 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F018757 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 233 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MPVTIEIPTAFRRFTDGAPKVDCSAATVAEALNELTSRFPDLSR |
| Number of Associated Samples | 189 |
| Number of Associated Scaffolds | 233 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.14 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.13 % |
| Associated GOLD sequencing projects | 175 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (75.966 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.888 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.609 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.931 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.78% β-sheet: 11.11% Coil/Unstructured: 61.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 233 Family Scaffolds |
|---|---|---|
| PF00291 | PALP | 87.12 |
| PF13365 | Trypsin_2 | 0.86 |
| PF00881 | Nitroreductase | 0.43 |
| PF00171 | Aldedh | 0.43 |
| PF01196 | Ribosomal_L17 | 0.43 |
| PF02322 | Cyt_bd_oxida_II | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 233 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.43 |
| COG0203 | Ribosomal protein L17 | Translation, ribosomal structure and biogenesis [J] | 0.43 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.43 |
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.43 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 75.97 % |
| All Organisms | root | All Organisms | 24.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.15% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.43% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.15% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.29% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.29% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.86% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.43% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.43% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.43% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.43% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.43% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.43% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000729 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026988 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033810 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A01DRAFT_10469382 | 3300000580 | Forest Soil | MPVTIEIPPAFRRFTEGAPKVDCSASTVAEALDALTKR |
| JGI12371J11900_10134192 | 3300000729 | Tropical Forest Soil | MAVTIEIPTAFRRFTDGEQHVSSGAATVSEALNDLTARFP |
| JGI1027J11758_116395921 | 3300000789 | Soil | MAVTIEIPTAFRKFTDGTPKLDCNATTIAEALNILTDQFPGLSRHVRDDQ |
| JGI1027J11758_123183001 | 3300000789 | Soil | MAITIEIPTAFRRFTEGAPKVESGATTVAEALNDLTA |
| JGI12635J15846_102446731 | 3300001593 | Forest Soil | MPVTIEIPTAFRRFTDGAPKVDCSAHTIAEALTELTARFPDLSRHV |
| JGI12635J15846_106632302 | 3300001593 | Forest Soil | MPVTIEIPTAFRRFTEGTPKVDCSAATIADALNEL |
| JGIcombinedJ26739_1013247271 | 3300002245 | Forest Soil | MPVIIEIPTAFRRFTDGQPKVDCSAVTIAEALNQLTAKFPDLGXH |
| JGI25384J37096_101889491 | 3300002561 | Grasslands Soil | MPVTIEIPTAFRRFTDGLPRVDCSAGTIADALNDLTARFPALSRHIRDD |
