| Basic Information | |
|---|---|
| Family ID | F018606 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 234 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKVRPGVELASLSDVGCQRENNEDRYSYWEPASDPEFPRKG |
| Number of Associated Samples | 208 |
| Number of Associated Scaffolds | 234 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.70 % |
| % of genes near scaffold ends (potentially truncated) | 98.29 % |
| % of genes from short scaffolds (< 2000 bps) | 86.75 % |
| Associated GOLD sequencing projects | 199 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.017 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.359 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.846 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 7.25% β-sheet: 0.00% Coil/Unstructured: 92.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 234 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 14.53 |
| PF00571 | CBS | 5.56 |
| PF00479 | G6PD_N | 5.13 |
| PF02781 | G6PD_C | 2.99 |
| PF02129 | Peptidase_S15 | 2.56 |
| PF04185 | Phosphoesterase | 2.56 |
| PF01494 | FAD_binding_3 | 1.28 |
| PF01061 | ABC2_membrane | 1.28 |
| PF08530 | PepX_C | 0.85 |
| PF02685 | Glucokinase | 0.85 |
| PF07690 | MFS_1 | 0.85 |
| PF07730 | HisKA_3 | 0.85 |
| PF01850 | PIN | 0.85 |
| PF12787 | EcsC | 0.85 |
| PF06764 | DUF1223 | 0.85 |
| PF09364 | XFP_N | 0.85 |
| PF00072 | Response_reg | 0.85 |
| PF13672 | PP2C_2 | 0.85 |
| PF13463 | HTH_27 | 0.43 |
| PF00871 | Acetate_kinase | 0.43 |
| PF00593 | TonB_dep_Rec | 0.43 |
| PF13533 | Biotin_lipoyl_2 | 0.43 |
| PF02113 | Peptidase_S13 | 0.43 |
| PF10017 | Methyltransf_33 | 0.43 |
| PF02518 | HATPase_c | 0.43 |
| PF13531 | SBP_bac_11 | 0.43 |
| PF01977 | UbiD | 0.43 |
| PF00857 | Isochorismatase | 0.43 |
| PF04545 | Sigma70_r4 | 0.43 |
| PF00326 | Peptidase_S9 | 0.43 |
| PF01841 | Transglut_core | 0.43 |
| PF03061 | 4HBT | 0.43 |
| PF00248 | Aldo_ket_red | 0.43 |
| PF03629 | SASA | 0.43 |
| PF12146 | Hydrolase_4 | 0.43 |
| PF02566 | OsmC | 0.43 |
| PF04168 | Alpha-E | 0.43 |
| PF13620 | CarboxypepD_reg | 0.43 |
| PF04226 | Transgly_assoc | 0.43 |
| PF01636 | APH | 0.43 |
| PF00440 | TetR_N | 0.43 |
| PF00856 | SET | 0.43 |
| PF14403 | CP_ATPgrasp_2 | 0.43 |
| PF02737 | 3HCDH_N | 0.43 |
| PF00923 | TAL_FSA | 0.43 |
| PF00196 | GerE | 0.43 |
| PF02812 | ELFV_dehydrog_N | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 234 Family Scaffolds |
|---|---|---|---|
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 8.12 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 2.56 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.56 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.28 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.28 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.28 |
| COG5429 | Uncharacterized conserved protein, DUF1223 domain | Function unknown [S] | 0.85 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.85 |
| COG0837 | Glucokinase | Carbohydrate transport and metabolism [G] | 0.85 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.85 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.85 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.85 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.85 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.43 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.43 |
| COG2307 | Uncharacterized conserved protein, Alpha-E superfamily | Function unknown [S] | 0.43 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.43 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.43 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.43 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.43 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.43 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.43 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.43 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.43 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.43 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.43 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.43 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.43 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.44 % |
| Unclassified | root | N/A | 5.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105392540 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300001431|F14TB_105011002 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300001593|JGI12635J15846_10814591 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300001593|JGI12635J15846_10852366 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300001686|C688J18823_10105949 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300001867|JGI12627J18819_10488156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100024336 | All Organisms → cellular organisms → Bacteria | 5269 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100151653 | All Organisms → cellular organisms → Bacteria | 2190 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101370052 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300002914|JGI25617J43924_10350968 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300003368|JGI26340J50214_10073642 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300004082|Ga0062384_100882096 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300004152|Ga0062386_100330778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1218 | Open in IMG/M |
| 3300005167|Ga0066672_10436432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 856 | Open in IMG/M |
| 3300005176|Ga0066679_10031895 | All Organisms → cellular organisms → Bacteria | 2912 | Open in IMG/M |
| 3300005177|Ga0066690_10000415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12707 | Open in IMG/M |
| 3300005180|Ga0066685_11088421 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005454|Ga0066687_10514045 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005529|Ga0070741_10055737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4695 | Open in IMG/M |
| 3300005538|Ga0070731_10053471 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300005554|Ga0066661_10509589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 726 | Open in IMG/M |
