALLVLMVIRQIREHPLDLRSLALPVLAVGVAAVLFLH
Ga0318540_1048939013300032094SoilMSNITTYLISASLILLVIRQIREHPLDARSLATPVLAVGAAAVMFLH
Ga0311301_1112712123300032160Peatlands SoilMNMYLINAILVLMVIRQIREHSLDLRVLAVPVLAVAA
Ga0307470_1134251813300032174Hardwood Forest SoilMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSVPG
Ga0307472_10128431513300032205Hardwood Forest SoilMSNINVYVINALLVLLVIRQIREHPLDLRSLAVPVLAVGVAAV
Ga0307472_10209884613300032205Hardwood Forest SoilMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGCAAVLFLHSVPAGGNDIVLEL
Ga0306920_10015070013300032261SoilMNIYLINALPVLLVVRQIREHQLDARAMAVPVLAVAAA
Ga0306920_10154699313300032261SoilMNINVYVINAILVLMVIRQIREHPLDLRSLAIPVLAVGAAAVL
Ga0306920_10231227923300032261SoilMSSVSVYVINALLVLLVIRQIREHPLDLRSLAVPVLAV
Ga0306920_10407825013300032261SoilMNINVYVINAILILMVVRQIREHPLDLRSLAIPVLAV
Ga0306920_10433832413300032261SoilMSNITTYLISASLILLVIRQIREHPLDARSLAVPVLAVGAAAV
Ga0335085_1084708213300032770SoilMNINMYVINAILILMVIRQVREHPLDLRSLAVPVLAVGC
Ga0335085_1221283023300032770SoilMGAGQHASGMHNITMYLTNAILILMVIRQIREHPLDARSLAGPVLAVSAAA
Ga0335082_1018210113300032782SoilMNINMYVINAILILMVVRQIREHPLDLRSMAAPVI
Ga0335078_1010255513300032805SoilMSNITTYLVSASLILLVIRQIREHPLDARSLAVPVLA
Ga0335078_1104482323300032805SoilMSNINVYVINALLVLLVIRQIREHPLDLRSLAIPV
Ga0335080_1199025413300032828SoilMNIYLINALLVLLVIRQIREHQLDLRALAVPVLAVGAAAMMFLHAVPG
Ga0335077_1200053713300033158SoilMSNITTYLISAGFILLVIRQIREHPLDARSLANPVLAVGAAAVMFLHSVPA
Ga0318519_1011909313300033290SoilVHADGMNNTTMYVINAILVLLVIRQIREHPLDLRSLAGPVLAVGAAAVLFLHSVP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.