| Basic Information | |
|---|---|
| Family ID | F018559 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 234 |
| Average Sequence Length | 40 residues |
| Representative Sequence | FYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKAEPSG |
| Number of Associated Samples | 156 |
| Number of Associated Scaffolds | 234 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 12.75 % |
| % of genes near scaffold ends (potentially truncated) | 46.58 % |
| % of genes from short scaffolds (< 2000 bps) | 52.99 % |
| Associated GOLD sequencing projects | 140 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.402 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (17.094 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.222 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.308 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.74% β-sheet: 0.00% Coil/Unstructured: 78.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 234 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 5.56 |
| PF00072 | Response_reg | 2.99 |
| PF07883 | Cupin_2 | 1.71 |
| PF13924 | Lipocalin_5 | 1.71 |
| PF00583 | Acetyltransf_1 | 1.28 |
| PF00005 | ABC_tran | 1.28 |
| PF07589 | PEP-CTERM | 0.85 |
| PF00561 | Abhydrolase_1 | 0.85 |
| PF01068 | DNA_ligase_A_M | 0.85 |
| PF13649 | Methyltransf_25 | 0.85 |
| PF04909 | Amidohydro_2 | 0.85 |
| PF00754 | F5_F8_type_C | 0.85 |
| PF00041 | fn3 | 0.85 |
| PF03060 | NMO | 0.85 |
| PF00211 | Guanylate_cyc | 0.85 |
| PF03480 | DctP | 0.85 |
| PF07681 | DoxX | 0.85 |
| PF00496 | SBP_bac_5 | 0.85 |
| PF00106 | adh_short | 0.85 |
| PF00037 | Fer4 | 0.43 |
| PF13751 | DDE_Tnp_1_6 | 0.43 |
| PF02417 | Chromate_transp | 0.43 |
| PF02824 | TGS | 0.43 |
| PF01551 | Peptidase_M23 | 0.43 |
| PF01695 | IstB_IS21 | 0.43 |
| PF13551 | HTH_29 | 0.43 |
| PF00848 | Ring_hydroxyl_A | 0.43 |
| PF03886 | ABC_trans_aux | 0.43 |
| PF13282 | DUF4070 | 0.43 |
| PF02698 | DUF218 | 0.43 |
| PF12681 | Glyoxalase_2 | 0.43 |
| PF16861 | Carbam_trans_C | 0.43 |
| PF01699 | Na_Ca_ex | 0.43 |
| PF13531 | SBP_bac_11 | 0.43 |
| PF07690 | MFS_1 | 0.43 |
| PF03400 | DDE_Tnp_IS1 | 0.43 |
| PF01244 | Peptidase_M19 | 0.43 |
| PF03088 | Str_synth | 0.43 |
| PF03928 | HbpS-like | 0.43 |
| PF00326 | Peptidase_S9 | 0.43 |
| PF05494 | MlaC | 0.43 |
| PF00903 | Glyoxalase | 0.43 |
| PF01925 | TauE | 0.43 |
| PF07603 | DUF1566 | 0.43 |
| PF17164 | DUF5122 | 0.43 |
| PF11752 | DUF3309 | 0.43 |
| PF10415 | FumaraseC_C | 0.43 |
| PF14350 | Beta_protein | 0.43 |
| PF13592 | HTH_33 | 0.43 |
| PF00772 | DnaB | 0.43 |
| PF12680 | SnoaL_2 | 0.43 |
| PF02374 | ArsA_ATPase | 0.43 |
| PF01494 | FAD_binding_3 | 0.43 |
| PF10115 | HlyU | 0.43 |
| PF13472 | Lipase_GDSL_2 | 0.43 |
| PF13602 | ADH_zinc_N_2 | 0.43 |
| PF00892 | EamA | 0.43 |
| PF14659 | Phage_int_SAM_3 | 0.43 |
| PF01575 | MaoC_dehydratas | 0.43 |
| PF07992 | Pyr_redox_2 | 0.43 |
| PF00486 | Trans_reg_C | 0.43 |
| PF04226 | Transgly_assoc | 0.43 |
| PF13701 | DDE_Tnp_1_4 | 0.43 |
| COG ID | Name | Functional Category | % Frequency in 234 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 5.56 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.85 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 0.85 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.85 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.85 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.85 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.85 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.85 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.85 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.85 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.43 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.43 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.43 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.43 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.43 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.43 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.43 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.43 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.43 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.43 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.43 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.83 % |
| Unclassified | root | N/A | 40.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0913505 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100780334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1120 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105731267 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1365 | Open in IMG/M |
| 3300000443|F12B_11447871 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 846 | Open in IMG/M |
| 3300000559|F14TC_101030464 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300000955|JGI1027J12803_105432850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1148 | Open in IMG/M |
| 3300000956|JGI10216J12902_112882057 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300001431|F14TB_100585160 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300002912|JGI25386J43895_10045691 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1270 | Open in IMG/M |