| 3300005557|Ga0066704_10403475 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300005561|Ga0066699_10742257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 696 | Open in IMG/M |
| 3300005566|Ga0066693_10134610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 918 | Open in IMG/M |
| 3300005576|Ga0066708_10238004 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300005591|Ga0070761_10331252 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300005610|Ga0070763_10267700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 931 | Open in IMG/M |
| 3300005614|Ga0068856_101535890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 679 | Open in IMG/M |
| 3300005764|Ga0066903_108787053 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005895|Ga0075277_1036194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 733 | Open in IMG/M |
| 3300005921|Ga0070766_10714242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300006028|Ga0070717_11532095 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300006050|Ga0075028_100727713 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006162|Ga0075030_100760846 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300006172|Ga0075018_10270818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 828 | Open in IMG/M |
| 3300006174|Ga0075014_100259890 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300006237|Ga0097621_101040318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 767 | Open in IMG/M |
| 3300006755|Ga0079222_10873290 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300006796|Ga0066665_11278770 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006800|Ga0066660_11085284 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006904|Ga0075424_100240475 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
| 3300006904|Ga0075424_100510303 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300006954|Ga0079219_11203855 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300007076|Ga0075435_100292501 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300009090|Ga0099827_10595039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300009098|Ga0105245_10047307 | All Organisms → cellular organisms → Bacteria | 3845 | Open in IMG/M |
| 3300009137|Ga0066709_102793017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300009174|Ga0105241_12033366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300009524|Ga0116225_1014561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4172 | Open in IMG/M |
| 3300009643|Ga0116110_1056175 | Not Available | 1403 | Open in IMG/M |
| 3300009700|Ga0116217_10357337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300009824|Ga0116219_10105281 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300010043|Ga0126380_10561238 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300010048|Ga0126373_11549523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300010339|Ga0074046_10681964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300010339|Ga0074046_10907359 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010343|Ga0074044_10239979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300010359|Ga0126376_13033316 | Not Available | 519 | Open in IMG/M |
| 3300010360|Ga0126372_12936346 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010361|Ga0126378_11938338 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300010366|Ga0126379_12967113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300010366|Ga0126379_13575098 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010376|Ga0126381_102150458 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012189|Ga0137388_10727137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 921 | Open in IMG/M |
| 3300012202|Ga0137363_10804660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300012203|Ga0137399_10464916 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300012203|Ga0137399_11016571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300012205|Ga0137362_10797466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 809 | Open in IMG/M |
| 3300012206|Ga0137380_11427166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae | 577 | Open in IMG/M |
| 3300012211|Ga0137377_10338849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1440 | Open in IMG/M |
| 3300012285|Ga0137370_10399071 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300012351|Ga0137386_11244636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300012361|Ga0137360_10252283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1449 | Open in IMG/M |
| 3300012363|Ga0137390_10636927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1032 | Open in IMG/M |
| 3300012363|Ga0137390_11070454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 756 | Open in IMG/M |
| 3300012685|Ga0137397_10308664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
| 3300012917|Ga0137395_10906141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300012922|Ga0137394_10082099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2698 | Open in IMG/M |
| 3300012922|Ga0137394_10950447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300012927|Ga0137416_10900227 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300012948|Ga0126375_10396112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 996 | Open in IMG/M |
| 3300012984|Ga0164309_11812178 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300013100|Ga0157373_10315321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1112 | Open in IMG/M |
| 3300013296|Ga0157374_10455621 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300013297|Ga0157378_12585441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 560 | Open in IMG/M |
| 3300014167|Ga0181528_10184221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1128 | Open in IMG/M |
| 3300014325|Ga0163163_10523507 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300014493|Ga0182016_10851321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300014501|Ga0182024_12088662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 623 | Open in IMG/M |