| JGI25614J43888_100786962 | 3300002906 | Grasslands Soil | MSITIEIPTAFRRFTEGSPKVDTAATTVAEALTDLTAKFPALSRHV |
| JGI26339J46600_100060171 | 3300003218 | Bog Forest Soil | MAITIEIPTAFRRFTDGIPKLDSAASTVAEALNDLTARYPALSR |
| JGI26339J46600_101276642 | 3300003218 | Bog Forest Soil | MAITIEIPSAFRRFTDGIPKLDSAAATVADALNDLTARYPALSRHV |
| JGI26346J50198_10032021 | 3300003351 | Bog Forest Soil | MPVTIEIPTAFRRFTDGTPKIXCSATTIAEALNDLTRRFPDLS |
| Ga0062385_100848491 | 3300004080 | Bog Forest Soil | MPVTIEIPTAFRRFTAGAPKIDCSAGTIAEALNNLTARFPDLSRHVRGED |
| Ga0062384_1008438212 | 3300004082 | Bog Forest Soil | MPVIIEIPTAFRRFTEGAPKIDCSAATVAAALAELTTRFPALSRH |
| Ga0062387_1001691052 | 3300004091 | Bog Forest Soil | MPVTIEIPTAFRRFTAGTPKIDCSATTIAEALNDLTTRFP |
| Ga0066395_106430801 | 3300004633 | Tropical Forest Soil | MAITIEIPTAFRKFTDGSPKYSCSAATVAEALNVLTAQFPGLGKHVRDD |
| Ga0062591_1017748981 | 3300004643 | Soil | MPVTIEIPTAFRRFTDGAPKVDCTATTIADALKELTTRFPDL |
| Ga0066673_100296454 | 3300005175 | Soil | MPVTIEIPTAFRRFTDGAPKVDCSAATIADALNELTSRFP |
| Ga0070667_1012940431 | 3300005367 | Switchgrass Rhizosphere | MAVTIEIPTAFRRFTDGTPKFDCNAATIAEALNILTTQFPGLSRHVRDDQG |
| Ga0070699_1009009641 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVTIEIPTAFRRFTDGAPKLDCNAATIAEALNILTAQFPGLSRH |
| Ga0070730_106775082 | 3300005537 | Surface Soil | MPVTIEIPTAFRRFTDGTPKIDCSAATIADALNDLTARFPALA |
| Ga0066701_107677782 | 3300005552 | Soil | MPVTIEIPTAFRRFTDGAPRVDCSASTVAEALDTLT |
| Ga0066692_105027501 | 3300005555 | Soil | MPVTIEIPTAFRRFTDGAPRVDCSAATVADALNELTSRF |
| Ga0066704_100526403 | 3300005557 | Soil | MPVTIEIPTAFRRFTDGAPRVDCSASTVAEALDTLTKRFPGLSRHVRDDSGQI |
| Ga0066704_100948182 | 3300005557 | Soil | MSVTIEIPTAFRRFTNGAPKVDCSAATVADALNELTSRFPDLGRH |
| Ga0066670_103407521 | 3300005560 | Soil | MFEEDLQPMPVTIEIPAAFRRFTGGAPKVDCSAETVAEALDALTKRF |
| Ga0066703_101193552 | 3300005568 | Soil | MAVTIEIPTAFRRFTDGTPKLDCNAATIAEALNILTAQFP |
| Ga0066703_107636632 | 3300005568 | Soil | MPVIIEIPTAFRRFTKGAPKVDCSAATVAEALNELT |
| Ga0066691_105191922 | 3300005586 | Soil | MAVTIEIPTAFRRFTDGAPKVDCSAATIAEALNVLTSRFPDLGRH |
| Ga0070762_102724903 | 3300005602 | Soil | VAITIEIPTAFRRFTDGVPKLDSAASTITEALNDLTTRYPALSRHVRD |
| Ga0066790_105300152 | 3300005995 | Soil | MPVIIEIPTAFRRFTDGQPKIDCSAVTVAEALNQLTAKFPD |
| Ga0066651_103860422 | 3300006031 | Soil | MAITIEIPTAFRRFTDGSPKYSCSATTVAEALNVLTSQFPG |
| Ga0075017_1004658121 | 3300006059 | Watersheds | MAVTIEIPTAFRRFTDGQPQVSSGAATVLEDLNDLTARYPAISRHVRDEQGQI |
| Ga0070765_1008491682 | 3300006176 | Soil | MPVTIEIPTAFRRFTDGAPKVDCTAATIAEALNTLTARFPELGRHVR |
| Ga0079222_109426041 | 3300006755 | Agricultural Soil | MPVTIEIPTAFRRFTDGAPKVDCSAATIADALNEL |
| Ga0079220_111496942 | 3300006806 | Agricultural Soil | MPITIEIPTAFRRFTDGAPKYDCSAATVAEALNDLTAKFPALSRHVRDEQ |
| Ga0075433_103724822 | 3300006852 | Populus Rhizosphere | MAVTIEIPTAFRRFTDGTPKFDCNAATIAEALNILT |
| Ga0099794_102653601 | 3300007265 | Vadose Zone Soil | MPVTIEIPTAFRRFTDGAPKIDCSANTIGGALNELTTRFPAIAR |
| Ga0099829_103588872 | 3300009038 | Vadose Zone Soil | MAVTIEIPTAFRRFTDGTPKLACNAATVAEAPSILTSQYPGLS |
| Ga0099830_103080671 | 3300009088 | Vadose Zone Soil | MPVTIEIPTAFRRFTNGAPRVDCSATTIAEALADLTARFPD |