| 3300004281|Ga0066397_10112909 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300004479|Ga0062595_102025770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300004633|Ga0066395_10016602 | All Organisms → cellular organisms → Bacteria | 2848 | Open in IMG/M |
| 3300004633|Ga0066395_10336420 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 835 | Open in IMG/M |
| 3300005174|Ga0066680_10041258 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2670 | Open in IMG/M |
| 3300005174|Ga0066680_10636375 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300005179|Ga0066684_10196782 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300005180|Ga0066685_11061744 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005332|Ga0066388_100659961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1659 | Open in IMG/M |
| 3300005332|Ga0066388_101008841 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300005332|Ga0066388_103799837 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300005445|Ga0070708_100172403 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
| 3300005467|Ga0070706_100521446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 1105 | Open in IMG/M |
| 3300005467|Ga0070706_101343547 | Not Available | 655 | Open in IMG/M |
| 3300005468|Ga0070707_100346242 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1444 | Open in IMG/M |
| 3300005471|Ga0070698_100117626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2620 | Open in IMG/M |
| 3300005549|Ga0070704_101406449 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005552|Ga0066701_10041711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2467 | Open in IMG/M |
| 3300005552|Ga0066701_10195813 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300005557|Ga0066704_10198450 | Not Available | 1356 | Open in IMG/M |
| 3300005558|Ga0066698_11110031 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005598|Ga0066706_11478206 | Not Available | 512 | Open in IMG/M |
| 3300005713|Ga0066905_101043507 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 723 | Open in IMG/M |
| 3300005713|Ga0066905_102322862 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300005764|Ga0066903_100021424 | All Organisms → cellular organisms → Bacteria | 6910 | Open in IMG/M |
| 3300006034|Ga0066656_10233518 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300006058|Ga0075432_10224659 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300006196|Ga0075422_10612425 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006796|Ga0066665_10154917 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300006844|Ga0075428_100141901 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
| 3300006852|Ga0075433_10022296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5315 | Open in IMG/M |
| 3300006852|Ga0075433_10265499 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300006852|Ga0075433_10474912 | Not Available | 1102 | Open in IMG/M |
| 3300006852|Ga0075433_10991111 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300006853|Ga0075420_101050265 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 701 | Open in IMG/M |
| 3300006854|Ga0075425_100004474 | All Organisms → cellular organisms → Bacteria | 14429 | Open in IMG/M |
| 3300006854|Ga0075425_101343584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 810 | Open in IMG/M |
| 3300006871|Ga0075434_100723035 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300006876|Ga0079217_10711253 | Not Available | 678 | Open in IMG/M |
| 3300007076|Ga0075435_100064534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2976 | Open in IMG/M |
| 3300007076|Ga0075435_101156640 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 677 | Open in IMG/M |
| 3300007265|Ga0099794_10423987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 696 | Open in IMG/M |
| 3300009012|Ga0066710_100317202 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2291 | Open in IMG/M |
| 3300009038|Ga0099829_10117199 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2092 | Open in IMG/M |
| 3300009089|Ga0099828_10838923 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300009100|Ga0075418_10160461 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2393 | Open in IMG/M |
| 3300009100|Ga0075418_10346275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1586 | Open in IMG/M |
| 3300009100|Ga0075418_11223112 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300009147|Ga0114129_10322829 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300009147|Ga0114129_10371437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1890 | Open in IMG/M |
| 3300009147|Ga0114129_10411932 | Not Available | 1779 | Open in IMG/M |
| 3300009147|Ga0114129_13146761 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300009162|Ga0075423_11336675 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 766 | Open in IMG/M |
| 3300010046|Ga0126384_10139663 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1851 | Open in IMG/M |
| 3300010046|Ga0126384_12087056 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300010047|Ga0126382_11863989 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300010320|Ga0134109_10111494 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 960 | Open in IMG/M |