| 3300015054|Ga0137420_1492709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4781 | Open in IMG/M |
| 3300015245|Ga0137409_10797186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300015262|Ga0182007_10404574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300015264|Ga0137403_10396052 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300016319|Ga0182033_10632892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 932 | Open in IMG/M |
| 3300016357|Ga0182032_10029038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3348 | Open in IMG/M |
| 3300016357|Ga0182032_11914460 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300016371|Ga0182034_11719785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300017925|Ga0187856_1340802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 509 | Open in IMG/M |
| 3300017934|Ga0187803_10342115 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300017936|Ga0187821_10048488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1521 | Open in IMG/M |
| 3300017936|Ga0187821_10302967 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300017942|Ga0187808_10430511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 605 | Open in IMG/M |
| 3300017942|Ga0187808_10581350 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300017943|Ga0187819_10368460 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300017961|Ga0187778_10391885 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300017970|Ga0187783_10051149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3049 | Open in IMG/M |
| 3300017970|Ga0187783_10436275 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300017972|Ga0187781_11337290 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300017973|Ga0187780_10872316 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300017974|Ga0187777_10081003 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
| 3300017975|Ga0187782_10447934 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300018002|Ga0187868_1220256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 651 | Open in IMG/M |
| 3300018006|Ga0187804_10011883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3007 | Open in IMG/M |
| 3300018013|Ga0187873_1317279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 571 | Open in IMG/M |
| 3300018018|Ga0187886_1114124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300018019|Ga0187874_10270376 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300018030|Ga0187869_10305209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300018043|Ga0187887_10070015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2130 | Open in IMG/M |
| 3300018054|Ga0184621_10295439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300018058|Ga0187766_10324062 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300018086|Ga0187769_10056288 | All Organisms → cellular organisms → Bacteria | 2744 | Open in IMG/M |
| 3300018088|Ga0187771_10943987 | Not Available | 732 | Open in IMG/M |
| 3300018090|Ga0187770_10094419 | All Organisms → cellular organisms → Bacteria | 2223 | Open in IMG/M |
| 3300018090|Ga0187770_10261135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1343 | Open in IMG/M |
| 3300018468|Ga0066662_12778298 | Not Available | 519 | Open in IMG/M |
| 3300019878|Ga0193715_1116184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300019887|Ga0193729_1192377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300019888|Ga0193751_1260201 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300019890|Ga0193728_1124046 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300020021|Ga0193726_1271329 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300020579|Ga0210407_10453364 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300020580|Ga0210403_10821128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300020580|Ga0210403_11530492 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300020582|Ga0210395_10617993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300020583|Ga0210401_11543992 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300021170|Ga0210400_10014698 | All Organisms → cellular organisms → Bacteria | 6207 | Open in IMG/M |
| 3300021170|Ga0210400_10079167 | All Organisms → cellular organisms → Bacteria | 2581 | Open in IMG/M |
| 3300021170|Ga0210400_10193936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1650 | Open in IMG/M |
| 3300021170|Ga0210400_10613104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 897 | Open in IMG/M |
| 3300021178|Ga0210408_10566502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300021180|Ga0210396_11412144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300021384|Ga0213876_10478971 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300021401|Ga0210393_11303654 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300021404|Ga0210389_11123925 | Not Available | 607 | Open in IMG/M |
| 3300021420|Ga0210394_11258395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300021474|Ga0210390_11518801 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300021477|Ga0210398_10644168 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300021478|Ga0210402_10333735 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300021478|Ga0210402_11274574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 662 | Open in IMG/M |
| 3300022521|Ga0224541_1004045 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300022731|Ga0224563_1010869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300022733|Ga0224562_1014513 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300022756|Ga0222622_10493811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 874 | Open in IMG/M |
| 3300022873|Ga0224550_1060771 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300023019|Ga0224560_100966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2039 | Open in IMG/M |
| 3300024220|Ga0224568_1023480 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300025414|Ga0208935_1054502 | Not Available | 536 | Open in IMG/M |
| 3300025439|Ga0208323_1050368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 756 | Open in IMG/M |