| Ga0099830_113946801 | 3300009088 | Vadose Zone Soil | MAITIEIPTAFRRFTNGAPKVDCSAATIAEALNELTTRFPDLGRHV |
| Ga0099828_108992701 | 3300009089 | Vadose Zone Soil | MPVTIEIPTAFRRFTNGAPKVDCSAATIADALNELTSRF |
| Ga0099828_115101382 | 3300009089 | Vadose Zone Soil | MPVTIEIPTAFRRFTNSAPRVDCSATTIAEALADLTARFPDLTC |
| Ga0105247_105771931 | 3300009101 | Switchgrass Rhizosphere | MGSKGETMAVTIEIPTAFRRFTDGAPKFDCSATTIAEALDILTTQFP |
| Ga0075423_129411891 | 3300009162 | Populus Rhizosphere | MAVTIEIPTAFRRFTDGTPKFDCNAATIAEALNILTAQFP |
| Ga0116116_10755751 | 3300009621 | Peatland | MAITIEIPTAFRRFTDGIPKLDSAASTVAEALNDLTA |
| Ga0116216_106327362 | 3300009698 | Peatlands Soil | MAITIEIPTAFRRFTDGAPRLESGAKTVAEALNELV |
| Ga0126374_100943001 | 3300009792 | Tropical Forest Soil | MAVTIEIPTAFRRFTDGAPRFDCSAATIAEALNILTAQFPGLSRHV |
| Ga0116219_107324831 | 3300009824 | Peatlands Soil | MAITIEIPTALRRFTDGIPKLDSAATTVAEALNDL |
| Ga0126380_105408562 | 3300010043 | Tropical Forest Soil | MSVTIEIPTAFRKFTDGTPKYSCSATTVAEALNVLTSQFPGLGKHVRD |
| Ga0126384_101293772 | 3300010046 | Tropical Forest Soil | MAVTIEIPTAFRRFTDGAPRFDCSATTIAEALNILTAQF |
| Ga0126373_101014891 | 3300010048 | Tropical Forest Soil | MPVTIEIPTAFRRFTDGAPKVDCSATTVAEALDALTKRFPA |
| Ga0126373_109838452 | 3300010048 | Tropical Forest Soil | MSVTIEIPTAFRRFTEGAPRVDTAAATVAEALSDL |
| Ga0074046_104025131 | 3300010339 | Bog Forest Soil | MAITIEIPTAFRRFTEGAPKVESGATTVAEALNELTAKFPALSRHVRDDQ |
| Ga0074044_100859922 | 3300010343 | Bog Forest Soil | MVITIEIPTAFRRFTGGIPKLDSAAATVAEALNELTARYP |
| Ga0126376_123963942 | 3300010359 | Tropical Forest Soil | MPVTIEIPTAFRRFTDGAPKVDCSAATVAEALDAL |
| Ga0126372_129886392 | 3300010360 | Tropical Forest Soil | MPVTIEIPTAFRRFTAGAPKVDCSATTAAEPLDAPTKRLRHVSRQVRNE |
| Ga0126381_1026607721 | 3300010376 | Tropical Forest Soil | MPVTIEIPTAFRRFTDGAPKVDCSAATVAEALDTLTTRFPDLSRHVRDE |
| Ga0126350_101167402 | 3300010880 | Boreal Forest Soil | MPVTIEIPTAFRRFTDGTPKIDCSAATIAEALNDLTTRFPALSRHVRDE |
| Ga0150983_140749722 | 3300011120 | Forest Soil | MPVTIEIPTAFRRFTDGTPKIDCSAATIAEALNDLTTRFPALSRHVRDEQ |
| Ga0137392_115894952 | 3300011269 | Vadose Zone Soil | MSVTIEIPTAFRRFTNGAPKVDCSAATVAEALNELTSRFPDLGRHVRD |
| Ga0137393_114690461 | 3300011271 | Vadose Zone Soil | MPVTIEIPTAFRRFTNGAPKVDCSAATVAEALNELTAR |
| Ga0120134_10745201 | 3300012004 | Permafrost | MPVIIEIPTAFRRFTGGQPKIDCSAVTIAEALNQLTAKFP |
| Ga0137388_104657372 | 3300012189 | Vadose Zone Soil | MPVTIEIPTAFRRFTHGAPKVDCSAQTIAEALTELTARFPD |
| Ga0137388_117076742 | 3300012189 | Vadose Zone Soil | MPVTIEIPTAFRRFTDGAPKVDCSAATVAEALNELTSRFPDLSRHVRDDQ |
| Ga0137388_119705112 | 3300012189 | Vadose Zone Soil | MPVTIEIPTAFRRFTNGAPKVDCSAATVAEALNELTSRFPDLGRHVRDDQGQ |
| Ga0137383_103435002 | 3300012199 | Vadose Zone Soil | LTQKSQENEMAITIEIPTAFRRFTDGSPKYSCSATTVAEALNVLTSQ |
| Ga0137382_113178033 | 3300012200 | Vadose Zone Soil | MPVTIEIPTAFRRFTNGAPKVDCSAATIAEALNELTSRFPDLGRHVRD |
| Ga0137362_102361401 | 3300012205 | Vadose Zone Soil | MSVTIEIPTAFRRFTNGAPKVDCSAATVAEALNELTSRFPDLGRHVRDDQG |
| Ga0137381_110039042 | 3300012207 | Vadose Zone Soil | MPVTIEIPTAFRRFTDGLPRVDCSAGTIADALNDLTARFPALSR |