| 3300010336|Ga0134071_10547939 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300010359|Ga0126376_10019595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4402 | Open in IMG/M |
| 3300010359|Ga0126376_10319308 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1360 | Open in IMG/M |
| 3300010359|Ga0126376_10352545 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300010359|Ga0126376_10939339 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300010360|Ga0126372_11569280 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 696 | Open in IMG/M |
| 3300010362|Ga0126377_10351464 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1471 | Open in IMG/M |
| 3300010362|Ga0126377_10514343 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1231 | Open in IMG/M |
| 3300010362|Ga0126377_11970594 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300010362|Ga0126377_13200095 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 529 | Open in IMG/M |
| 3300010362|Ga0126377_13329678 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300010376|Ga0126381_101062829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1169 | Open in IMG/M |
| 3300010398|Ga0126383_11650121 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300012204|Ga0137374_10335674 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300012204|Ga0137374_11000742 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 604 | Open in IMG/M |
| 3300012205|Ga0137362_10303257 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1383 | Open in IMG/M |
| 3300012208|Ga0137376_11664082 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012211|Ga0137377_11488130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 603 | Open in IMG/M |
| 3300012359|Ga0137385_11546417 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012582|Ga0137358_10670953 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012685|Ga0137397_11138465 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 566 | Open in IMG/M |
| 3300012948|Ga0126375_11690006 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012972|Ga0134077_10085245 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1207 | Open in IMG/M |
| 3300012976|Ga0134076_10057265 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1481 | Open in IMG/M |
| 3300013306|Ga0163162_11618289 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 739 | Open in IMG/M |
| 3300014326|Ga0157380_12817509 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300015053|Ga0137405_1366488 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1787 | Open in IMG/M |
| 3300015245|Ga0137409_10207682 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
| 3300015264|Ga0137403_10874608 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 750 | Open in IMG/M |
| 3300015373|Ga0132257_100432565 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1604 | Open in IMG/M |
| 3300015373|Ga0132257_103961187 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300015374|Ga0132255_100125972 | All Organisms → cellular organisms → Bacteria | 3531 | Open in IMG/M |
| 3300017997|Ga0184610_1225859 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300018053|Ga0184626_10024840 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
| 3300018063|Ga0184637_10195171 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1242 | Open in IMG/M |
| 3300018431|Ga0066655_10995718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 579 | Open in IMG/M |
| 3300021560|Ga0126371_12215264 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300025910|Ga0207684_10044358 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3770 | Open in IMG/M |
| 3300025910|Ga0207684_11008712 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300025923|Ga0207681_11459780 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300025938|Ga0207704_11739921 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300026309|Ga0209055_1145433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 833 | Open in IMG/M |
| 3300026313|Ga0209761_1035460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2942 | Open in IMG/M |
| 3300026331|Ga0209267_1063691 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1628 | Open in IMG/M |
| 3300026332|Ga0209803_1014760 | All Organisms → cellular organisms → Bacteria | 3998 | Open in IMG/M |
| 3300026332|Ga0209803_1243221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 624 | Open in IMG/M |
| 3300026342|Ga0209057_1224652 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300026529|Ga0209806_1030341 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2690 | Open in IMG/M |
| 3300026538|Ga0209056_10390423 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 869 | Open in IMG/M |
| 3300026552|Ga0209577_10581419 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300027384|Ga0209854_1101826 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300027646|Ga0209466_1022335 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300027748|Ga0209689_1017119 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 4583 | Open in IMG/M |
| 3300027874|Ga0209465_10072074 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300027874|Ga0209465_10384867 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 702 | Open in IMG/M |