| 3300025911|Ga0207654_10031881 | All Organisms → cellular organisms → Bacteria | 2907 | Open in IMG/M |
| 3300025927|Ga0207687_10035838 | All Organisms → cellular organisms → Bacteria | 3377 | Open in IMG/M |
| 3300025927|Ga0207687_10392378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1140 | Open in IMG/M |
| 3300025929|Ga0207664_11392168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300025933|Ga0207706_11325436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300025938|Ga0207704_11274824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300025961|Ga0207712_10049776 | All Organisms → cellular organisms → Bacteria | 2922 | Open in IMG/M |
| 3300026041|Ga0207639_10085501 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300026078|Ga0207702_10839087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300026078|Ga0207702_11463866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300026088|Ga0207641_11143960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300026217|Ga0209871_1049942 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300026297|Ga0209237_1086258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1421 | Open in IMG/M |
| 3300026326|Ga0209801_1078201 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300026482|Ga0257172_1103328 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300026523|Ga0209808_1142570 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300026538|Ga0209056_10550754 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300026542|Ga0209805_1152187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1061 | Open in IMG/M |
| 3300026552|Ga0209577_10429671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300026557|Ga0179587_10869956 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300027439|Ga0209332_1071392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300027537|Ga0209419_1115140 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300027565|Ga0209219_1162025 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300027648|Ga0209420_1205697 | Not Available | 521 | Open in IMG/M |
| 3300027652|Ga0209007_1061329 | Not Available | 952 | Open in IMG/M |
| 3300027667|Ga0209009_1060586 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300027676|Ga0209333_1029634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1532 | Open in IMG/M |
| 3300027678|Ga0209011_1151077 | Not Available | 652 | Open in IMG/M |
| 3300027706|Ga0209581_1146752 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300027737|Ga0209038_10172214 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300027853|Ga0209274_10056088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1879 | Open in IMG/M |
| 3300027874|Ga0209465_10204436 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300027905|Ga0209415_10272400 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300027910|Ga0209583_10642847 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300027915|Ga0209069_10305366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300028036|Ga0265355_1023526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300028775|Ga0302231_10206801 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Elateriformia → Elateroidea → Lampyridae → Luciolinae → Abscondita → Abscondita terminalis | 820 | Open in IMG/M |
| 3300028780|Ga0302225_10399541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300028780|Ga0302225_10558141 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300028828|Ga0307312_10245877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300028866|Ga0302278_10051964 | All Organisms → cellular organisms → Bacteria | 2543 | Open in IMG/M |
| 3300028873|Ga0302197_10242111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 828 | Open in IMG/M |
| 3300029915|Ga0311358_10644809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 790 | Open in IMG/M |
| 3300029953|Ga0311343_11033724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 642 | Open in IMG/M |
| 3300030738|Ga0265462_10529864 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300030879|Ga0265765_1059801 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031057|Ga0170834_110517536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1795 | Open in IMG/M |
| 3300031090|Ga0265760_10378778 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031561|Ga0318528_10659107 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031718|Ga0307474_10124556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1936 | Open in IMG/M |
| 3300031720|Ga0307469_10068808 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
| 3300031720|Ga0307469_10225581 | Not Available | 1486 | Open in IMG/M |
| 3300031736|Ga0318501_10462897 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300031765|Ga0318554_10554892 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300031819|Ga0318568_10930059 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300031820|Ga0307473_11434218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300031823|Ga0307478_11349229 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300031833|Ga0310917_10916434 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300031912|Ga0306921_12053301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 607 | Open in IMG/M |
| 3300031941|Ga0310912_10994383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 643 | Open in IMG/M |
| 3300031954|Ga0306926_10133447 | All Organisms → cellular organisms → Bacteria | 3070 | Open in IMG/M |
| 3300031962|Ga0307479_11076805 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031962|Ga0307479_11238293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300032174|Ga0307470_10162780 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300032180|Ga0307471_100177258 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300032261|Ga0306920_102410521 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300032783|Ga0335079_10317691 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300032783|Ga0335079_12090774 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300032805|Ga0335078_12035830 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300032828|Ga0335080_12213064 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300032954|Ga0335083_10311450 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300033158|Ga0335077_11221260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 735 | Open in IMG/M |