| Ga0137379_106041142 | 3300012209 | Vadose Zone Soil | MPVTIEIPTAFRRFTDGAPRVDCSASTVAEALDTLTKRFPGLSRHVRDDSGQ |
| Ga0137377_105977572 | 3300012211 | Vadose Zone Soil | MSVTIEIPTAFRRFTDGTPSFACSAKTVAEALRILT |
| Ga0137361_109812682 | 3300012362 | Vadose Zone Soil | MAVTIEIPTAFRRFTEGTPKLDCNAATIAEALNILTAQFPGLSRHV |
| Ga0134039_12633691 | 3300012374 | Grasslands Soil | MPVTIEIPTAFRRFTDGAPRVDCSASTVAEALDTLTKRF |
| Ga0134048_11468582 | 3300012400 | Grasslands Soil | MPVTIEIPTAFRRFTDGAPKVDCSAATIADALNELTSRFPDLS |
| Ga0137358_103410232 | 3300012582 | Vadose Zone Soil | MAVTIEIPTAFRRFTDGTPKLDCNAATIAEALNILTAQFPGLSRHVRD |
| Ga0137358_106889552 | 3300012582 | Vadose Zone Soil | MSVTIEIPTAFRRFTDGAPKVDCSAATVAEALNHLTARFPDLGRHVRDDQG |
| Ga0137398_101208641 | 3300012683 | Vadose Zone Soil | MPVTIEIPTAFRRFTEGVPKVDCSAATIADALNELTSRYLDLS |
| Ga0137396_107571623 | 3300012918 | Vadose Zone Soil | MPVTIEIPTAFRRFTDGTPRVDCSAATVAEALNELTSRFPDLSRH |
| Ga0137396_112738932 | 3300012918 | Vadose Zone Soil | MPVIIEIPTAFRRFTDGAPKVDCSAATVAEALNEL |
| Ga0137359_113886752 | 3300012923 | Vadose Zone Soil | MAITIEIPTAFRRFTDGSPKYSCSATTIAEALNVLTSQFPGLGKHVRDD |
| Ga0137419_108774652 | 3300012925 | Vadose Zone Soil | MAITIEIPTAFRRFTEGSPKVDSGATTIAEALNDLTVKFPALSRHV |
| Ga0137419_118949322 | 3300012925 | Vadose Zone Soil | MPVTIEIPTAFRRFTDGAPKVDCSAATVAEALNELTSRFPDLSR |
| Ga0137416_100552191 | 3300012927 | Vadose Zone Soil | MSNMPVTIEIPTAFRRFTDGAPKVDCSANTIAEALAELTA |
| Ga0137416_109008681 | 3300012927 | Vadose Zone Soil | MPITIEIPTAFRRFTNGAPKVDCSATTIAEALNELTSRFPDLGRH |
| Ga0137404_108609992 | 3300012929 | Vadose Zone Soil | MSVTIEIPTAFRRFTDGAPKVECSATTIAEALNELTQ |
| Ga0137407_108301232 | 3300012930 | Vadose Zone Soil | MPVTIEIPTAFRRFTGGAPKVDCSAATVAEALNQLTARFP |
| Ga0137410_115911512 | 3300012944 | Vadose Zone Soil | LEIEEGESEMSVIIEIPTAFRRFTGGAPKLDCSAATVAEALNELTARFPD |
| Ga0137410_116945091 | 3300012944 | Vadose Zone Soil | MAITIEIPTAFRRFTEGSPNVETGAATVAEALNDLTTK |
| Ga0157374_114836942 | 3300013296 | Miscanthus Rhizosphere | MPVTIEIPTAFRRFTDGAPKVDCTATTIADALKELTT |
| Ga0181533_10715792 | 3300014152 | Bog | MAITIEIPTAFRRFTDGIPKLDSAASTVAEALNDLTAR |
| Ga0167662_10177901 | 3300015082 | Glacier Forefield Soil | MTGETMAVTIEIPTAFRRFTDGTPKLDCNAATIAEALNILTTQ |
| Ga0137409_100770723 | 3300015245 | Vadose Zone Soil | MSTMPVTIEIPTAFRRFTDGAPKVDCSANTIAEALTELTARFPELS |
| Ga0137409_109563052 | 3300015245 | Vadose Zone Soil | MAITIEIPTAFRRFTEGSPNVETGAATVAEALNDLTTKFPALSRHVRD |
| Ga0137403_101226303 | 3300015264 | Vadose Zone Soil | MPVIIEIPTAFRRFTGGAPKVDCSAATVAEALNELTARFPD |
| Ga0132257_1010128971 | 3300015373 | Arabidopsis Rhizosphere | MAVTIEIPTAFRRFTDGTPKFDCNAATIAEALNILTTQ |
| Ga0182036_112397541 | 3300016270 | Soil | MAITIEIPTAFRRFTDGTPKFESAARTVAEALNDLVTKYP |
| Ga0182033_114566792 | 3300016319 | Soil | MAVTIEIPTAFRRFTDGTPKFDCNAATIAEALNILTSQFP |
| Ga0182035_116668562 | 3300016341 | Soil | MPITIEIPTAFRRFTDGASFVDCSATTVADALNDLTARF |
| Ga0182032_106222111 | 3300016357 | Soil | MTNLEKENMAITIEIPTAFRRFTEGAPRVDSGATTVGEALNELTTRFPALSR |
| Ga0182037_107808792 | 3300016404 | Soil | MPVTIEIPPAFRRFTEGAARVDCSASTVAEALDALT |
| Ga0182039_112072572 | 3300016422 | Soil | MAITIEIPTAFRRFTEGAPLVESGATTVGEALNELTT |