| 3300027907|Ga0207428_10934937 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300027907|Ga0207428_11206886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
| 3300027957|Ga0209857_1059255 | Not Available | 665 | Open in IMG/M |
| 3300028819|Ga0307296_10534913 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 641 | Open in IMG/M |
| 3300031226|Ga0307497_10329916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300031561|Ga0318528_10202760 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1061 | Open in IMG/M |
| 3300031713|Ga0318496_10265474 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300031720|Ga0307469_10640444 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300031720|Ga0307469_11387884 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 670 | Open in IMG/M |
| 3300031723|Ga0318493_10872677 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031740|Ga0307468_100243923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1257 | Open in IMG/M |
| 3300031740|Ga0307468_100288386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1183 | Open in IMG/M |
| 3300031770|Ga0318521_10558091 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031792|Ga0318529_10147037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1083 | Open in IMG/M |
| 3300031805|Ga0318497_10503701 | Not Available | 678 | Open in IMG/M |
| 3300031820|Ga0307473_10122562 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300031820|Ga0307473_10779139 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300031820|Ga0307473_11076124 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031832|Ga0318499_10023493 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2169 | Open in IMG/M |
| 3300031845|Ga0318511_10551127 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300031897|Ga0318520_10022476 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3033 | Open in IMG/M |
| 3300031941|Ga0310912_10780939 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300032013|Ga0310906_10008532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiorhodovibrio → unclassified Thiorhodovibrio → Thiorhodovibrio sp. 970 | 3784 | Open in IMG/M |
| 3300032052|Ga0318506_10426613 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300032180|Ga0307471_101224596 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 914 | Open in IMG/M |
| 3300032205|Ga0307472_100167419 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300033289|Ga0310914_10411059 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1225 | Open in IMG/M |
| 3300033811|Ga0364924_022762 | Not Available | 1246 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.09% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.24% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.71% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.43% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.43% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.43% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_09135053 | 2228664022 | Soil | YTSGMEHSPTSATGTAWERTPWHAVRNAAWDALKRD |
| INPhiseqgaiiFebDRAFT_1007803341 | 3300000364 | Soil | YTTGMEHSPTSAMGTGWERTPWRAVQGAARDALKAG* |
| INPhiseqgaiiFebDRAFT_1057312673 | 3300000364 | Soil | FYTTGMEHSPTSATGTAWERTPWHATQKAAWDALKRAHTS* |
| F12B_114478711 | 3300000443 | Soil | FYTTGMEHSPTSATGSAWERTPWHAVQGAAREALNNDKTTA* |
| F14TC_1004193712 | 3300000559 | Soil | TSGMEHSPTSATGTAWERTPWLATQRAAWEVLRK* |
| F14TC_1010304641 | 3300000559 | Soil | TGMEHSPTSATGTGWQRTPWHATQRAAWETLRHADVSD* |
| JGI1027J12803_1054328503 | 3300000955 | Soil | TFYTTGMEHSPTSATGTGWERTPRHATQRAAWESLRQQLFGA* |
| JGI10216J12902_1128820571 | 3300000956 | Soil | TFYTTGMEHSPTSATGTGWEPTPWHATQRAAWEVLKKGSTA* |
| F14TB_1005851601 | 3300001431 | Soil | TTGMEHSPTSATGTAWEPTPWQAVQGAARDALKRALIGPL* |
| JGI25386J43895_100456911 | 3300002912 | Grasslands Soil | YTSGMEHSPTSAMGTAWELTPXHAVQRAACEALKRSXIGG* |
| Ga0066397_101129091 | 3300004281 | Tropical Forest Soil | TFYTTGMEHSPTSATGTAWEPTPWRATQRAAWEALSRKKS* |
| Ga0062595_1020257701 | 3300004479 | Soil | ATFYTTGMEHSPTSVTGTGWEPTPWHATQQAAWEALRKSKED* |
| Ga0066395_100166023 | 3300004633 | Tropical Forest Soil | MFYTTGMEHSPMSATGTEWERTSWRATQRAAWEALKRMLEKC* |
| Ga0066395_103364202 | 3300004633 | Tropical Forest Soil | MFYTTGMEHSRTSATGTARERTPWDATQRAAWEALERADRQ* |
| Ga0066680_100412581 | 3300005174 | Soil | LARDFYTTGMEHSPTSATGTGWERSAWHATQRAAWEALKKASG* |
| Ga0066680_106363752 | 3300005174 | Soil | RATFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALRKVKAAR* |
| Ga0066684_101967822 | 3300005179 | Soil | MSGMEHSLTRATGTAWERTPWRAVQGAAREALKQAGRDG* |
| Ga0066685_110617442 | 3300005180 | Soil | TFYTTGMEHSPTSATGTAWERTPWHATQRAAWEALRNAEATR* |
| Ga0066388_1006599613 | 3300005332 | Tropical Forest Soil | TFYTTGMEHSPTSATGIAWEPTAWHATQRAAWGALNKPNDDHK* |
| Ga0066388_1010088411 | 3300005332 | Tropical Forest Soil | ASRATFYTTGMEHSPTSTTGTAWERTPWHAVQRAAWGVLEKADGGS* |
| Ga0066388_1037998373 | 3300005332 | Tropical Forest Soil | ATFYTTGMEHSPTSATGTGWEPTPWHTTQRAAWEALKRTECRDL* |
| Ga0070708_1001724032 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MEHLPTSATGTGWERTPWHAAQSAPARLARSHGGGRNVELADAV |
| Ga0070706_1005214463 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MFYTTAIEHSPTSATGTGWERTPWHATQRAAWEALKKADTSG* |