| 3300033755|Ga0371489_0482734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.13% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.99% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.71% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.28% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.28% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.28% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.28% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.28% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.43% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.43% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.43% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.43% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.43% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.43% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.43% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.43% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.43% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1053925405 | 3300000364 | Soil | MQVRPGVEVASLSDVGCQRENNEDALSYWEPHSDAQ |
| F14TB_1050110022 | 3300001431 | Soil | MEIRPGIEMASLTDVGCQRQNNEDATSYWEPKTDDEFQ |
| JGI12635J15846_108145912 | 3300001593 | Forest Soil | MNVKPGIEVASLSDVGCQRENNEDSYLYWEPREDEEFKRKGR |
| JGI12635J15846_108523662 | 3300001593 | Forest Soil | MNVKPAVEVAGLSDVGCQRENNEDSYLYWEPAGAKEF |
| C688J18823_101059491 | 3300001686 | Soil | MRIRPGIELASLSDVGCQRDNNEDRYSYWEPASDEEFEKKGRLAIV |
| JGI12627J18819_104881562 | 3300001867 | Forest Soil | MNVRPGMEVAILTDVGRVRENNEDSYLYWEAEADDDFRRK |
| JGIcombinedJ26739_1000243361 | 3300002245 | Forest Soil | MRVRLGVELAGLSDVGCQRDNNEDRYSYWEPPSDQQFPLKGRLAIVADGMG |
| JGIcombinedJ26739_1001516534 | 3300002245 | Forest Soil | LSVDCIRVRPGVEVASLSDVGCQRENNEDSYLYWEPADDQDFQRKGRLAVIADGMG |
| JGIcombinedJ26739_1013700522 | 3300002245 | Forest Soil | MAVDCSNVKPGIEMASLTDVGRQRTNNEDSYLYWEPDSDAEFRRKGRLAIIA |
| JGI25617J43924_103509682 | 3300002914 | Grasslands Soil | MKVRAGVEVASLSDVGCQRENNEDSYGYWESPDDHTFARLGRLAIVADG |
| JGI26340J50214_100736421 | 3300003368 | Bog Forest Soil | MVVDSAKTKPGIEIASLTDVGLQRANNEDSYLYWEPESDDDFRRKGR |
| Ga0062384_1008820962 | 3300004082 | Bog Forest Soil | MNVRPGVEVASLTDVGCQRENNEDSFLYWEPAGDREFQRK |
| Ga0062386_1003307781 | 3300004152 | Bog Forest Soil | MSVDCMNVRPGVEVASLTDVGCQRDNNEDSYLYWEPASDEEFQRKGR |
| Ga0066672_104364322 | 3300005167 | Soil | MRNRPGVELASLTDVGCKRENNEDSYAYWEPANDADFAELGRLAIVA |
| Ga0066679_100318956 | 3300005176 | Soil | MGIRAGVEFAHLSDIGCQREQNEDFSGYWERDDEEQYRRKGRLAVIADG |
| Ga0066690_100004151 | 3300005177 | Soil | MGIRAGVEFAHLSDIGCQREQNEDFSGYWEPDDEEQYRRKGRLAVIADGM |
| Ga0066685_110884211 | 3300005180 | Soil | MKIRPGVEVAGLTDVGCQRENNEDSYGYWEPEDDVLFGQVGRLAVV |
| Ga0066687_105140451 | 3300005454 | Soil | MNVKPGVEVAGLSDVGCQRENNEDSFLYWEPASEVEFQRKGRLAVIADG |
| Ga0070741_100557371 | 3300005529 | Surface Soil | MDVRPGIEVAALSDIGCQRENNEDRYGYWEPVSDEQFR |
| Ga0070731_100534713 | 3300005538 | Surface Soil | MKVRPGVELASLSDVGCQRENNEDRYSYWEPAADSEF |
| Ga0066661_105095892 | 3300005554 | Soil | MRIRPGIEVASLSDVGCQRQNNEDRYSYWEPASEE |
| Ga0066704_104034752 | 3300005557 | Soil | MPVDCINPKPGLEVASLTDIGRQRINNEDSCLYWEPDSDEEFSRKGRLAVIA |
| Ga0066699_107422571 | 3300005561 | Soil | MRIRPGLEVASLTDVGCHRENNEDYFTYWEPDSEEEFARKGR |
| Ga0066693_101346102 | 3300005566 | Soil | MPEMVHVRGAMQIRPGIELAGLSDVGCQRKNNEDRYSYWEPASEEEFRRKGR |
| Ga0066708_102380041 | 3300005576 | Soil | MRVRPGIEVVSLTDVGCQRENNEDNFVYWEPDDDAAFERLGRL |
| Ga0070761_103312523 | 3300005591 | Soil | VSVDCVTVKPGVEVASLSDIGCQRENNEDSYLYWEPAGD |
| Ga0070763_102677001 | 3300005610 | Soil | MSVDCMNVRPGVEVASLTDVGCQRDNNEDSYLYWEP |
| Ga0068856_1015358902 | 3300005614 | Corn Rhizosphere | MRPGIELAALSDTGCQRENNEDTYSYWEPASEEAFQRRGRLISIA |
| Ga0066903_1087870532 | 3300005764 | Tropical Forest Soil | MRVRPGLEIAGLSDVGCQRENNEDSYAYWEAEDDAVFRRLG |
| Ga0075277_10361942 | 3300005895 | Rice Paddy Soil | MPTRPGIEVAGLSDLGCQRENNEDRFAYWESSSDEEFNRKGRLA |
| Ga0070766_107142421 | 3300005921 | Soil | MQIRAGVEVGSLSDVGCQRENNEDALSYWEPQAEEAFQKKGRL |
| Ga0070717_115320951 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVRPGVEVAFLTDVGCKRENNEDYYAYWEPKEDAAFR |
| Ga0075028_1007277133 | 3300006050 | Watersheds | MAIRPGVELASLSDIGCQRENNEDSYSYWEAPSDEQYQ |
| Ga0075030_1007608462 | 3300006162 | Watersheds | MAVDCSNTKPGIEIASLTDVGLQRANNEDSYLYWEPDSDEDFRHKGRLAVIADGMGGYE |
| Ga0075018_102708182 | 3300006172 | Watersheds | MQIRPGIEMASLTDVGCQRENNEDSFSYWEPQSEAEFQQKG |
| Ga0075014_1002598901 | 3300006174 | Watersheds | MPVDCINPKPGLEVASLTDVGRLRANNEDSCLYWEPASDEEFARKG |
| Ga0097621_1010403182 | 3300006237 | Miscanthus Rhizosphere | MRPGIELAALSDTGCQRENNEDTYSYWEPTSEEAFQRKGRLISIADGMGGYEG |
| Ga0079222_108732903 | 3300006755 | Agricultural Soil | MRVRPGIELAGLSDVGCQRTNNEDRYSYWEPVDDRDFPQKGRLAIVADGMGG |
| Ga0066665_112787701 | 3300006796 | Soil | MKIRPGVEVAGLTDVGCQRENNEDSYGYWEPEDDVLFGQVGRLAV |
| Ga0066660_110852841 | 3300006800 | Soil | MRIRTGIELAALTDVGCERENNEDRYSYWEPASDEQFQQKGRLAI |
| Ga0075424_1002404751 | 3300006904 | Populus Rhizosphere | MKLRPGIAYAGLTDVGCERENNEDRFAYWEPASDELFARK |
| Ga0075424_1005103031 | 3300006904 | Populus Rhizosphere | MKVRPGLEIASVSDVGCQRDNNEDSYAYWESGDDAVFQRSG |
| Ga0079219_112038552 | 3300006954 | Agricultural Soil | MPVDITNPKPGVEAASLTDVGLQRDNNEDSYLYWEPEPEDEFRRKGRLAIVA |
| Ga0075435_1002925011 | 3300007076 | Populus Rhizosphere | MRVRPGVELAGLSDVGCQRENNEDRYSYWEPASDSEFPMKGRLAIVADGM |
| Ga0099827_105950391 | 3300009090 | Vadose Zone Soil | MRVRPGIELAGLSDIGCQRENNEDCFAYWEPDADEQ |
| Ga0105245_100473075 | 3300009098 | Miscanthus Rhizosphere | MRPGIELAALSDTGCQRENNEDTYSYWEPASEEAFQRRGR |
| Ga0066709_1027930171 | 3300009137 | Grasslands Soil | MKIRPGVELASLTDVGCQRENNEDSYGYWEPANDSDFGALGRLAIVA |
| Ga0105241_120333662 | 3300009174 | Corn Rhizosphere | MRVRPGVELAGLSDVGCQRENNEDRYSYWEPASDS |
| Ga0116225_10145614 | 3300009524 | Peatlands Soil | MAVELKTPKPGIEAASLTDVGRQRSNNEDSYIYWEPDADEDFRRKGRLAVVA |