| Ga0187877_10430102 | 3300017931 | Peatland | MAITIEIPTAFRRFTDGIPKLASSASTVAEALNDLTARYP |
| Ga0187809_102825401 | 3300017937 | Freshwater Sediment | MAITIEIPTAFRRFTDGAPRLESGATTVAEALNELVTRFP |
| Ga0187819_106521871 | 3300017943 | Freshwater Sediment | MPVTIEIPTAFRRFTAGAPKVDCSATTIAEALNELTSRFPD |
| Ga0187817_107792062 | 3300017955 | Freshwater Sediment | MPVTIEIPTAFRRFTAGAPKIDCSASTIAEALNDLTSRF |
| Ga0187817_108203041 | 3300017955 | Freshwater Sediment | MPVTVEIPTAFRRFTAGAPKIDCSASTIAEALNDLTSR |
| Ga0187780_104919011 | 3300017973 | Tropical Peatland | MAITIEIPTAFQRFTEGTPKLASTASTVAEALDDLTARYPALSRHVR |
| Ga0187804_102722412 | 3300018006 | Freshwater Sediment | MPVTIEIPTAFRRFTDGAPKVDCSAGTVAEALNALTARFPDLGRHVRDD |
| Ga0187804_104568531 | 3300018006 | Freshwater Sediment | MPVTIEIPTAFRRFTAGSPRIDCSATTIAEALNELTSRFPDLS |
| Ga0187805_100053151 | 3300018007 | Freshwater Sediment | MPVTIEIPTAFRRFTDGAPKIDCSAATIADALNELTRR |
| Ga0187810_100485001 | 3300018012 | Freshwater Sediment | MAVTIEIPTAFRRFTDGAPKLDSGAATVAEALNELVARFPAL |
| Ga0187867_104552322 | 3300018033 | Peatland | MAITIEIPSAFRRFTDGIPKLDSAASTVAAALNDLTA |
| Ga0187771_113627412 | 3300018088 | Tropical Peatland | MAITIEIPTAFRRFTEGASRVDSGARTIAEALNDLTTRFPALSRHVRD |
| Ga0187771_119397842 | 3300018088 | Tropical Peatland | MAVTIEIPTAFRRFTDGAPRVDCSATTIAEALNQLTSRFPDLSRHVRDE |
| Ga0187770_108310581 | 3300018090 | Tropical Peatland | MPVTIEIPTAFRRFTDGTPKVDTGAATVAEALNDL |
| Ga0187798_10336562 | 3300019275 | Peatland | MVVTIEIPTAFRRFTEGTPRVDTGASTVAEALNELVARFPGLSRHVR |
| Ga0187800_11065092 | 3300019278 | Peatland | MPVTIEIPTAFRRFTDGTPKVDTGAVTVAEALNDLVVRYPALS |
| Ga0179594_101118451 | 3300020170 | Vadose Zone Soil | MSVIIEIPTAFRRFTGGAPKVDCSAATVAEALNELTARFPDLSRHVRDD |
| Ga0179594_101428522 | 3300020170 | Vadose Zone Soil | MPVIIEIPTAFRRFTNGAPRVDCSAATVAEALNELTA |
| Ga0179594_104314882 | 3300020170 | Vadose Zone Soil | MPVIIEIPTAFRRFTGGAPKVDCSAATVAEALNEL |
| Ga0179592_100682902 | 3300020199 | Vadose Zone Soil | MPVTIEIPTAFRRFTEGAPKVDCSAATVAEALNEL |
| Ga0179592_103025392 | 3300020199 | Vadose Zone Soil | MAVTIEIPTAFRRFTDGSAKLDCTAATVAEALNILTSQYPGLSRHVRDDQ |
| Ga0179592_103532532 | 3300020199 | Vadose Zone Soil | MPVTIEIPTAFRRFTAGAPRVDCSAKTIAEALAELTA |
| Ga0179592_104312231 | 3300020199 | Vadose Zone Soil | MSVTIEIPTAFQRFTEGTPKYSCSATTVAEALNVLTNQ |
| Ga0210407_103406811 | 3300020579 | Soil | MPITVEIPTAFRRFTDGAPKIDCSAITVADALNQLTTRFPDLSRHVRDDS |
| Ga0210407_109623011 | 3300020579 | Soil | MPVTIEIPTAFRRFTNGAPKVDCTAATVADALDELTARFPDLGRHVRDDQGQ |
| Ga0210403_100557193 | 3300020580 | Soil | MAVTIEIPTAFRRFTDGSPKLDCNAATIAEALSILTSQYP |
| Ga0210403_104153662 | 3300020580 | Soil | MAITIEIPTAFRRFTEGAPKVESGATTVAEALNELTAKFPALSRH |
| Ga0210401_103877042 | 3300020583 | Soil | MPITIEIPTAFQRFTDGAPKVDCTAATIADALNTLTARFPELGRHVRDDSGQIRQ |
| Ga0210401_104644021 | 3300020583 | Soil | MPVTIEIPTAFRRFTDGTPKIDCSATTIAEALNDLTTRFPD |
| Ga0210404_103620191 | 3300021088 | Soil | MPVTIEIPTAFRRFTDGAPKVDCSANTVAEALTELTTR |
| Ga0210406_103589631 | 3300021168 | Soil | MAVIIEIPTAFRRFTEGAPKIDSGAGTVAEALNDL |
| Ga0210405_103713211 | 3300021171 | Soil | MPITIEIPTAFRRFTEGSLKVDSRATTVAEALNDLTTKFPALSRHVRDDQGQ |
| Ga0210408_100322424 | 3300021178 | Soil | MPVTIEIPTAFRRFTDGAPKVDCSANTIAEALNELTTRFPNLSRH |