| Ga0070706_1013435471 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ATFYATGMEHSPTSATGSAWERTSWHATQRAAWEARKRMETV* |
| Ga0070707_1003462421 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MFYTTGVEHSPTSATGTGWERAPWHATQRAAWEALRQVSAVGQG |
| Ga0070698_1001176262 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGMEHSPTSATGTGWERTPWHAVQRAAWEALRKHLDETV* |
| Ga0070704_1014064491 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RCHRAGTEMEHSPTSATGTAWERTPWHSTQRAAWAVLKKADT* |
| Ga0066701_100324381 | 3300005552 | Soil | MEHSPTSATGTGWERTPWHATQRAAWEALRQANRDG* |
| Ga0066701_100417111 | 3300005552 | Soil | FYTTGMEHSITSATGTGWERTPWRAVQGAAREALKKQEPTR* |
| Ga0066701_100700924 | 3300005552 | Soil | MEHSPTSATGTGWERTPWHATQRAAWEALKKGEESKG* |
| Ga0066701_101958134 | 3300005552 | Soil | ATFYTSGMEHSPTSATGSAWERTPWHAVQGAAGDALRRASRDG* |
| Ga0066661_100016973 | 3300005554 | Soil | MEHSPATGTGWERTPWHATQRAAWEALPKTEEGDR* |
| Ga0066661_101770393 | 3300005554 | Soil | MEHSPTGATGTGWERTPWHATQRAAWEALKKAESGS* |
| Ga0066707_107737542 | 3300005556 | Soil | MEHSPMSATGTGWERTPWHATQRAAWEALKKGEESKG* |
| Ga0066704_100816832 | 3300005557 | Soil | MEHSPTSATGTGWERTPSHATQRAAWEALKQAEMS* |
| Ga0066704_101984501 | 3300005557 | Soil | FYTTGVEHSPTSATGTAWERTPWHAVRRAAWEALKKVEPSG* |
| Ga0066698_111100312 | 3300005558 | Soil | ATFYTTGMEHSPTSATGAGWERTRWHATQRAAAWEALERAGETD* |
| Ga0066699_110452213 | 3300005561 | Soil | HSLTSATGTAWERTPWRAVQGAAREAFTHMEATR* |
| Ga0066706_114782061 | 3300005598 | Soil | YTSGMEHSPTSATGTGWERTPWHATQRAAWEALKKAGAGG* |
| Ga0066905_1001114882 | 3300005713 | Tropical Forest Soil | MEHLPTSATGTAWEQTPWHATQRAAWEALKRTEEIACYHPK* |
| Ga0066905_1010435072 | 3300005713 | Tropical Forest Soil | YTTGMEHSPTRATGSGRDRTPWRATQKAVWEVLRR* |
| Ga0066905_1023228621 | 3300005713 | Tropical Forest Soil | VTRSRKRATFYTTGMEPSAVSATGTAWERTPWHATQRAAWKAL |
| Ga0066903_1000214245 | 3300005764 | Tropical Forest Soil | MFYTSWMEHSPTSATGTAWERTPWRAAQRAAWEASRNHEKVTQ* |
| Ga0066903_1019131132 | 3300005764 | Tropical Forest Soil | MEHSPTSATGTAWEPTPWRATQRAAWEALDRESRS* |
| Ga0066696_108041133 | 3300006032 | Soil | HSLTSATGTAWEPTPWRAVQGAAREAFTHMEATR* |
| Ga0066656_102335185 | 3300006034 | Soil | FYTTGMEHSPTSATGTGWERAPWHAVQSAARHALTQGSRDA* |
| Ga0066656_103431661 | 3300006034 | Soil | MEHSPTSATGTGWERTPWHATQRAAGAALKQAEMS* |
| Ga0075432_102246592 | 3300006058 | Populus Rhizosphere | AYTIGIEHSPTSATGIGWERTPWQATRLAAWEVLIRLEGR* |
| Ga0075422_101292481 | 3300006196 | Populus Rhizosphere | TGMEHSPTSATGTGWVRTPWHATQRAVWEALKKTPESESG* |
| Ga0075422_106124251 | 3300006196 | Populus Rhizosphere | ATFYTTGMEHSPTSATGTGWEPTPWHATLRAASEVLKKAEEGER* |
| Ga0066665_100587144 | 3300006796 | Soil | MNPPTSATGTGWERTPWHATQRAAWGALKQAEMS* |
| Ga0066665_101549171 | 3300006796 | Soil | YTTGMEHSPTSATGTGWERTPWRATQRAAWDALKKAEPSG* |
| Ga0066660_101606581 | 3300006800 | Soil | MEHSPTSATGTGWERSAWHATQRAAWEALKKASG* |
| Ga0075428_1001419015 | 3300006844 | Populus Rhizosphere | LEATFYTTGMEHSPTRDRDGWERTLWHTTKRAALEVLKKGSTA* |
| Ga0075433_100222962 | 3300006852 | Populus Rhizosphere | MEHAATSATGTGWEPKPWQATQRAAWEALSRVND* |
| Ga0075433_100292538 | 3300006852 | Populus Rhizosphere | MEYSPAGATGTGWERTPWHATQRAAWEAVMKSEEGNR* |
| Ga0075433_102654994 | 3300006852 | Populus Rhizosphere | MSLTTGVEHSPTSATGTSWERTPWHATQRAPWEALSRVND* |
| Ga0075433_104749121 | 3300006852 | Populus Rhizosphere | YVSGMEYSPAGATGTGWERTPWHATQRAARKALRKAG* |
| Ga0075433_109911111 | 3300006852 | Populus Rhizosphere | FYTTGMEHSPTSATGTGWERTPWHAVQVAAWDTLRRRSI* |
| Ga0075433_112373013 | 3300006852 | Populus Rhizosphere | TGMEHSPTSATGTGWERTPWHATQRAVWEALKKTPESESG* |
| Ga0075420_1010502651 | 3300006853 | Populus Rhizosphere | RRATFYTTGIGHSATSATGTGWESTPWHATQRAAWEVLKKAEEGER* |
| Ga0075425_1000044745 | 3300006854 | Populus Rhizosphere | MRATFYTTGVEHSPTRGTGTGWERTPWHATQRAAWEALKKA* |
| Ga0075425_1013435843 | 3300006854 | Populus Rhizosphere | FYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKAEPSG* |
| Ga0075434_1007230352 | 3300006871 | Populus Rhizosphere | MFYTTAIEHSRTGATGTGWEPTPWRATQRAAWGTLKRVDG* |
| Ga0079217_107112532 | 3300006876 | Agricultural Soil | MEHSATSAIGSAWEKTPWRAVQRAAWAALNTPQPSQPGA* |
| Ga0075429_1000564493 | 3300006880 | Populus Rhizosphere | MEHSPTNATGTGWARTPWHATQRAAWEALRRAADG* |
| Ga0075419_104035361 | 3300006969 | Populus Rhizosphere | MEYSPAGATGTGWERTPWHATQQAAWEALDRAHRP* |
| Ga0075435_1000645344 | 3300007076 | Populus Rhizosphere | MGVAGMEHSPTSATGTGWERTAWHAVQRAAWDALRKDDG* |
| Ga0075435_1011566401 | 3300007076 | Populus Rhizosphere | TTGMEHSPTSATGTGSERTPWHATQRAAWDALTRAE* |
| Ga0099794_101907571 | 3300007265 | Vadose Zone Soil | TTGMEHSITSATPSVWERTPWHATQRAAWEALRTAK* |
| Ga0099794_104239872 | 3300007265 | Vadose Zone Soil | MEHSPTGAIGTAWERTPWRVVQSAAWEALKKVSV* |
| Ga0066710_1001834843 | 3300009012 | Grasslands Soil | MEHSPTSATGTGWEGTPWHATPRAAWEALRQISTVE |
| Ga0066710_1003172021 | 3300009012 | Grasslands Soil | ATFYTTGMEHSPTSATGTGWERTPWHATQQAAWEAVRKVEREA |
| Ga0066710_1046336052 | 3300009012 | Grasslands Soil | MEHSPTSATGTGWEPTPWHAVQRAAWEALKKAEEGNR |
| Ga0099829_101171997 | 3300009038 | Vadose Zone Soil | ATFYTTGIEHSITSATASAWERTPWHSTQRAAWEALRKAGAGVGEMSE* |
| Ga0099828_108389231 | 3300009089 | Vadose Zone Soil | MEHSITSATASAWERTPWHAVQGAARDALRQAERSR* |