| Ga0116110_10561751 | 3300009643 | Peatland | MKIRSGIELANLTDIGLQRENNEDYYGYWESDSDEEFQRKGRLAI |
| Ga0116217_103573373 | 3300009700 | Peatlands Soil | MPIRPGIEMAGQSDLGCQRENNEDSYAYWEPDSDVEFAQKGRLAVVADGM |
| Ga0116219_101052813 | 3300009824 | Peatlands Soil | MNVKPGIEVASLSDVGRQRENNEDAYLYWESSSEE |
| Ga0126380_105612381 | 3300010043 | Tropical Forest Soil | MTIRPGIELAGASDVGCQRENNEDQFAYWEPSGDDEFAQKGRLAIVADGM |
| Ga0126373_115495231 | 3300010048 | Tropical Forest Soil | MQIRPGIEIASLSDVGCQRENNEDALSYWEPQSDEVFQQKGRLALVADGM |
| Ga0074046_106819642 | 3300010339 | Bog Forest Soil | MQVKAGIELGSLSDVGCQRDNNEDWYSYWEPESEE |
| Ga0074046_109073592 | 3300010339 | Bog Forest Soil | MNVKPGVEVAGLTDVGCARENNEDSYLYWEPASEKEF |
| Ga0074044_102399791 | 3300010343 | Bog Forest Soil | MNVKPGVEVASLSDVGCQREDNEDSYLYWEPASDAEFMRKGRLA |
| Ga0126376_130333161 | 3300010359 | Tropical Forest Soil | MSVECVNPKPGLEVASLTDIGRLRGNNEDSSLYWEPDSDQEFSRKGRLAVIAD |
| Ga0126372_129116641 | 3300010360 | Tropical Forest Soil | MKLRPGIAYAGLTDVGCERENNEDRFAYWEPASDELFARKGRLVLI |
| Ga0126372_129363462 | 3300010360 | Tropical Forest Soil | MSVECVNPKPGLEVASLTDIGRLRGNNKDSSLYWKPDSDQEFSRKGRLAVIADGMDGYEGGQE |
| Ga0126378_119383382 | 3300010361 | Tropical Forest Soil | MQIRPGVEVASLSDVGCQRENNEDALFYWEPQSDDQFLRKG |
| Ga0126379_129671131 | 3300010366 | Tropical Forest Soil | MPVETKIRPGLEIASLSDIGCARENNEDSVGYWEPAEDAEF |
| Ga0126379_135750982 | 3300010366 | Tropical Forest Soil | MTIRPGIELAGASDVGCQRENNEDQFAYWEPSGDDEFA |
| Ga0126381_1021504582 | 3300010376 | Tropical Forest Soil | MPVDCSKTKPGLEVASLTDIGRQRANNEDSWVYWEPDSEKEIARKGR |
| Ga0137388_107271372 | 3300012189 | Vadose Zone Soil | MKVRPGVEVAGLSDVGCQRENNEDSYSYWEAPDDSSFARLGRLAIVAD |
| Ga0137363_108046602 | 3300012202 | Vadose Zone Soil | MRVRPGIELAGLSDVGCQRANNEDRYSYWEPADDQDFPLKGRLAIVADG |
| Ga0137399_104649162 | 3300012203 | Vadose Zone Soil | MPVEPGIEVASLSDVGCQRDNNEDSYLYWEPRDDQELQRK |
| Ga0137399_110165711 | 3300012203 | Vadose Zone Soil | MRIRPGIELAGLSDVGCQRKNNEDRYSYWEPADEEEFRHKGRLAIVADGM |
| Ga0137362_107974661 | 3300012205 | Vadose Zone Soil | MRIRPGVEIASLTDVGCQRENNEDSLGYWESADDAVFARLGRLAIVAD |
| Ga0137380_114271662 | 3300012206 | Vadose Zone Soil | MKVRAGVEVASLSDVGCQRENNEDSLSYWESPDDPSFARLGRLAIVADG |
| Ga0137377_103388491 | 3300012211 | Vadose Zone Soil | VRGAMQIRPGIELASLSDVGCQRQNNEDRYSYWEP |
| Ga0137370_103990713 | 3300012285 | Vadose Zone Soil | MRARPGIEVVSLTDVGCQRENNEDNFVYWEPDDDADFA |
| Ga0137386_112446362 | 3300012351 | Vadose Zone Soil | MKVRAGVEVASLSDVGCQRENNEDSYSYWESPDESAFARLG |
| Ga0137385_100142511 | 3300012359 | Vadose Zone Soil | MQGKLHVRGAMQIRPGIELAGLSDVGCQRKNNEDRYSYWEPVSDEEFRRKGRLAIVA |
| Ga0137360_102522832 | 3300012361 | Vadose Zone Soil | MRVRAGIELAGLSDVGCQRENNEDRYAYWEPADDHDVPLKGRLAIVADG |
| Ga0137390_106369271 | 3300012363 | Vadose Zone Soil | MKVRRGVELASLSDVGCQRENNEDRYSYWEPANDLEFPMKGRLAI |
| Ga0137390_110704542 | 3300012363 | Vadose Zone Soil | MKVRAGLEVASLSDVGCQRENNEDSYSYWESPDDSVFARLGRLAIVAD |
| Ga0137397_103086641 | 3300012685 | Vadose Zone Soil | MKVRPGVELASLSDVGCQRENNEDRYSYWEPANDLEFPMKGRLAIVAD |
| Ga0137395_109061412 | 3300012917 | Vadose Zone Soil | MKVRPGVELASLSDVGCQRENNEDRYSYWEPANDLEFPMKGRLAIVA |
| Ga0137394_100820991 | 3300012922 | Vadose Zone Soil | MEIRPGIEMASLSDVGCQRANNEDATSYWEPKTDDEFQRKGRLA |
| Ga0137394_109504471 | 3300012922 | Vadose Zone Soil | MKVRPGVELASLSDVGCQRENNEDRYSYWEPANDLEFPMKGRL |
| Ga0137416_109002271 | 3300012927 | Vadose Zone Soil | MEIRPGIEMASLSDVGCQRANNEDSTSYWEPQSDDEFQRKGRLAVVAD |
| Ga0126375_103961123 | 3300012948 | Tropical Forest Soil | MEIRPGIEMASLSDVGCQRQNNEDATSYWEPKTDDEFQQKGRLAVV |
| Ga0164309_118121781 | 3300012984 | Soil | MRPGVKLAGLSDVGCQRENNEDRFAYWESKNDAQFQEK |
| Ga0157373_103153211 | 3300013100 | Corn Rhizosphere | MRVRPGVELAGLSDVGCHRENNEDRYSYWEPASDSEFPMKGRLAI |
| Ga0157374_104556212 | 3300013296 | Miscanthus Rhizosphere | MRMRPGVKLAGLSDVGCQRENNEDRFAYWESKNDAQFQEKGR |
| Ga0157378_125854412 | 3300013297 | Miscanthus Rhizosphere | MKAEMRPGIELAALSDTGCQRENNEDTYSYWEPTSEEAFQRKGRLISIADGMGGY |
| Ga0181528_101842211 | 3300014167 | Bog | MLGVMNGKPGMDVAGLSDVGCQRENNEDSCLYWEPLSDAEFQRKGRLAVIADGMGGYEG |
| Ga0163163_105235071 | 3300014325 | Switchgrass Rhizosphere | MQIRPGIEVASQSDVGCCRENNEVYAYYWEPESDGDFKQKGRVALIADGMGGYEGGQEAS |
| Ga0182016_108513211 | 3300014493 | Bog | MRIRPGIELASLSDVGCLRPNNEDSYSYWEAFRREQFQQSG |
| Ga0182024_120886622 | 3300014501 | Permafrost | MRIRPGVDLASLSDIGCQRENNEDQYAYWEPSSDEEFARK |
| Ga0137420_14927098 | 3300015054 | Vadose Zone Soil | MASLSDVGCQRANNEDATSYWEPKTDEEFQRKGRLAVVADAWW |
| Ga0137409_107971862 | 3300015245 | Vadose Zone Soil | MEVASLTDVGRLRENNEDSYLYWEPDGDEELTRKGRLAIIA |
| Ga0182007_104045741 | 3300015262 | Rhizosphere | MQIRPGVELAGLTDVGCQRENNEDNYSYWEPESDEQFSRMGRL |
| Ga0137403_103960521 | 3300015264 | Vadose Zone Soil | MRPGIELAALSDVGCQRENNEDTYSYWEPASEEAFQHKGRLISVADGM |
| Ga0182033_106328921 | 3300016319 | Soil | MHIRPGIEMASLTDVGCQRENNEDFLSYWEPDSEADFQKKGRLALIADG |
| Ga0182032_100290384 | 3300016357 | Soil | MQIRPGIEIASLSDVGCQRENNEDALSYWEPQSDEVFQQKGRL |
| Ga0182032_119144601 | 3300016357 | Soil | MRIRAGIELAALTDLGCQRENNEDRFSYWEPPSDEQFAVKGRLVSVA |
| Ga0182034_117197852 | 3300016371 | Soil | MHIRPGIEMASLTDVGCQRENNEDFLSYWEPDSEADFQKKG |
| Ga0187856_13408021 | 3300017925 | Peatland | MSVDYMNVKPGMEVASLSDVGCQRDNNEDSYLYWEPTADRE |
| Ga0187803_103421152 | 3300017934 | Freshwater Sediment | LASMSDIGCQRENNEDHYTYWEPADDTEFARKGRLAIV |
| Ga0187821_100484881 | 3300017936 | Freshwater Sediment | VASLSDVGCQRENNEDALSYWEPQSETQFQQKGRLALVAD |
| Ga0187821_103029672 | 3300017936 | Freshwater Sediment | MQIRPGIEVASLSDVGCQRENNEDALSYWEPQSDEVFQQKG |
| Ga0187808_104305112 | 3300017942 | Freshwater Sediment | MSVDCMNVKPGMEVASLTNVGCQRDNNEDSFLYWEPASDGEFHRKGRLAVIAD |
| Ga0187808_105813502 | 3300017942 | Freshwater Sediment | MAVDPNSARPGIEVASLTDVGLQRSNNEDCCLYWEPSGDEDFRRKGRLAVIADGM |
| Ga0187819_103684603 | 3300017943 | Freshwater Sediment | MQIRPGVELASLSDIGCQRENNEDQYAYWEPADDKEFARKGRLAIV |
| Ga0187778_103918851 | 3300017961 | Tropical Peatland | MQSGRGVMRVRDGVEVAGLSDVGCQRENNEDRYSYWEP |
| Ga0187783_100511491 | 3300017970 | Tropical Peatland | MEVAGLSDIGCQRENNEDSFLYWEPADEREFQRKGRLAIVADGM |