| Ga0210396_117456091 | 3300021180 | Soil | MPVTIEIPTAFRRFTDGAPKVDCTAATIADALNTLTARFPELGRHVRHDSG |
| Ga0213882_103115272 | 3300021362 | Exposed Rock | MSVTIEIPTAFRRFTDGAPKVDCTGATVAAALNELTTKFPDLSKHVR |
| Ga0210385_106746921 | 3300021402 | Soil | MSVTIEIPTAFRRFTDGAPKIDCNGTTVAAALTELTTRFPDLSKHVR |
| Ga0210387_104053702 | 3300021405 | Soil | MAITIEIPTAFRRFTEGAPKIDSGALTVAEALNDLTTKYPA |
| Ga0210383_104963611 | 3300021407 | Soil | MAITIEIPTAFRRFTDGVPKLDSSASTITEALNDLTTRYPALSRHVR |
| Ga0210384_102560312 | 3300021432 | Soil | MPVTIEIPTAFRRFTDGTPKIDCSASTIAEALNDLTARFPALSRHV |
| Ga0210392_111146502 | 3300021475 | Soil | MPVTIEIPTAFRRFTAGAPKIDCSATTIAEALNTLTA |
| Ga0210398_111894761 | 3300021477 | Soil | MSITIEIPTAFRRFTEGSPKVDTAAATVAEALNDLTTKFP |
| Ga0210402_103486591 | 3300021478 | Soil | MAITIEIPTAFRRFTEGAPKVESGATTVAEALNELTAKFP |
| Ga0210402_103726312 | 3300021478 | Soil | MPITVEIPTAFRRFTDGAPKIDCSAATVAEVLTQLTARFP |
| Ga0210410_115546561 | 3300021479 | Soil | MPVTIEIPTAFRRFTEGAPKVDCSAATIADALNELTSRYPD |
| Ga0210409_105756082 | 3300021559 | Soil | MPVTIEIPTAFRRFTDGTPKIDCSAATIAEALNDLTTRFPA |
| Ga0210409_115614431 | 3300021559 | Soil | MPVTIEIPTAFRRFTDGAPKVDCSANTIAEALAELTARFPELARHVRDES |
| Ga0126371_115511442 | 3300021560 | Tropical Forest Soil | MAITIEIPTAFRRFTDGEPRVQSAGATVAEALTELTVKYPALSRHVR |
| Ga0247672_10679482 | 3300024187 | Soil | MAITIEIPTAFRRFTDGSPKYACSATTVAEALNVLT |
| Ga0137417_12702012 | 3300024330 | Vadose Zone Soil | MPVTIEIPTAFRRFTDGAPRVDCSAATVAEALNELTSRFPDLSRHVRD |
| Ga0207710_105765471 | 3300025900 | Switchgrass Rhizosphere | MAVTIEIPTAFRRFTDGAPKFDCSATTIAEALDILTTQFP |
| Ga0207654_111319672 | 3300025911 | Corn Rhizosphere | MAVTIEIPTAFRRFTDGSPKFDCNATTIAEALNILTT |
| Ga0207693_100320544 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MAITIEIPTAFRRFTEGAPKVESGATTVAEALNELTAKFPALSRHVRD |
| Ga0207712_110324381 | 3300025961 | Switchgrass Rhizosphere | MAVTIEIPTAFRRFTDGAPKFDCNATTIAEALDILTTEFPGLMRH |
| Ga0209863_101242431 | 3300026281 | Prmafrost Soil | MPITIEIPTAFRRFTEGAPKIDSNAPTVAEALNELTTRFPELSRHVR |
| Ga0209240_12154092 | 3300026304 | Grasslands Soil | MPVIIEIPTAFRRFTEGAPKVDCSAGTVAEALDEL |
| Ga0209688_10203542 | 3300026305 | Soil | MPVTIEIPTAFRRFTDGAPKLDCSAATIAEALDELTS |
| Ga0209055_13082391 | 3300026309 | Soil | MPVTIEIPTAFRRFTDGTPKVGCSAATVAEALNELTSRYPDL |
| Ga0209268_11859481 | 3300026314 | Soil | MAVTIEIPTAFRRFTDGAPKVDCSAATIAEALNVLTSRFPDLGRHVRDD |
| Ga0209473_10803722 | 3300026330 | Soil | MPVTIEIPTAFRRFTDGAPRVDCSASTVAEALDTLTKRFP |
| Ga0209803_11488571 | 3300026332 | Soil | MAVTIEIPTAFRRFTDGTPKLDCNAATIAEALNILT |
| Ga0209377_10900292 | 3300026334 | Soil | MPVIIEIPTAFRRFTKGAPKVDCSAATVAEALNELTARFPD |
| Ga0257155_10662721 | 3300026481 | Soil | MPVTIEIPTAFRRFTDGAPKVDCSANTIAEALAELT |
| Ga0257153_10555862 | 3300026490 | Soil | MSVTIEIPTAFQRFTEGTPKYSCSATTVAEALNVLTNQFPGL |
| Ga0209808_11248431 | 3300026523 | Soil | MPVTIEIPTAFRRFTDGAPKVDCSAETVAEALDALTKRFP |
| Ga0209807_12040741 | 3300026530 | Soil | MPVTIEIPTAFRRFTDGAPKVDCSAATVADALNELTSR |
| Ga0209474_103231141 | 3300026550 | Soil | MPVTIEIPTAFRRFTDGAPKLDCSAATIAEALDELTSRFPDLG |
| Ga0209648_100841731 | 3300026551 | Grasslands Soil | MPVTIEIPTAFRRFTEGAPRVDCSATTIAEAHSELTSRFPAL |