| Ga0099828_111688093 | 3300009089 | Vadose Zone Soil | GMEHSPSSATGTGWERTPWHAVQGAARDALRQTKKGD* |
| Ga0075418_101604617 | 3300009100 | Populus Rhizosphere | YTTGMEHLPTSATGTAWERTLWQAVQRSAWQALKKAETG* |
| Ga0075418_103462754 | 3300009100 | Populus Rhizosphere | YVSGMEYSPAGATGTGWERTPWHATQRAAWEAVMKSEEGNR* |
| Ga0075418_112231122 | 3300009100 | Populus Rhizosphere | ATVYTTGMEHSPTSATGTGWERTPWRATQRAPWEALNRTNRQ* |
| Ga0066709_1019608561 | 3300009137 | Grasslands Soil | MEHSPTSATGTGWERTPWQTVQKAAREFLKASLDG* |
| Ga0114129_103228293 | 3300009147 | Populus Rhizosphere | RYEERGWRATFYTIGMEHSPWERTPWHATQRAAWEALKKARG* |
| Ga0114129_103714372 | 3300009147 | Populus Rhizosphere | MAATFYTSEMEHSPTSATGTGWKRTPWHVTQRAAWEALKRTDA* |
| Ga0114129_104119325 | 3300009147 | Populus Rhizosphere | MTFSVIDHSPTSATDTRGSARRGTATQRAAWKALKKAEPSG* |
| Ga0114129_112388981 | 3300009147 | Populus Rhizosphere | MEHSPTSATGTGWERTPWHATQRAAWKALMRVENYVR* |
| Ga0114129_122640803 | 3300009147 | Populus Rhizosphere | SPTSATGTGWERTPWQATQRAAWEALRQAEYECHIA* |
| Ga0114129_131467611 | 3300009147 | Populus Rhizosphere | TFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKADDTQ* |
| Ga0075423_113366753 | 3300009162 | Populus Rhizosphere | YTTGMEHSPTSATGTAFERTPWQATQRAAWEALKKALKP* |
| Ga0105249_105557173 | 3300009553 | Switchgrass Rhizosphere | MRRDMEHSLTSAIGTGWELTPWHATQRATWEAVKRN* |
| Ga0105072_11359581 | 3300009818 | Groundwater Sand | EHSITSATASAWERTPWHATQRAAWEVLKKIWEVQ* |
| Ga0126384_101396631 | 3300010046 | Tropical Forest Soil | TFYTTGMEHSPVSAIGTGWEPTPWRAVQRAAWEALKSVDSIGG* |
| Ga0126384_120870561 | 3300010046 | Tropical Forest Soil | TFYTTGMEHSPTSATGTAWERTPWHATQRAAWEAAKKTQDDIR* |
| Ga0126382_101203701 | 3300010047 | Tropical Forest Soil | EHSPTSATGTAWERTAWRATLRAAWEALKRAEWVG* |
| Ga0126382_118639892 | 3300010047 | Tropical Forest Soil | YTTGMEHSPTSATGTGWERTPWQATRHAAWEALENADGRS* |
| Ga0134109_101114941 | 3300010320 | Grasslands Soil | TFHKSEMGHSRTSATGTAWERTPWRAVHRAAWEALKRT* |
| Ga0134071_100024921 | 3300010336 | Grasslands Soil | MSGMEHSPTSATGTAWEPMPWRAVQGAAWGTLRAEE |
| Ga0134071_105479391 | 3300010336 | Grasslands Soil | MFYTTAIEHSPTSATGAGWERTPWRATQRAAWEALKKTEDEIR* |
| Ga0126376_100195952 | 3300010359 | Tropical Forest Soil | MTGERATFYTTGMEHSPTSATGTGLRRTPWHAVQRAAWEALDRTGRP* |
| Ga0126376_103193081 | 3300010359 | Tropical Forest Soil | MFYTTGMEHSRTSATGTARERTPWDATQPAAWEALERADRQ* |
| Ga0126376_103525451 | 3300010359 | Tropical Forest Soil | TFYTTGMEHSPISATATAWEQTPWHATQRAAWEALDRAHRQ* |
| Ga0126376_109393393 | 3300010359 | Tropical Forest Soil | MKVGVEHSPTSATGTGWEPTPWHATQRAAWEALKKAEEGDR* |
| Ga0126372_115692801 | 3300010360 | Tropical Forest Soil | MAGYTTGIEHSPTTVTGTTWEPTPWHATQRATWEVLKRAEYGG* |
| Ga0126377_100499585 | 3300010362 | Tropical Forest Soil | MEHSPTSATGTAWERPTWHAAQRAAWGALATAEASG* |
| Ga0126377_103514644 | 3300010362 | Tropical Forest Soil | SDHPATFNVTGRAHSGIGGTAWERTPWRATQRAAWEALD* |
| Ga0126377_105143432 | 3300010362 | Tropical Forest Soil | MFYTTGMEHSRTSATGTAWERTPWDATQRAAWEALERADRQ* |
| Ga0126377_119705941 | 3300010362 | Tropical Forest Soil | FYTTGMEHSPTSATGTAWERAPWRATQRAAWEGLKNSETNC* |
| Ga0126377_132000951 | 3300010362 | Tropical Forest Soil | WRATLYATGMEHSPTSATGTAWERTPWHAVQWAAWGALKKSEA* |
| Ga0126377_133296783 | 3300010362 | Tropical Forest Soil | YTTGMEPSPSSVTGTGYEPTPWHATSRAAWEVLKKADSIGR* |
| Ga0126381_1010628293 | 3300010376 | Tropical Forest Soil | FYTTGMEHSPTSATGTASERTPWRATQRAAWGALKNADQREG* |
| Ga0126383_110962023 | 3300010398 | Tropical Forest Soil | MEHSPTSATGTAWERTPWRATQRAAWEALKQTVSET* |
| Ga0126383_116501211 | 3300010398 | Tropical Forest Soil | FYTTGMEHSPTSVTGTAWERTPWHATQRAAWEALKKGDA* |
| Ga0134122_116574021 | 3300010400 | Terrestrial Soil | MEHSPTSATGTGWERTPWHATQRAVWEALKKTPESESG* |
| Ga0137392_111025002 | 3300011269 | Vadose Zone Soil | MEHSITRATASAWERTPWHAVQGAAREALRKAGDD* |
| Ga0137388_116934001 | 3300012189 | Vadose Zone Soil | MEHSITSATASAWERTPWHAVQGAARDALRQATAGG* |
| Ga0137382_113497181 | 3300012200 | Vadose Zone Soil | TTGMEHSPTSATGTGGERAPWHATQRAAREALGRGD* |
| Ga0137363_104708141 | 3300012202 | Vadose Zone Soil | MEHSPTSATGTGWERTPWHATQRAAWAVLKKADT* |
| Ga0137363_115222941 | 3300012202 | Vadose Zone Soil | GMEHSPTSATGTGWERTPWHPTQRAAWEALKNAEAIYR* |
| Ga0137374_103356744 | 3300012204 | Vadose Zone Soil | MEHSITSATASAWKRTPWHATQRAAWEALVKAEE* |
| Ga0137374_110007421 | 3300012204 | Vadose Zone Soil | MEHSITSATASAWEHTPWHAVQGAAWEALKRASERE* |
| Ga0137362_100160177 | 3300012205 | Vadose Zone Soil | MEHSPMSATGTGWERTPWHAKQRAAWEALKKGEESKG* |
| Ga0137362_101051464 | 3300012205 | Vadose Zone Soil | MEHSPPGATGTGWERTPWHATQRAAWDALMKKDAR* |
| Ga0137362_103032571 | 3300012205 | Vadose Zone Soil | TFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKQAGANNA* |
| Ga0137380_103546051 | 3300012206 | Vadose Zone Soil | MEHSITSATASAWERTPWHAIQGAARDTLRQVSRDG* |
| Ga0137376_116640821 | 3300012208 | Vadose Zone Soil | GLARDFYTTGMEHSPTSATGTGWERSAWHATQRAAWEALKKASG* |
| Ga0137378_109295002 | 3300012210 | Vadose Zone Soil | FYTTGMEHSITSATASAWERTPWHAVQRAAWEALSRVND* |
| Ga0137377_114881301 | 3300012211 | Vadose Zone Soil | TTGMEHSPMGATGTSWERTPWHATQRAAWDALTKAEIGAEHS* |
| Ga0137387_105621722 | 3300012349 | Vadose Zone Soil | YTTGMEHSITSATASALERTLWRAVQGAARDALRAAGY* |
| Ga0137386_107920711 | 3300012351 | Vadose Zone Soil | HSITSATASAWERAPWHAVQGAAREALRLANRDG* |
| Ga0137369_101029373 | 3300012355 | Vadose Zone Soil | MEHSITSATASAWERTPWHAVQGAARDALRQAEELEH* |
| Ga0137369_104337091 | 3300012355 | Vadose Zone Soil | TFYTTGMEHSITSATASAWERTPWHAFQGAARDVLRKVEAR* |
| Ga0137369_108523933 | 3300012355 | Vadose Zone Soil | GMEHSITSATASAWERTPWHAVQGAARDALRQAEAGDR* |
| Ga0137385_115464172 | 3300012359 | Vadose Zone Soil | EVLYAVRTGMEHSPTRATGTGSERTPWHATQRAAWEALKKNEEDDR* |
| Ga0137390_102074951 | 3300012363 | Vadose Zone Soil | TGMEHSATSATGTGWERTPWHATQRAAREALKKIDA* |
| Ga0137358_106709531 | 3300012582 | Vadose Zone Soil | TFYTTGMEHSPTTATGTGWERTPWHAVQRAAWEVLRRSDNYPHLG* |
| Ga0137358_108537691 | 3300012582 | Vadose Zone Soil | MEHLPTSATGTAWERTPWHATQRAAWEALKKADVA* |
| Ga0137397_111384651 | 3300012685 | Vadose Zone Soil | TFYTTGMEHSPTSATGTAWERTPWHATQRAALEALTKGTEPEGETR* |
| Ga0137404_113242711 | 3300012929 | Vadose Zone Soil | TGMEHSPTSATGTGWERTPWHATQRAAGAALKKAESSP* |
| Ga0137404_118795852 | 3300012929 | Vadose Zone Soil | EHSPTSATGTGWERTPWHATQGAAWEALRRANSDG* |
| Ga0126375_112339851 | 3300012948 | Tropical Forest Soil | TTGMEHSPTSATGIARHRTPWHATQRAAGEALKHAAEGSRAG* |
| Ga0126375_116900061 | 3300012948 | Tropical Forest Soil | SGCMAMGIEHSPRSATGTGWEPTPWHATQRAAWEALKRPETS* |
| Ga0126369_108778571 | 3300012971 | Tropical Forest Soil | KVGVEHSPTSATGTGWEPTRWHATQRAAWEALALK* |
| Ga0134077_100852452 | 3300012972 | Grasslands Soil | FYTPGMEHSPTSATGTGWERTPWHATQRAAWETLKKAETNYL* |
| Ga0134076_100572651 | 3300012976 | Grasslands Soil | GMEHSPTSATGTAWKPLPWRAVQRAAWEALRQISTVE* |
| Ga0163162_116182893 | 3300013306 | Switchgrass Rhizosphere | MSLTTGMEYSPTSATGTGWERTPWHATQRAPWEALRKVDVA* |
| Ga0157380_128175092 | 3300014326 | Switchgrass Rhizosphere | VSFYTTGLEHSPTSATGTAWERTPWRATQRAAWEA |
| Ga0137405_13664881 | 3300015053 | Vadose Zone Soil | SLCSSYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKADAGG* |
| Ga0137420_15004409 | 3300015054 | Vadose Zone Soil | MEHSPTGATGTGWERTPWHGTQRAAWEALKKAETS* |
| Ga0137409_102076823 | 3300015245 | Vadose Zone Soil | MRATFYTTRMEHSIMSATASAWERTPWHATQRAAWEALKKAEAP* |
| Ga0137403_108746083 | 3300015264 | Vadose Zone Soil | ATFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKAEAP* |
| Ga0132258_109059581 | 3300015371 | Arabidopsis Rhizosphere | LSPSSATGTGWERTPWHATQSEAWEALKKAEPSG* |
| Ga0132257_1004325655 | 3300015373 | Arabidopsis Rhizosphere | MERSPTSAIGTGRERTPWHATQRAAWEALNKGEP* |
| Ga0132257_1039611872 | 3300015373 | Arabidopsis Rhizosphere | YVSGMEYSPAGATGTGWERTPWHATQRAAWGALKKTD* |
| Ga0132255_1001259721 | 3300015374 | Arabidopsis Rhizosphere | GMEHSATSATRTAWERTPCHATQRAAWEALRQAG* |
| Ga0134083_101100972 | 3300017659 | Grasslands Soil | MEHSPTSATGTGWERTPWHATQRAAWEALKKVEESKG |
| Ga0184610_12258592 | 3300017997 | Groundwater Sediment | FYTTGMEHSITSATGTGWERTPWHAVQGAAREALSRSEVGDR |
| Ga0184638_10679715 | 3300018052 | Groundwater Sediment | RATFYTTGMEHSITSATASAWERTPWHAVQGAARDALRRAE |
| Ga0184626_100248402 | 3300018053 | Groundwater Sediment | MEHSITSATASAWERTPWHATQRAAWEALRKAGEE |
| Ga0184637_101951712 | 3300018063 | Groundwater Sediment | ATFYTTGMEHSITSATASAWERTPWHAVQGAARDALRQAEGGR |
| Ga0184609_103083762 | 3300018076 | Groundwater Sediment | EHSITSATASAWERTPWHSVQSAAWDALSKAEESR |
| Ga0184609_105028821 | 3300018076 | Groundwater Sediment | TFYTTGMEHSITSATASAWERTPWHAVQVAAREALRQTEEGSDD |
| Ga0184612_103869731 | 3300018078 | Groundwater Sediment | TTGMEHSITSATASAWERTSWHAVQGAARDALRQAEELEH |
| Ga0184629_104440492 | 3300018084 | Groundwater Sediment | YTSGMNHSITSATASAWERTPWHAVQGAARDALNKTAENRG |
| Ga0066655_109957181 | 3300018431 | Grasslands Soil | RRATFYTMGMEHSPRSATGTAWERMPRQAVQGAARAALRKAAE |
| Ga0184646_11216821 | 3300019259 | Groundwater Sediment | TTGMEHSPTSATGTGWERTPWHATKRAAWEALKGG |
| Ga0126371_122152642 | 3300021560 | Tropical Forest Soil | AGLEHSPTSATGTAWCRTPWRETQRAAWGALKKAEA |
| Ga0207684_100443586 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MEHSPTSATGTGWERTPWHATQRAAWEALKKGEESKG |
| Ga0207684_110087122 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GMEHSPTSATGAGWERTRWHATQRAAAWEALERAGETD |
| Ga0207646_100524896 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEHSPTSATGTGWERTPWHATQRAAWEALKKGEES |
| Ga0207646_114769761 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEHSPTSATGTGWERTPWHATQRAAWEALKKMEDA |
| Ga0207681_114597801 | 3300025923 | Switchgrass Rhizosphere | ATFYTTGMEHSPTSATGTAWEPTPWQAVQGAARDALKRALIGPL |
| Ga0207704_117399212 | 3300025938 | Miscanthus Rhizosphere | MGYSPTSATGTAWERTPWHATQRAAWEALRQAERIESLRALRRP |
| Ga0207648_108819732 | 3300026089 | Miscanthus Rhizosphere | MEHSPTSATGTGWERTPWQATQRAAWEALKTAEESEPTG |
| Ga0209235_10888182 | 3300026296 | Grasslands Soil | MEHSPMSATGTGWERTPWHATQRAAWEALKKGEESKG |
| Ga0209237_10054681 | 3300026297 | Grasslands Soil | IEHSITSATALVWERTPWRAIQVAARDAQRKAEESNR |
| Ga0209055_100360612 | 3300026309 | Soil | MEHSPTGATGTGWERTPWHATQRAAWEALKKAESGS |
| Ga0209055_11454331 | 3300026309 | Soil | RTFYTTGMEHSATSAIGTGWERTPWHATQRAAWEALGRVND |
| Ga0209761_10354601 | 3300026313 | Grasslands Soil | GRRATFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALRKVKAAR |
| Ga0209470_12170721 | 3300026324 | Soil | TGMEHSITSATASAWERTPWHAVQGAARDALKRAE |
| Ga0209267_10636914 | 3300026331 | Soil | RATFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKAATSG |
| Ga0209803_10147601 | 3300026332 | Soil | TTGMEHSPTGATGTGWERTPWHATQRAAWEALKKAESGS |
| Ga0209803_12432212 | 3300026332 | Soil | TFYTTGMEHSPTSATGTGWERTPWHATQRAAWAVLKKADT |
| Ga0209057_12246521 | 3300026342 | Soil | ATFYTTGMEHSPTSATGAGWERTRWHATQRAAAWEALERAGETD |
| Ga0209690_10984563 | 3300026524 | Soil | MEHSPTSTTGTAWECTPWHATQRAAREALKKAETS |
| Ga0209806_10303416 | 3300026529 | Soil | VRAIFYTTWMEHSPTSATGTGWERTPWHATQRAAWEALKKGEESKG |
| Ga0209056_103904231 | 3300026538 | Soil | ATFYTTGMEHSLTSATGTGWERTPWHATQRAAWEALKRSDRSG |
| Ga0209156_100958743 | 3300026547 | Soil | EHSLTRATGTAWERTPWHAVQGAAREALKQAGRDG |
| Ga0209577_105814191 | 3300026552 | Soil | GTEHSPTSATGSAWEPTPWRAVQGAARDALKRANVDG |
| Ga0209854_10141013 | 3300027384 | Groundwater Sand | GMEHSPAGATGSAWERTPWHATQRAAWEALRKVSAT |
| Ga0209854_11018262 | 3300027384 | Groundwater Sand | VRATFYVTGMEHSPTSATGTGWERTAWHATQRAAWTAL |
| Ga0209466_10223353 | 3300027646 | Tropical Forest Soil | MEHSPTSATGTAWERTAWRATLRAAWEALKRAEWVG |
| Ga0209588_11269431 | 3300027671 | Vadose Zone Soil | TGMEHSITSATASAWERTPWHAVQGAARDALRQATAGG |
| Ga0209689_10171198 | 3300027748 | Soil | TFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALKKAEPSG |
| Ga0209701_101939552 | 3300027862 | Vadose Zone Soil | GMEHSITSATGTGWERTPWHAVQGAARDALRQAAGRDR |
| Ga0209465_100720741 | 3300027874 | Tropical Forest Soil | MFYTTGMEHSPMSATGTEWERTSWRATQRAAWEALKRMLEKC |
| Ga0209465_103848672 | 3300027874 | Tropical Forest Soil | MFYTTGMEHSRTSATGTARERTPWDATQRAAWEALERADRQ |
| Ga0209488_101781742 | 3300027903 | Vadose Zone Soil | MEHSPTGATGTGWERTPWHATQRAAWEALRKAEKDSR |
| Ga0207428_109349372 | 3300027907 | Populus Rhizosphere | AYTIGIEHSPTSATGIGWERTPWQATRLAAWEVLIRLEGR |
| Ga0207428_112068862 | 3300027907 | Populus Rhizosphere | FYTTAMEHSATSAIGTGWEPTPWHATQRAAWEALKKLQP |
| Ga0209857_10592553 | 3300027957 | Groundwater Sand | MTQMEHAPTRATGFAWERTLWHATQRAAWEALKKAEPSG |
| Ga0307296_105349133 | 3300028819 | Soil | TFYTTGMEHSITSATASAWERTPSHAVPGAARDALRQRQ |
| Ga0307497_103299162 | 3300031226 | Soil | MTFYATDMEHSPTSATGTGWARTPWHATQRAAWEALKKIES |
| Ga0318528_102027603 | 3300031561 | Soil | YTTGMEHSLTSATGTAWERTPWHATQRAAREALKRADASG |
| Ga0318496_102654741 | 3300031713 | Soil | YTTGMEHSPASATGTGWELTPWHATQRAAWAILGAR |
| Ga0307469_104622953 | 3300031720 | Hardwood Forest Soil | MEHSPTSATGTGWERTPWHATQRAAWETLKKMSATNY |
| Ga0307469_106404442 | 3300031720 | Hardwood Forest Soil | MTGKEHSHTSATGTPWERTPWHAVQQAAWEALDRASPPIV |
| Ga0307469_113878842 | 3300031720 | Hardwood Forest Soil | FFANTTGMEHSPTSATGTGWERTPWHATQRVAWGALKKAEEGS |
| Ga0318493_108726773 | 3300031723 | Soil | MFAFRNPGRATLYTMGMEHSPTSATGTAWERTPWRAAQRAALEALKRADA |
| Ga0307468_1002439233 | 3300031740 | Hardwood Forest Soil | VSFSTTGLEHSLTSATGTVWERTLWRAMQRGVWEALKKASTSA |
| Ga0307468_1002883863 | 3300031740 | Hardwood Forest Soil | MAATFYTSEMEHSPTSATGTGWKRTPWHVTQRAAWEALKRTDA |
| Ga0307468_1009643622 | 3300031740 | Hardwood Forest Soil | TGMEHSPTSATGTGWERTPWRATQRAAWEVLKKGSTA |
| Ga0307468_1017082681 | 3300031740 | Hardwood Forest Soil | IEHSPTRAAGTAWECTPWHMTQRAAWEAVKKNEEDDR |
| Ga0307468_1019686242 | 3300031740 | Hardwood Forest Soil | GMEHSPTSATGTAWERTPWHATQRAVGEALKKASG |
| Ga0318521_105580911 | 3300031770 | Soil | MSPTLVREPFHTTGMEHSPTSATGTAWKRTPWRATQRAAWKVLEKTE |
| Ga0318529_101470373 | 3300031792 | Soil | FYTTGMEHSPTSATSTAWERTPWHATQRAAWEAMTKDNDRISWAG |
| Ga0318497_105037013 | 3300031805 | Soil | TFYTTGMEHSPSPTGATGTGWERTPWRATQRVAWEVLTKGNQDG |
| Ga0318497_108866041 | 3300031805 | Soil | TTGMEDSPTSATGTAWERMPWHATQRAAWEALRGGKLTTGYDL |
| Ga0307473_101225621 | 3300031820 | Hardwood Forest Soil | TFYTTGMEHSPTSATGTGWERTPWHATQRAAWEALDRAHRP |
| Ga0307473_107791391 | 3300031820 | Hardwood Forest Soil | LDATFYTMGIRTLPPSVTGTGWEPTPWHATQRAVWEASRKSI |
| Ga0307473_109427551 | 3300031820 | Hardwood Forest Soil | VTFYTTGMEHSITSATRTGRERTPWHATQRAACEALKKAV |
| Ga0307473_110761241 | 3300031820 | Hardwood Forest Soil | FYTTGMEHSPTSATGTAWERTPWHATQRGAWEALEIG |
| Ga0318499_100234931 | 3300031832 | Soil | YTTGMEHSPTSATGTAWEGTRWRATQRAAWEALSKGEDR |
| Ga0318517_101244441 | 3300031835 | Soil | EHSPVSATGTAWEATPWRATQRAAWEALKRVLEKC |
| Ga0318511_105511272 | 3300031845 | Soil | FYTTGMEHSPASATGTGWELTPWHATQRAAWAILGAR |
| Ga0318520_100224766 | 3300031897 | Soil | TFYTTGMEHSPTSATGTAWEGTRWRATQRAAWEALSKGEDR |
| Ga0310912_107809392 | 3300031941 | Soil | ATFYTTGMEHSPASATGTGWELTPWHATQRAAWAILGAR |
| Ga0310906_100085326 | 3300032013 | Soil | YTTGMEHSPTSATGTAWERMPWQATQRAGWEALRNAEGIE |
| Ga0318545_103886842 | 3300032042 | Soil | TGMEHSPTSATGTAWEGTRWRATQRAAWEALSKGEDR |
| Ga0318506_104266132 | 3300032052 | Soil | MFYTTGMEHSPTSATGTAWDRTPWRATQRAAWGALTAMAQMEQ |
| Ga0307471_1012245961 | 3300032180 | Hardwood Forest Soil | GWRATFHTTGMEHSQTSATGTGWEGTPWHATQRAAWEALRKAK |
| Ga0307471_1015843672 | 3300032180 | Hardwood Forest Soil | TGMEHSPTSATGIGWERTPWHATQRAAWDALKKAETS |
| Ga0307472_1001674193 | 3300032205 | Hardwood Forest Soil | YTTGIEHSPTSATGTAWERTPWGATQRAAWEVLRRMEKDIQ |
| Ga0307472_1025387311 | 3300032205 | Hardwood Forest Soil | TEHSPTSATGTGWERTPWRATQRAAWEALRRAEAPLQ |
| Ga0310914_104110591 | 3300033289 | Soil | YTMGMEHSPTSATGTAWERTPWRAAQRAALEALKRADA |
| Ga0364924_022762_1118_1246 | 3300033811 | Sediment | ATFYPTGMEHSITSATASAWERTPWHAVQGAARDALRQEARQ |
| ⦗Top⦘ |