| Ga0187783_104362753 | 3300017970 | Tropical Peatland | LNEAKSMQVRKGVAVAGISDVGCQRTNNEDSYAYWESASDSEYEQKGRLAVVADGMG |
| Ga0187781_113372902 | 3300017972 | Tropical Peatland | MAVEWNQTKPGVEIAGLTDVGRQRSNNEDSYLYWEPDSEEEFRHKGRLAVVAD |
| Ga0187780_108723162 | 3300017973 | Tropical Peatland | MQVRKGIEVAGISDVGCQRTNNEDSYAYWESASDSEYEQKGRLAVVADG |
| Ga0187777_100810031 | 3300017974 | Tropical Peatland | MAVDTQKIKPGLEIASLTDVGLQRSNNEDSCLYWEPVSDDDFHRKGRLAVVADGM |
| Ga0187782_104479341 | 3300017975 | Tropical Peatland | VSRMENDNEAMEVRAGVEVAGMSDVGCQRQSNEDRYGYWEPSSDAEFEDKGRLAVVADGM |
| Ga0187868_12202561 | 3300018002 | Peatland | MSVDYMNVKPGMEVASLSDVGCQRDNNEDSYLYWEPT |
| Ga0187804_100118831 | 3300018006 | Freshwater Sediment | MQTRDDMELGSLSDVGCQRENNEDYYSYWEPADAEQFARKGRL |
| Ga0187873_13172792 | 3300018013 | Peatland | MSVDCSKVKPGMEVAGLTDVGCQREHNEDSYLYWEPADEEEFRRK |
| Ga0187886_11141242 | 3300018018 | Peatland | MSVDCMNVKPGVEVASLSDVGCQRDNNEDSYLYWEPAAEGEFQGKGRLAVI |
| Ga0187874_102703761 | 3300018019 | Peatland | MAVDCKAPKPGIEAASLTDVGRQRSNNEDSFLYWEPDSDEEFLRKGRLA |
| Ga0187869_103052092 | 3300018030 | Peatland | MAVDSKTPKPGIEAASLTDVGLQRSNNEDSYLYWEPDSDEDFRRKGRLAVVAD |
| Ga0187887_100700152 | 3300018043 | Peatland | MPVDAKAPRPGIEAASLTDVGRQRSNNEDSFLYWEPISDQDFRRKGRLAVVADGM |
| Ga0184621_102954391 | 3300018054 | Groundwater Sediment | MPIRPGVEVASLSDVGCQRENNEDALSYWEPQGDD |
| Ga0187766_103240623 | 3300018058 | Tropical Peatland | MHGRVEVAGMSDVGCQRRSNEDRYGYWEPSSEIEL |
| Ga0187769_100562884 | 3300018086 | Tropical Peatland | MEELSVDCMNAKPGVEVASLTDLGCQRENNEDSCLYWEPAGEEELQRKGRLAV |
| Ga0187771_109439871 | 3300018088 | Tropical Peatland | MQSEAKLMRIREGIEVAGMSDVGCQRQNNEDSYAYWEPASDLEYERKGRLAIV |
| Ga0187770_100944194 | 3300018090 | Tropical Peatland | MQSEAKLMRMREGIEVAGMSDVGCQRENNEDCYAYWEPA |
| Ga0187770_102611353 | 3300018090 | Tropical Peatland | MASEAKLMRIREGIEVAGLSDVGCQRQNNEDSYAYWEP |
| Ga0066662_127782981 | 3300018468 | Grasslands Soil | MPVDCKTPKPGIEAASLTDVGLQRADNEDSYLYWEPDSADEFRRKGRLAIV |
| Ga0193715_11161841 | 3300019878 | Soil | MRIRPGIELASLSDVGCQRQNNEDRYSYWEPKSEDEFRRK |
| Ga0193729_11923772 | 3300019887 | Soil | MPVKPGIEVASRSDVGCQRDNNEDSYLYWEPRDHQELQ |
| Ga0193751_12602012 | 3300019888 | Soil | MNARPGIEVASLTDIGRQRENNEDSYLYWEPASDEEF |
| Ga0193728_11240462 | 3300019890 | Soil | MKVRAGVEVASLSDVGCQRENNEDSYSYWESPEDSTFARLGRLA |
| Ga0193726_12713292 | 3300020021 | Soil | MAVDLNTRKPGIETASLTDVGRQRANNEDSYLYWEPDSEEDFLRKGRLAVVAD |
| Ga0210407_104533642 | 3300020579 | Soil | MSVDCMNVKPGIEVASLSDVGCQRENNEDSYLYWEPLTESEFQRKGRLAVI |
| Ga0210403_108211281 | 3300020580 | Soil | MSVDCMNVRPGVEVASLTDVGCQRDNNEDSYLYWEPVSDEEFRRKGRLAVI |
| Ga0210403_115304921 | 3300020580 | Soil | MSVDCMNVKPGIEVASLSDVGCQRENNEDSYLYWEPLTESEFQRKGR |
| Ga0210395_106179931 | 3300020582 | Soil | MSDIGCQRENNEDQLTYWEPAADEEFARKGRLAIVAD |
| Ga0210401_115439922 | 3300020583 | Soil | MRIRPGIELAGLSDIGCQRENNEDQFAYWEPADDEEFARKG |
| Ga0210400_100146981 | 3300021170 | Soil | MSVDCMNVKPGIEVASLSDVGCQRENNEDSYLYWEPLTDAEFQRKGRLA |
| Ga0210400_100791671 | 3300021170 | Soil | VQGVMRIRPGVELASLSDIGCQRENNEDQYAYWEPAGDEEFARKG |
| Ga0210400_101939362 | 3300021170 | Soil | MKVRPGVELASLSDVGCQRENNEDRYSYWEPASDPEFPRKGRLAIVAD |
| Ga0210400_106131042 | 3300021170 | Soil | MRIRPGVELASLSDIGCQRENNEDQYAYWEPANDEEFARKG |
| Ga0210408_105665022 | 3300021178 | Soil | MKVRPGIELAGLSDVGCQRENNEDRYAYWEPADDQ |
| Ga0210396_114121441 | 3300021180 | Soil | MKVRPGVELASLSDVGCQRENNEDRYSYWEPASDPEFPRKG |
| Ga0213876_104789712 | 3300021384 | Plant Roots | MKVRPGVEIASLTDVGCERENNEDSYGYWESEDEETFAR |
| Ga0210393_113036542 | 3300021401 | Soil | MAVDCSNTKPGIEIASLTDVGRQRTNNEDSYLYWEPDSDEDFRRKGRLAVIAD |
| Ga0210389_111239251 | 3300021404 | Soil | MAVDSKTPKPGIEAASLTDVGRQRSNNEDSFIYWEPDSDEDFRRKGRLAVI |
| Ga0210394_112583951 | 3300021420 | Soil | LSVDCMNARPGVEVASLTDVGCQRENNEDSFLYWEPAD |
| Ga0210390_115188011 | 3300021474 | Soil | MAIDCKTPKPGIEAASLTDIGRLRSNNEDSYLYWEPDSDDDFLRKGRLAVIADGMGG |
| Ga0210398_106441681 | 3300021477 | Soil | MVIHCMDVKPGMEVACLTDVGRQRENNEDSCLYWEPQDKAEFLRKGRLAVIA |
| Ga0210402_103337351 | 3300021478 | Soil | MRIRPGVQLASMSDIGCQRENNEDQYAYWEPGADKEFARKGRLA |
| Ga0210402_112745741 | 3300021478 | Soil | VSLDCMNVKPGMEVAGLSDVGCQRENNEDSYLYWEPAND |
| Ga0224541_10040453 | 3300022521 | Soil | LSVDCMNVKPGVEVAGLSDVGCQRENNEDSYLYWEPAG |
| Ga0224563_10108691 | 3300022731 | Soil | MSVDCMKVKPGMEVASLSDVGCQRENNEDSYLYWEPVGEEEFQRKGR |
| Ga0224562_10145132 | 3300022733 | Soil | MVIHCMDVKPGMEVACLTDVGRQRENNEDSCLYWEPQDKADFLRKGRRRLG |
| Ga0222622_104938111 | 3300022756 | Groundwater Sediment | MKMRPGLEIAGLTDVGCQRENNEDSYGYWEPQGDADF |
| Ga0224550_10607713 | 3300022873 | Soil | VAGLSDVGCQRENNEDSYLYWEPSGDEEFQRKGRLAVIA |
| Ga0224560_1009661 | 3300023019 | Soil | MSVDCMKVKPGMEVASLSDVGCQRENNEDSYLYWEPVGEEEFQRKGRLAVIADGM |
| Ga0224568_10234802 | 3300024220 | Plant Litter | MSVDCMNVRPGVEVASLTDVGCQRDNNEDSYLYWEPPNDQDFQ |
| Ga0208935_10545021 | 3300025414 | Peatland | MAVDSKTPKPGIEAASLTDVGLQRSNNEDSYLYWEPDSDEDFRRKGRLAVV |
| Ga0208323_10503681 | 3300025439 | Peatland | MSVDYMNVKPGMEVASLSDVGCQRDNNEDSYLYWEPTADREFHRK |
| Ga0207654_100318813 | 3300025911 | Corn Rhizosphere | VELAGLSDVGCQRENNEDRYSYWEPASDSEFPMKGRLAIVADGMG |
| Ga0207687_100358385 | 3300025927 | Miscanthus Rhizosphere | MRPGIELAALSDTGCQRENNEDTYSYWEPASEEAFQRRGRL |
| Ga0207687_103923781 | 3300025927 | Miscanthus Rhizosphere | MRVRPGVELAGLSDVGCQRENNEDRYSYWEPADDAQFP |
| Ga0207664_113921681 | 3300025929 | Agricultural Soil | MKIRPGVELASLTDVGCQRENNEDSFGYWEPANDAE |
| Ga0207706_113254361 | 3300025933 | Corn Rhizosphere | MRPGIELAALSDTGCQRENNEDTYSYWEPASEEAFQ |
| Ga0207704_112748242 | 3300025938 | Miscanthus Rhizosphere | MRPGIELAALSDTGCQRENNEDTYSYWEPASEEAFQRRGRLISIADGMGG |
| Ga0207712_100497761 | 3300025961 | Switchgrass Rhizosphere | VELAGLSDVGCQRENNEDRYSYWEPASDSEFPMKGRLAIVADGM |
| Ga0207639_100855012 | 3300026041 | Corn Rhizosphere | MRVRPGVELAGLSDVGCQRENNEDRYSYWEPASDSEFP |
| Ga0207702_108390871 | 3300026078 | Corn Rhizosphere | MRVRPGVELAGLSDVGCQRENNEDRYSYWEPADDAQFPAKGRLAIVA |
| Ga0207702_114638661 | 3300026078 | Corn Rhizosphere | MRPGIELAALSDTGCQRENNEDTYSYWEPASEEAFQRRGRLSSI |
| Ga0207641_111439603 | 3300026088 | Switchgrass Rhizosphere | MKFRPGIAYAGLTDVGCERENNEDRFAYWEAASDELF |