| Ga0209648_106585921 | 3300026551 | Grasslands Soil | MPVIIEIPTAFRRFTEGTPRVDCSAATIADALNELTSRYPDL |
| Ga0179587_102168632 | 3300026557 | Vadose Zone Soil | MAITIEIPTAFRRFTDGSPKYSCSATTVAEALNVL |
| Ga0179587_106594101 | 3300026557 | Vadose Zone Soil | MPITIEIPTAFRRFTEGAPKVDCTAATIAVALNTRTP |
| Ga0207834_10201131 | 3300026988 | Tropical Forest Soil | MTNLEKENMAITIEIPTAFRRFTEGAPRVDSGATTVGEALNELTT |
| Ga0208365_10251632 | 3300027070 | Forest Soil | MPVTIEIPTAFRRFTEGAPKVDCRAATIAEALNELTSRYPGLSRHVRDDQ |
| Ga0209529_10564262 | 3300027334 | Forest Soil | MSVTIEIPTAFRRFTDGAPKVDCTGATVAAALTELTTRFPDLS |
| Ga0209525_11403562 | 3300027575 | Forest Soil | MAITIEIPTAFRRFTEGSPKVDSGATTVAEALNDL |
| Ga0209217_11595821 | 3300027651 | Forest Soil | MPITIEIPTAFRRFTEGAPKIDSGALTVAEALNDLTAKYPSLSRHVRDEQGQ |
| Ga0209011_11832511 | 3300027678 | Forest Soil | MPVTIEIPTAFRRFTNGAPRVDCSATTIAEALADLTARFP |
| Ga0209810_13006971 | 3300027773 | Surface Soil | MNITIEIPTAFRRFTDGAPRFACSASTIAEALAQLTAQFP |
| Ga0209177_104245441 | 3300027775 | Agricultural Soil | MSITIEIPTAFRRFTDGAPKFACSATTVSEALALLTSQFPG |
| Ga0209448_100868841 | 3300027783 | Bog Forest Soil | MPVTIEIPTAFRRFTAGTPKIDCSATTIAEALNDLTTRFPDLSRHVRDEQG |
| Ga0209180_101443121 | 3300027846 | Vadose Zone Soil | MPITIEIPSAFRRFTDGAPKVDCSAATVAEALDQL |
| Ga0209180_106921322 | 3300027846 | Vadose Zone Soil | MPVTIEIPTAFRRFTEGAPRVDCSAATIAEALNELTSRFPALSRHVRD |
| Ga0209167_104785891 | 3300027867 | Surface Soil | MGVTIEIPTAFRRFTDGTPKFDCNATTVAEALNILTAQ |
| Ga0209283_105479231 | 3300027875 | Vadose Zone Soil | MPVTIEIPTAFRRFTEGAPRVDCSATTIAEALSELTSRFPA |
| Ga0209590_109467932 | 3300027882 | Vadose Zone Soil | MPVTIEIPTAFRRFTDGAPRVDCSTGTIADALNDL |
| Ga0209380_101976121 | 3300027889 | Soil | MPVTIEIPTAFRRFTDGAPKVDCTAATIADALNTLTARFPELGRHVRDDS |
| Ga0209488_101480322 | 3300027903 | Vadose Zone Soil | MSVTIEIPTAFRRFTNGAPKVDCSAATVAEALNELTSRF |
| Ga0209526_108619571 | 3300028047 | Forest Soil | MPVTIEIPTAFRRFTDGAPRVDCSATTIAEALADLT |
| Ga0268264_101011441 | 3300028381 | Switchgrass Rhizosphere | MPVTIEIPTAFRRFTDGAPKVDCTATTIADALKELTTRFPDLSRHVRDDS |
| Ga0137415_108934362 | 3300028536 | Vadose Zone Soil | MPVTIEIPTAFRRFTNGAPKVDCSAATIAEALNELTSRFPDLGRHVRDDQG |
| Ga0302228_104314671 | 3300028808 | Palsa | MHVTIEIPTAFRRFTDGAPKIDCAATTIAEALSHLT |
| Ga0308309_104074951 | 3300028906 | Soil | MPVTIEIPTAFRRFTDGTPKIDCSAATIAEALNDLTPRFPALSRHV |
| Ga0310039_103410691 | 3300030706 | Peatlands Soil | MAITIEIPTAFRRFTDGIPKLDSAASTVAEALNDLTARYPALSRHVRD |
| Ga0170824_1046782992 | 3300031231 | Forest Soil | MAITIEIPTAFRRFTEGSPKVETGATTVAEALNDLTTKFPALS |
| Ga0310915_101290922 | 3300031573 | Soil | MTITIEIPTAFRRFTEGAPRVDTGATTVGEALDEL |
| Ga0307483_10109421 | 3300031590 | Hardwood Forest Soil | MPVTIEIPTAFRRFTDGAPKVDCSANTIAEALTELTT |
| Ga0318561_106507791 | 3300031679 | Soil | MTNLEKENMAITIEIPTAFRRFTEGAPRVDSGATTVGEALNEL |
| Ga0307476_107525521 | 3300031715 | Hardwood Forest Soil | MSVTIEIPTAFRRFTDGAPKVDCSATTVAAALTELTTRFPDL |
| Ga0307474_106349972 | 3300031718 | Hardwood Forest Soil | MGVTIEIPTAFRRFTDGTPKFDCNATTVAEALNILTAQFPGLSR |
| Ga0306917_107026212 | 3300031719 | Soil | MTITIEIPTAFRRFTEGAPRVDTGATTVGEALDELTA |