| Ga0209871_10499422 | 3300026217 | Permafrost Soil | MKVRPGVELASLSDVGCQRENNEDRYSYWEPASDLEFPMKGRLAIVADG |
| Ga0209237_10862581 | 3300026297 | Grasslands Soil | MQIRPGIELAGLSDVGCQRKNNEDRYSYWEPVSDE |
| Ga0209801_10782013 | 3300026326 | Soil | MRIRPGIEIAGLTDVGCQRENNEDSLGYWESADDAVFARLGRLAV |
| Ga0257172_11033281 | 3300026482 | Soil | MNARPGIEVASLTDIGRQRENNEDSYLYWEPGSDEEFQRKGRLAIVA |
| Ga0209808_11425701 | 3300026523 | Soil | MKVRPGVELASLTDVGCHRENNEDSYGYWEADDDASFAASGRLALVADG |
| Ga0209056_105507541 | 3300026538 | Soil | MGIRAGVEFAHLSDIGCQREQNEDFSGYWEPDDEEQYRRKGRLAVIADGMGG |
| Ga0209805_11521871 | 3300026542 | Soil | MRIRPGLEVASLTDVGCHRENNEDYFTYWEPDSEEEFARKGRL |
| Ga0209577_104296712 | 3300026552 | Soil | MTVRPGIELAGLTDVGCQRENNEDRYSYWEPASDQQFP |
| Ga0179587_108699561 | 3300026557 | Vadose Zone Soil | MHVKPGVEVASLSDIGCQRDNNEDSFLYWEPAGDAEFQRKGRLAVIADGM |
| Ga0209332_10713922 | 3300027439 | Forest Soil | MAIDCKTPKPGIEAASLTDIGRLRSNNEDSYLYWEPDSDDDFLRKGRLA |
| Ga0209419_11151401 | 3300027537 | Forest Soil | MQVRPDVEVAGLTDVGCQRQNNEDSYLYWEPADNEEF |
| Ga0209219_11620251 | 3300027565 | Forest Soil | MASLSDIGCQRENNEDQYAYWEPADDEEFARKGRLAIVA |
| Ga0209420_12056972 | 3300027648 | Forest Soil | MVIHCMDVKPGMEVACLTDVGRQRENNEDSCLYWEPQDKT |
| Ga0209007_10613292 | 3300027652 | Forest Soil | MVIHCMDVKPGMEVACLTDVGRQRENNEDSCLYWEPQDKTEFLRKGRLAV |
| Ga0209009_10605863 | 3300027667 | Forest Soil | LSVDCIRVRPGVEVASLSDVGCQRQNNEDSYLYWEPADD |
| Ga0209333_10296341 | 3300027676 | Forest Soil | VTVDCMKVKPGIEVASLSDVGCQRENNEDSYLYWEPADDEEFQRKGRLAVIADG |
| Ga0209011_11510773 | 3300027678 | Forest Soil | MAIDGMKVKPGMEVASVTDVGHQRENNEDSFLYWEPESDEEVERKGRLA |
| Ga0209581_11467521 | 3300027706 | Surface Soil | MKIRPGVELASLTDVGCIRANNEDSYSYWEPDDDAVFQRLGRLAVV |
| Ga0209038_101722142 | 3300027737 | Bog Forest Soil | MSVCMNVRPGVEVASLTDVGCQRENNEDSFLYWEPAGDREFQRK |
| Ga0209274_100560882 | 3300027853 | Soil | MAVDSKTPKPGIEAASLTDIGRQRTNNEDSFLYWEPDSDEDFRRKGRLA |
| Ga0209465_102044361 | 3300027874 | Tropical Forest Soil | MRVRPGVELASLTDVGCQRENNEDRYSYWEPASDEDFRSKGRLAI |
| Ga0209415_102724005 | 3300027905 | Peatlands Soil | MPIRPGIEMAGLSDLGCQRENNEDSYAYWEPDSDVEFAQKGRLAVVA |
| Ga0209583_106428471 | 3300027910 | Watersheds | MAIRPGVELASLSDIGCQRENNEDSYSYWEGASEE |
| Ga0209069_103053663 | 3300027915 | Watersheds | MAIRPGVELASLSDIGCQRENNEDSYSYWEAPSDEQYQRK |
| Ga0265355_10235262 | 3300028036 | Rhizosphere | MDVKPGMEVACLTDVGRQRENNEDSCLYWEPQNEAEFRR |
| Ga0302231_102068012 | 3300028775 | Palsa | VLSAEVCELAVECIKVRPGVEVASLTDVGCVRDNNEDSFLYWEPAEDAEFLRKGRLA |
| Ga0302225_103995412 | 3300028780 | Palsa | VSVDCVTVKPGVEVASLSDVGCQRENNEDSYLYWEP |
| Ga0302225_105581412 | 3300028780 | Palsa | MVIHCMDVKPGMEVACLTDVGRQRENNEDSCLYWEPQDEADFLRKGRLAVIA |
| Ga0307312_102458772 | 3300028828 | Soil | MRIRPGIELASLSDVGCQRQNNEDRYSYWEPKSEDEF |
| Ga0302278_100519641 | 3300028866 | Bog | MSVDCSKVKPGMEVAGLTDVGCQRENNEDSYLYWEPADEEEFRRKGRLAVI |
| Ga0302197_102421111 | 3300028873 | Bog | MSVDCSKVKPGMEVAGLTDVGCQRENNEDSYLYWEPADEEEFRRKGR |
| Ga0311358_106448092 | 3300029915 | Bog | MSVDCSKVKPGMEVAGLTDVGCQRENNEDSYLYWEPADE |
| Ga0311343_110337242 | 3300029953 | Bog | MLIENMNVKPGIEVAGLSDVGCQRDNNEDSYLYWEPSGDSDFQRKGRLAV |
| Ga0265462_105298641 | 3300030738 | Soil | VKPGVEVASLSDVGCQRENNEDSYLYWEPAGDEEFKRKGRLAV |
| Ga0265765_10598012 | 3300030879 | Soil | MSVDCMNVRPGVEVASLTDVGCQRDNNEDSYLYWEPASDEEFR |
| Ga0170834_1105175363 | 3300031057 | Forest Soil | VSVDCMNVKPGVEVASLSDVGCQRENNEDSYLYWEPSGDEEFQR |
| Ga0265760_103787781 | 3300031090 | Soil | MSDIGCQRENNEDQLAYWEPAADEDFARKGRLAIVADGM |
| Ga0318528_106591072 | 3300031561 | Soil | MRIRPGIEMASLTDVGCQRENNEDFLSYWEPDSDADFLKKGRLALIAD |
| Ga0307474_101245563 | 3300031718 | Hardwood Forest Soil | MAVECMNVKPGMEVAILSDVGRVRGNNEDSYLYWEADGDEEFHR |
| Ga0307469_100688081 | 3300031720 | Hardwood Forest Soil | MKVRPGVELASLSDVGCQRENNEDRYSYWEPANDLEFPIKGRL |
| Ga0307469_102255811 | 3300031720 | Hardwood Forest Soil | MMQIRPGVEVASLSDVGCQRENNEDALSYWEPQSDDQFQRKGRLA |
| Ga0318501_104628972 | 3300031736 | Soil | MQIRPGLELASLTDVGCQRENNEDAFSYWEPQTDADFQEKGRLV |
| Ga0318554_105548921 | 3300031765 | Soil | MQIRPGIEIASLSDVGCQRENNEVALSYWEPQSDEVF |
| Ga0318568_109300591 | 3300031819 | Soil | MQIRPGIEIASLSDVGCQRENNEDALSYWEPQSDEVFQQKGR |
| Ga0307473_114342181 | 3300031820 | Hardwood Forest Soil | MKVRPGVELASLSDVGCQRENNEDRYSYWEPANDLEFPIKGRLAIV |
| Ga0307478_113492292 | 3300031823 | Hardwood Forest Soil | MSVDCMNVRPGVEVASLTDVGCQRDNNEDSYLYWEPTSDEEFRRKGRLAVI |
| Ga0310917_109164341 | 3300031833 | Soil | MQIRPGLELASLTDVGCQRENNEDAFSYWEPQTDADFQEKGRLVIIAD |
| Ga0306921_120533011 | 3300031912 | Soil | MAVECVNPKPGLEVASLTDIGRLRGNNEDSSLYWEPDSDTEFARKGRLAVI |
| Ga0310912_109943831 | 3300031941 | Soil | MAFECVNPKPGLEVASLTDIGRLRGNNEDSSLYWEPDSDTEFARKGRLAVIADGMGGY |
| Ga0306926_101334473 | 3300031954 | Soil | MAVECVNPKPGLEVASLTDIGRLRGNNEDSSLYWEPDSDTEFARKGRLAVIADGMGGYE |
| Ga0307479_110768052 | 3300031962 | Hardwood Forest Soil | MKIRPGVELASLTDVGCVRENNEDSYSYWEPEDDALFAAFGR |
| Ga0307479_112382932 | 3300031962 | Hardwood Forest Soil | MKVRPGLEIASVTDVGCQRDNNEDSYAYWESGDDAVFQRSGRLAVVAD |
| Ga0307470_101627802 | 3300032174 | Hardwood Forest Soil | MQIRPGIELAALTDLGCQRENNEDRYSYWEPSADQ |
| Ga0307471_1001772583 | 3300032180 | Hardwood Forest Soil | MQIRPGVEVASLSDIGCQRENNEDALSYWEPQSEEKFRRKGRLAL |
| Ga0306920_1024105211 | 3300032261 | Soil | MPVDCSKPKPGLEVASLTDIGRQRANNEDSFLYWEPDSDQELVRKGRLAVIAD |
| Ga0335079_103176913 | 3300032783 | Soil | MPVECTNPKPGLEVASLTDVGRQRLNNEDSFLYWEPDSDDDFRRKGRLAIVAD |
| Ga0335079_120907741 | 3300032783 | Soil | MRIREGVQVAGMSDLGCQRENNEDRYAYWEPASDAEFERKGRLAIVA |
| Ga0335078_120358302 | 3300032805 | Soil | MRIRPGVEVAGLSDVGCLRANNEDSYSYWEPARNEEFEQRGRLAIIADGMG |
| Ga0335080_122130642 | 3300032828 | Soil | VRIRDGVEVAGITDLGCQRQNNEDRYSYWEPAADQDFERKGRLA |
| Ga0335083_103114501 | 3300032954 | Soil | MPIRPGIEQAGLSDVGCLRSNNEDRYSYWEPAEDARFP |
| Ga0335077_112212601 | 3300033158 | Soil | MPVDLKSAKPGIEAASLTDVGLQRSNNEDSCLYWEPEGEEEFRRKGRLAVVADGM |
| Ga0371489_0482734_2_139 | 3300033755 | Peat Soil | MSVDCMNVKPGVEVASLSDVGCQRDNNEDSYLYWEPAAEGEFQRKG |
| Ga0314866_002841_1730_1873 | 3300033807 | Peatland | MAVDTQKIKPGLEIASLTDVGLQRSNNEDSCLYWEPVSDDDFHRKGRL |
| ⦗Top⦘ |