| Ga0306917_113555591 | 3300031719 | Soil | MAITIEIPTAFRRFTDGAQRVESGGTTVKEALNDLVAKFPALSR |
| Ga0307469_116186352 | 3300031720 | Hardwood Forest Soil | MAVTIEIPTAFRRFTDGTPKLDCNAATVAEALNILTTQFPGLSRHVRDD |
| Ga0307475_102088782 | 3300031754 | Hardwood Forest Soil | MPVTIEIPTAFRRFTNGAPKVDCSANTIAEALTELTARFPDLSRHVRD |
| Ga0318546_110461921 | 3300031771 | Soil | MAVTIEIPTAFRRFTDGTPKFDCNATTIAEALNILTAQFPGLARHVRDD |
| Ga0307473_102437511 | 3300031820 | Hardwood Forest Soil | MPVTIEIPTAFRRFTDGVPRVDCSAATVAEALNELTSRFPDL |
| Ga0307473_104310281 | 3300031820 | Hardwood Forest Soil | MAITIEIPTAFRRFTEGTPRLESGATTVAQALNELVTRFP |
| Ga0310917_101382761 | 3300031833 | Soil | MAITIEIPTAFRRFTEGAPRVDSGATTVGEALNELTTRFPSLSRHVRDEQ |
| Ga0306921_100513345 | 3300031912 | Soil | MAITIEIPTAFRRFTNGTPKFESAARTVAEALNDLVTKYPAL |
| Ga0306921_106022041 | 3300031912 | Soil | MSVTIEIPTAFRRFTEGAPRVDTAAATVAEALTDLTT |
| Ga0306921_126275171 | 3300031912 | Soil | MPVTIEIPPAFRRFTEGAARVDCSASTVAEALDALTKQFPGLSRH |
| Ga0310913_105645941 | 3300031945 | Soil | MAVTIEIPTAFRRFTDGTPKFDCNATTIAEALNILTAQFPGL |
| Ga0307479_102797581 | 3300031962 | Hardwood Forest Soil | MPVIIEIPTAFRRFTNGQPKIDCSAVTIAEALNQLTAKFPDLGRPVRDD |
| Ga0307479_106978962 | 3300031962 | Hardwood Forest Soil | VAITIEIPTAFRRFTEGSPKVDSGATTVAEALNDLTAKFPALS |
| Ga0307479_107810941 | 3300031962 | Hardwood Forest Soil | MPVTIEIPTAFRRFTDGAPKVDCSAATVAEALNELTSRFPALSR |
| Ga0310911_104545562 | 3300032035 | Soil | MAITIEIPTAFRRFTEGAPLVESGATTVGEALNEL |
| Ga0318505_100967512 | 3300032060 | Soil | MTITIEIPTAFRRFTEGAPRVDTWATTVGAALDELTAR |
| Ga0318540_106691711 | 3300032094 | Soil | MAVTIEIPTAFRRFTDGAPKVDSGATTVAEALNELVTKFPALSR |
| Ga0307470_100868191 | 3300032174 | Hardwood Forest Soil | MAITIEIPTAFRRFTEGSPKVDTGATTVAEALNDL |
| Ga0307470_102824641 | 3300032174 | Hardwood Forest Soil | MPITVEIPTAFRRFTDGAPKIDCSAITVADALNQLTTRFPD |
| Ga0307470_103662202 | 3300032174 | Hardwood Forest Soil | MPVTIEIPTAFRRFTAGAPKVDCSAKTIAEALTELTARFPE |
| Ga0307471_1014707982 | 3300032180 | Hardwood Forest Soil | MPVIIEIPTAFRRFTGGAPKVDCSAATVAEALNELTARFPDLSR |
| Ga0307471_1017262882 | 3300032180 | Hardwood Forest Soil | MPVTIEIPTAFRRFTDGAPKVDCSANTIAEALNELTT |
| Ga0307471_1036647032 | 3300032180 | Hardwood Forest Soil | MAVTIEIPTAFRRFTDGSPKLDCNAATVAEALSILTAQYPGLSRHV |
| Ga0307471_1037509862 | 3300032180 | Hardwood Forest Soil | MPVTIEIPTAFRRFTDGAPKVDCSAATVAEALNELTA |
| Ga0307471_1038226282 | 3300032180 | Hardwood Forest Soil | MSVIIEIPTAFRRFTDGAPKVDCSAATVAEALNEL |
| Ga0307472_1018963692 | 3300032205 | Hardwood Forest Soil | MAVTIEIPTAFRRFTDGTPKLDCNAATIAEALNLLTA |
| Ga0335082_115925201 | 3300032782 | Soil | MPVTIEIPSAFRRFTEGAPKVDSSAPTVAAALDDLV |
| Ga0335076_117856281 | 3300032955 | Soil | MSVTIEIPTAFRRFTDGAPKVDCSGTTVAAALNELTTKFPDLSKH |
| Ga0326728_102530632 | 3300033402 | Peat Soil | MAITIEIPAAFRRFTEGIPKLDSAAATVAEALNDLT |
| Ga0326726_107691502 | 3300033433 | Peat Soil | MAITIEIPTAFRRFTDGIPKLDSAASTVAEALDDLTARYP |
| Ga0314872_017512_3_128 | 3300033810 | Peatland | MAVTIEIPTAFRRFTDGEQHVSSGAATVSEALNDLTTKYPAL |
| Ga0326724_0307302_1_123 | 3300034091 | Peat Soil | MAITIEIPTAFRRFTEGAPKVDSGATTVTEALNDLTTRFPA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |