Basic Information | |
---|---|
Family ID | F018456 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 235 |
Average Sequence Length | 44 residues |
Representative Sequence | MSTLQRDELLTQSEILKKETSPPAKEADQHSEAEPDEAKHGQDL |
Number of Associated Samples | 170 |
Number of Associated Scaffolds | 235 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 50.21 % |
% of genes near scaffold ends (potentially truncated) | 42.55 % |
% of genes from short scaffolds (< 2000 bps) | 72.77 % |
Associated GOLD sequencing projects | 154 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.085 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.617 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.128 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.319 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 235 Family Scaffolds |
---|---|---|
PF13683 | rve_3 | 2.98 |
PF00665 | rve | 2.13 |
PF12704 | MacB_PCD | 1.70 |
PF00149 | Metallophos | 1.28 |
PF13276 | HTH_21 | 1.28 |
PF16576 | HlyD_D23 | 1.28 |
PF00589 | Phage_integrase | 1.28 |
PF01850 | PIN | 1.28 |
PF08447 | PAS_3 | 1.28 |
PF07730 | HisKA_3 | 0.85 |
PF01464 | SLT | 0.85 |
PF04519 | Bactofilin | 0.85 |
PF07676 | PD40 | 0.85 |
PF13620 | CarboxypepD_reg | 0.85 |
PF15937 | PrlF_antitoxin | 0.85 |
PF04203 | Sortase | 0.85 |
PF13545 | HTH_Crp_2 | 0.85 |
PF14417 | MEDS | 0.85 |
PF13450 | NAD_binding_8 | 0.43 |
PF00437 | T2SSE | 0.43 |
PF01610 | DDE_Tnp_ISL3 | 0.43 |
PF13358 | DDE_3 | 0.43 |
PF12681 | Glyoxalase_2 | 0.43 |
PF00210 | Ferritin | 0.43 |
PF01058 | Oxidored_q6 | 0.43 |
PF10150 | RNase_E_G | 0.43 |
PF13560 | HTH_31 | 0.43 |
PF09720 | Unstab_antitox | 0.43 |
PF03219 | TLC | 0.43 |
PF13463 | HTH_27 | 0.43 |
PF07885 | Ion_trans_2 | 0.43 |
PF08448 | PAS_4 | 0.43 |
PF07804 | HipA_C | 0.43 |
PF00069 | Pkinase | 0.43 |
PF02738 | MoCoBD_1 | 0.43 |
PF13502 | AsmA_2 | 0.43 |
PF13676 | TIR_2 | 0.43 |
PF07690 | MFS_1 | 0.43 |
PF10042 | DUF2278 | 0.43 |
PF13557 | Phenol_MetA_deg | 0.43 |
PF16477 | DUF5054 | 0.43 |
PF04586 | Peptidase_S78 | 0.43 |
PF07040 | DUF1326 | 0.43 |
PF07098 | DUF1360 | 0.43 |
PF00924 | MS_channel | 0.43 |
PF04972 | BON | 0.43 |
PF00989 | PAS | 0.43 |
PF13432 | TPR_16 | 0.43 |
PF14833 | NAD_binding_11 | 0.43 |
PF13578 | Methyltransf_24 | 0.43 |
PF00903 | Glyoxalase | 0.43 |
PF01546 | Peptidase_M20 | 0.43 |
PF00963 | Cohesin | 0.43 |
PF02492 | cobW | 0.43 |
PF13180 | PDZ_2 | 0.43 |
PF13305 | TetR_C_33 | 0.43 |
PF13701 | DDE_Tnp_1_4 | 0.43 |
PF02371 | Transposase_20 | 0.43 |
PF07238 | PilZ | 0.43 |
PF13657 | Couple_hipA | 0.43 |
PF02954 | HTH_8 | 0.43 |
PF12728 | HTH_17 | 0.43 |
PF01936 | NYN | 0.43 |
PF02661 | Fic | 0.43 |
PF07592 | DDE_Tnp_ISAZ013 | 0.43 |
PF01174 | SNO | 0.43 |
PF16360 | GTP-bdg_M | 0.43 |
PF13414 | TPR_11 | 0.43 |
PF02803 | Thiolase_C | 0.43 |
PF01833 | TIG | 0.43 |
PF01769 | MgtE | 0.43 |
PF01695 | IstB_IS21 | 0.43 |
COG ID | Name | Functional Category | % Frequency in 235 Family Scaffolds |
---|---|---|---|
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 2.13 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 2.13 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 2.13 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 2.13 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.70 |
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.85 |
COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.85 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.85 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.85 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.85 |
COG3202 | ATP/ADP translocase | Energy production and conversion [C] | 0.43 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.43 |
COG3550 | Serine/threonine protein kinase HipA, toxin component of the HipAB toxin-antitoxin module | Signal transduction mechanisms [T] | 0.43 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.43 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.43 |
COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 0.43 |
COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.43 |
COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.43 |
COG1824 | Permease, similar to cation transporters | Inorganic ion transport and metabolism [P] | 0.43 |
COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.43 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.43 |
COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.43 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.43 |
COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 0.43 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.09 % |
Unclassified | root | N/A | 11.91 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_17341484 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
2088090014|GPIPI_17407077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1037 | Open in IMG/M |
2189573004|GZGWRS402IX14E | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300000550|F24TB_10428725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
3300000567|JGI12270J11330_10001049 | All Organisms → cellular organisms → Bacteria | 20937 | Open in IMG/M |
3300001593|JGI12635J15846_10057475 | All Organisms → cellular organisms → Bacteria | 2932 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101002908 | Not Available | 720 | Open in IMG/M |
3300002914|JGI25617J43924_10054304 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
3300002914|JGI25617J43924_10073936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1245 | Open in IMG/M |
3300002914|JGI25617J43924_10197357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300002917|JGI25616J43925_10029678 | All Organisms → cellular organisms → Bacteria | 2420 | Open in IMG/M |
3300004091|Ga0062387_100876388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
3300005171|Ga0066677_10020219 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
3300005173|Ga0066822_1017849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300005175|Ga0066673_10442354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
3300005177|Ga0066690_10031832 | All Organisms → cellular organisms → Bacteria | 3074 | Open in IMG/M |
3300005178|Ga0066688_10487676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300005295|Ga0065707_11072682 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005347|Ga0070668_100514855 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300005353|Ga0070669_101964649 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300005434|Ga0070709_10771043 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300005439|Ga0070711_100038198 | All Organisms → cellular organisms → Bacteria | 3226 | Open in IMG/M |
3300005439|Ga0070711_100080381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2321 | Open in IMG/M |
3300005450|Ga0066682_10637645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
3300005454|Ga0066687_10227688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
3300005518|Ga0070699_100365786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1301 | Open in IMG/M |
3300005536|Ga0070697_101637168 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300005552|Ga0066701_10570103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 693 | Open in IMG/M |
3300005566|Ga0066693_10185351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
3300005575|Ga0066702_10167298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
3300005586|Ga0066691_10030075 | All Organisms → cellular organisms → Bacteria | 2797 | Open in IMG/M |
3300005587|Ga0066654_10035067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2123 | Open in IMG/M |
3300005598|Ga0066706_10447251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 1029 | Open in IMG/M |
3300005842|Ga0068858_101169895 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300005842|Ga0068858_101361664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300006031|Ga0066651_10266111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
3300006046|Ga0066652_101573594 | Not Available | 606 | Open in IMG/M |
3300006047|Ga0075024_100717204 | Not Available | 551 | Open in IMG/M |
3300006163|Ga0070715_10757221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300006163|Ga0070715_10876938 | Not Available | 551 | Open in IMG/M |
3300006175|Ga0070712_100044498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3061 | Open in IMG/M |
3300006175|Ga0070712_100073672 | All Organisms → cellular organisms → Bacteria | 2450 | Open in IMG/M |
3300006176|Ga0070765_100001671 | All Organisms → cellular organisms → Bacteria | 13642 | Open in IMG/M |
3300006237|Ga0097621_100651914 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300006642|Ga0075521_10171318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
3300006642|Ga0075521_10573991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300006794|Ga0066658_10224547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
3300006794|Ga0066658_10303895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
3300006797|Ga0066659_11186135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300006800|Ga0066660_10088284 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
3300006800|Ga0066660_10285319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1310 | Open in IMG/M |
3300006854|Ga0075425_100318920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1789 | Open in IMG/M |
3300007255|Ga0099791_10008755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4199 | Open in IMG/M |
3300007265|Ga0099794_10111366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1372 | Open in IMG/M |
3300009038|Ga0099829_10143729 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
3300009088|Ga0099830_10696010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 836 | Open in IMG/M |
3300009137|Ga0066709_101171987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300009523|Ga0116221_1087031 | Not Available | 1393 | Open in IMG/M |
3300010048|Ga0126373_10224808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1833 | Open in IMG/M |
3300010303|Ga0134082_10039706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1790 | Open in IMG/M |
3300010303|Ga0134082_10057938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1493 | Open in IMG/M |
3300010303|Ga0134082_10151489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
3300010303|Ga0134082_10190701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 837 | Open in IMG/M |
3300010320|Ga0134109_10139614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
3300010321|Ga0134067_10011318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2546 | Open in IMG/M |
3300010341|Ga0074045_10005905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10603 | Open in IMG/M |
3300010341|Ga0074045_10009951 | All Organisms → cellular organisms → Bacteria | 7927 | Open in IMG/M |
3300010341|Ga0074045_10025836 | All Organisms → cellular organisms → Bacteria | 4510 | Open in IMG/M |
3300010341|Ga0074045_10326637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
3300010343|Ga0074044_10130669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1684 | Open in IMG/M |
3300010358|Ga0126370_12429000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300010366|Ga0126379_10337679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1531 | Open in IMG/M |
3300010379|Ga0136449_100735971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni | 1645 | Open in IMG/M |
3300010398|Ga0126383_11475734 | Not Available | 770 | Open in IMG/M |
3300010398|Ga0126383_13044367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300011269|Ga0137392_11080499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300011271|Ga0137393_10137041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2032 | Open in IMG/M |
3300012096|Ga0137389_11783418 | Not Available | 511 | Open in IMG/M |
3300012198|Ga0137364_10019860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4105 | Open in IMG/M |
3300012200|Ga0137382_10022558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3642 | Open in IMG/M |
3300012200|Ga0137382_11285768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300012203|Ga0137399_10164728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1780 | Open in IMG/M |
3300012203|Ga0137399_10186969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1675 | Open in IMG/M |
3300012203|Ga0137399_11160047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300012205|Ga0137362_10102889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2407 | Open in IMG/M |
3300012209|Ga0137379_11109484 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300012211|Ga0137377_11599477 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300012224|Ga0134028_1091658 | Not Available | 560 | Open in IMG/M |
3300012356|Ga0137371_10554248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
3300012361|Ga0137360_10589277 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300012361|Ga0137360_11547841 | Not Available | 568 | Open in IMG/M |
3300012362|Ga0137361_10005285 | All Organisms → cellular organisms → Bacteria | 8670 | Open in IMG/M |
3300012362|Ga0137361_10014115 | All Organisms → cellular organisms → Bacteria | 5850 | Open in IMG/M |
3300012363|Ga0137390_10008880 | All Organisms → cellular organisms → Bacteria | 8739 | Open in IMG/M |
3300012923|Ga0137359_10105637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2489 | Open in IMG/M |
3300012923|Ga0137359_11188429 | Not Available | 651 | Open in IMG/M |
3300012927|Ga0137416_11235399 | Not Available | 673 | Open in IMG/M |
3300012929|Ga0137404_10800347 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300012930|Ga0137407_10063404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3049 | Open in IMG/M |
3300012944|Ga0137410_11013755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
3300012957|Ga0164303_10545288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
3300012957|Ga0164303_11463748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 514 | Open in IMG/M |
3300012960|Ga0164301_10692308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 766 | Open in IMG/M |
3300012971|Ga0126369_12484711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
3300012975|Ga0134110_10159596 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300012976|Ga0134076_10092419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1192 | Open in IMG/M |
3300012977|Ga0134087_10193550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
3300012989|Ga0164305_10536327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
3300013296|Ga0157374_11674640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300014157|Ga0134078_10016362 | All Organisms → cellular organisms → Bacteria | 2266 | Open in IMG/M |
3300014164|Ga0181532_10033420 | All Organisms → cellular organisms → Bacteria | 3540 | Open in IMG/M |
3300014494|Ga0182017_10000115 | All Organisms → cellular organisms → Bacteria | 59654 | Open in IMG/M |
3300015356|Ga0134073_10003710 | All Organisms → cellular organisms → Bacteria | 3143 | Open in IMG/M |
3300015356|Ga0134073_10081066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
3300015358|Ga0134089_10221415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300016270|Ga0182036_11913840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300016341|Ga0182035_11679359 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300016445|Ga0182038_11689992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300016750|Ga0181505_10125970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300017822|Ga0187802_10002778 | All Organisms → cellular organisms → Bacteria | 5027 | Open in IMG/M |
3300017933|Ga0187801_10243955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300017933|Ga0187801_10338131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300017943|Ga0187819_10003353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8593 | Open in IMG/M |
3300017955|Ga0187817_10043669 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
3300017995|Ga0187816_10128844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1091 | Open in IMG/M |
3300018431|Ga0066655_10626009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
3300018433|Ga0066667_10032173 | All Organisms → cellular organisms → Bacteria | 2964 | Open in IMG/M |
3300019788|Ga0182028_1361338 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
3300020579|Ga0210407_10022747 | Not Available | 4657 | Open in IMG/M |
3300020579|Ga0210407_10077604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2500 | Open in IMG/M |
3300020579|Ga0210407_10188656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1599 | Open in IMG/M |
3300020579|Ga0210407_10188712 | Not Available | 1599 | Open in IMG/M |
3300020580|Ga0210403_10591869 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300020580|Ga0210403_11362476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300020582|Ga0210395_11375116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300020583|Ga0210401_10187897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1923 | Open in IMG/M |
3300021168|Ga0210406_10013814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 7753 | Open in IMG/M |
3300021168|Ga0210406_10086600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2674 | Open in IMG/M |
3300021168|Ga0210406_10578065 | Not Available | 879 | Open in IMG/M |
3300021170|Ga0210400_10955081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
3300021171|Ga0210405_10047977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3384 | Open in IMG/M |
3300021171|Ga0210405_10435321 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
3300021171|Ga0210405_10530911 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 920 | Open in IMG/M |
3300021178|Ga0210408_10664701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
3300021180|Ga0210396_10516289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
3300021404|Ga0210389_10332422 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300021407|Ga0210383_10637913 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300021475|Ga0210392_10048524 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
3300021475|Ga0210392_10940464 | Not Available | 647 | Open in IMG/M |
3300021478|Ga0210402_11420604 | Not Available | 621 | Open in IMG/M |
3300021478|Ga0210402_11746677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300021479|Ga0210410_10012459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7316 | Open in IMG/M |
3300021479|Ga0210410_10042516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3954 | Open in IMG/M |
3300025474|Ga0208479_1007854 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2282 | Open in IMG/M |
3300025474|Ga0208479_1016732 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
3300025878|Ga0209584_10021752 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
3300025915|Ga0207693_10208338 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300025915|Ga0207693_10589035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 866 | Open in IMG/M |
3300025916|Ga0207663_10354744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1111 | Open in IMG/M |
3300025939|Ga0207665_11331633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300025939|Ga0207665_11357321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300026308|Ga0209265_1049829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1292 | Open in IMG/M |
3300026308|Ga0209265_1061003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
3300026315|Ga0209686_1013049 | All Organisms → cellular organisms → Bacteria | 3423 | Open in IMG/M |
3300026316|Ga0209155_1099292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1055 | Open in IMG/M |
3300026323|Ga0209472_1048067 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
3300026327|Ga0209266_1143886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 976 | Open in IMG/M |
3300026330|Ga0209473_1010341 | All Organisms → cellular organisms → Bacteria | 4637 | Open in IMG/M |
3300026331|Ga0209267_1203671 | Not Available | 753 | Open in IMG/M |
3300026515|Ga0257158_1025734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1013 | Open in IMG/M |
3300026523|Ga0209808_1033504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2456 | Open in IMG/M |
3300026542|Ga0209805_1018584 | All Organisms → cellular organisms → Bacteria | 3663 | Open in IMG/M |
3300026551|Ga0209648_10056868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3329 | Open in IMG/M |
3300026551|Ga0209648_10106592 | All Organisms → cellular organisms → Bacteria | 2287 | Open in IMG/M |
3300026551|Ga0209648_10641604 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 581 | Open in IMG/M |
3300026552|Ga0209577_10016051 | All Organisms → cellular organisms → Bacteria | 6701 | Open in IMG/M |
3300026552|Ga0209577_10106711 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
3300026557|Ga0179587_10300047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
3300027591|Ga0209733_1006488 | All Organisms → cellular organisms → Bacteria | 3014 | Open in IMG/M |
3300027604|Ga0208324_1183132 | Not Available | 560 | Open in IMG/M |
3300027701|Ga0209447_10055547 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300027862|Ga0209701_10086305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1974 | Open in IMG/M |
3300027905|Ga0209415_10055546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4985 | Open in IMG/M |
3300028047|Ga0209526_10018862 | All Organisms → cellular organisms → Bacteria | 4796 | Open in IMG/M |
3300028047|Ga0209526_10029270 | All Organisms → cellular organisms → Bacteria | 3871 | Open in IMG/M |
3300028069|Ga0255358_1009396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1327 | Open in IMG/M |
3300028381|Ga0268264_10017712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5832 | Open in IMG/M |
3300028536|Ga0137415_10443273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1104 | Open in IMG/M |
3300030973|Ga0075395_10981497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300031057|Ga0170834_105660832 | Not Available | 1309 | Open in IMG/M |
3300031057|Ga0170834_110114558 | All Organisms → cellular organisms → Bacteria | 1831 | Open in IMG/M |
3300031057|Ga0170834_110363281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
3300031057|Ga0170834_110863148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1170 | Open in IMG/M |
3300031090|Ga0265760_10074423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
3300031128|Ga0170823_10824209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1472 | Open in IMG/M |
3300031128|Ga0170823_12843670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1770 | Open in IMG/M |
3300031170|Ga0307498_10282148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300031231|Ga0170824_105624846 | Not Available | 1337 | Open in IMG/M |
3300031231|Ga0170824_123851911 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300031231|Ga0170824_128977017 | Not Available | 942 | Open in IMG/M |
3300031446|Ga0170820_10272607 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300031446|Ga0170820_11718983 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300031446|Ga0170820_15452537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300031561|Ga0318528_10220246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1017 | Open in IMG/M |
3300031564|Ga0318573_10373607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
3300031715|Ga0307476_11068187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300031720|Ga0307469_12493676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300031754|Ga0307475_10263266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1382 | Open in IMG/M |
3300031754|Ga0307475_10368581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 1154 | Open in IMG/M |
3300031754|Ga0307475_10607510 | Not Available | 875 | Open in IMG/M |
3300031793|Ga0318548_10076935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1571 | Open in IMG/M |
3300031890|Ga0306925_11367526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
3300031897|Ga0318520_10068433 | Not Available | 1919 | Open in IMG/M |
3300031910|Ga0306923_10023770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6520 | Open in IMG/M |
3300031912|Ga0306921_11242220 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300031941|Ga0310912_10182356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1600 | Open in IMG/M |
3300031954|Ga0306926_10421719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 1645 | Open in IMG/M |
3300031962|Ga0307479_10712898 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300031962|Ga0307479_10724281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
3300031962|Ga0307479_10815575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
3300032174|Ga0307470_10578991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
3300032180|Ga0307471_100003851 | All Organisms → cellular organisms → Bacteria | 9085 | Open in IMG/M |
3300032180|Ga0307471_100239276 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
3300032180|Ga0307471_100254034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1812 | Open in IMG/M |
3300032180|Ga0307471_101093384 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300032180|Ga0307471_103024603 | Not Available | 596 | Open in IMG/M |
3300032205|Ga0307472_100027031 | Not Available | 3259 | Open in IMG/M |
3300032205|Ga0307472_100205739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1501 | Open in IMG/M |
3300032205|Ga0307472_100470321 | Not Available | 1075 | Open in IMG/M |
3300032205|Ga0307472_100979173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
3300032261|Ga0306920_100892472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1300 | Open in IMG/M |
3300033977|Ga0314861_0012004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6053 | Open in IMG/M |
3300034070|Ga0334822_071640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.34% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.66% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.38% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.11% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.40% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.55% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.13% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.13% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.13% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.13% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.13% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.28% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.85% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.43% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.43% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.43% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.43% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.43% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.43% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005173 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMA | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
3300034070 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-M | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_03036290 | 2088090014 | Soil | MSTFQRDELLTQSKILEKETSPPAKEAGKYSKAEPDEAKHGQDL |
GPIPI_00592900 | 2088090014 | Soil | MSTLQRDDLLTQSKILEKETSPLAKEANQHSKAEPYKTKHGQDL |
FG2_08504640 | 2189573004 | Grass Soil | MSTLQHDELLTQSEILEKETLPPAKEADQHAEAEPDEAHHGQDL |
F24TB_104287251 | 3300000550 | Soil | ELLTQSKILEKETSPPAKEADKHSKAEPDKAKHGQDL* |
JGI12270J11330_1000104917 | 3300000567 | Peatlands Soil | MLTLQHDELLTQSEILEKKTLPPAKEAHQRSEAEPDEAKHGQDL* |
JGI12635J15846_100574752 | 3300001593 | Forest Soil | MSALQRDELLTQSEILEKETSPPAQEAYQHSGADHDEAKHGQDL* |
JGIcombinedJ26739_1010029082 | 3300002245 | Forest Soil | QRDELLTQSEILEKETLPSAKEADQHAEAEPETGRFSVE* |
JGI25617J43924_100543043 | 3300002914 | Grasslands Soil | QRDELLTQSKILEKETSPPAKEAAQHSKAEPDEAKHGHDL* |
JGI25617J43924_100739361 | 3300002914 | Grasslands Soil | MSTLQHDELLTQSEILEKETLPPEKEADQHAEAEPDEAHHSQDL* |
JGI25617J43924_101973572 | 3300002914 | Grasslands Soil | MSTLQHDELLTQSEILEKETLPPEKEADQRAEAEPDEAHYGQDL* |
JGI25616J43925_100296781 | 3300002917 | Grasslands Soil | MSTLQRDELLTQSKILEKETPLPAKEANQHSKEEPYETKHDEDL* |
Ga0062387_1008763881 | 3300004091 | Bog Forest Soil | MSTLQRDELLTQSKILEKEILPPTKEVYQHSEEEPDKAKHDQDL* |
Ga0066677_100202191 | 3300005171 | Soil | TLERDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGPDL* |
Ga0066822_10178492 | 3300005173 | Soil | MSTLQHDELLTQSEILEKETLPPAKEAYHHSKAERDEAKHGQDL* |
Ga0066673_104423542 | 3300005175 | Soil | MSTLERDELLTQSEILKKESSPLTKEADQHSQAERDEAKHGLDL* |
Ga0066690_100318324 | 3300005177 | Soil | TLQRDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGLDL* |
Ga0066688_104876762 | 3300005178 | Soil | MSTLQRDKLLTQSEILKKETWPPTREADQHSEAEREEAKHGEGL* |
Ga0065707_110726822 | 3300005295 | Switchgrass Rhizosphere | MSTPQNDELLTQSKILEKETSPLAKEANQHFKAEPYKTKHGQDL* |
Ga0070668_1005148552 | 3300005347 | Switchgrass Rhizosphere | MSTLQRDQLLTQSEILKKETSPLTKEADQHSEAEPDEAKHGQDL* |
Ga0070669_1019646492 | 3300005353 | Switchgrass Rhizosphere | QRDQLLTQSEILKKETSPLTKEADQHSEAEPDEAKHGQDL* |
Ga0070709_107710432 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTLQRDELLTQSKILEKETSPLAKEADKHSKAEPDEAKHGQDL* |
Ga0070711_1000381983 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTFQRNELLTQSEILEKETLPSAKEAYQHSEEDPDKAKHDQNL* |
Ga0070711_1000803813 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RARMSTLQHDELLTQSEILDKETLPPVKKADQYAEAEPDESHHGQDL* |
Ga0066682_106376452 | 3300005450 | Soil | ARMSTLQRDELLTQSKILEKETSPLAKEANQHSEAEPYKTKHSQDL* |
Ga0066687_102276881 | 3300005454 | Soil | IEEAETWPGMSTLERDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGPDL* |
Ga0070699_1003657863 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTLQRDELLTQSEILEKETSPPAKEAYHDSKAEPDEAKHGQDL* |
Ga0070697_1016371681 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTLQRDELLTQSKILEKETSPLAKEANQHSKAEPYKTKHSQDL* |
Ga0066701_105701033 | 3300005552 | Soil | LLTQSEILKKETWPPTKEADQHSEAEREEAKHGQGL* |
Ga0066693_101853513 | 3300005566 | Soil | TLQRDELLTQSEILKKEASLLAKEADQHPEAEPDEAKHGQDL* |
Ga0066702_101672984 | 3300005575 | Soil | QRDELLTQSEILKKEASPLAKEADQHPEAETDEAKHGQD* |
Ga0066691_100300751 | 3300005586 | Soil | RMSTLQRDELLTQSEILKKETSPPTKEADQHSEAEPDEAKHSQDL* |
Ga0066654_100350672 | 3300005587 | Soil | TSARMSTLQRDKLLTQSEILKKETWPPTREADQHSEAEREEAKHGQGL* |
Ga0066706_104472511 | 3300005598 | Soil | IEEAKTRARMSTLQRDKLLTQSEIRKKETWPPTKEADQHSEAEREEAKHGQGL* |
Ga0068858_1011698952 | 3300005842 | Switchgrass Rhizosphere | MSTLQHDELLTQSEILEKETLPPEKEADQHAEAEPDEAHHGQDL* |
Ga0068858_1013616641 | 3300005842 | Switchgrass Rhizosphere | TQSEILEKETLPSAKEAYQHSEEDPDKAKHDQNL* |
Ga0066651_102661112 | 3300006031 | Soil | MSTLQRDELLTQSKILEKETSPLAKEANQHSEAEPYKTKHSQDL* |
Ga0066652_1015735942 | 3300006046 | Soil | ARMSTLQRDELLTQSEILKKETSPLTKEADQHSQAERDEAKHGLDL* |
Ga0075024_1007172042 | 3300006047 | Watersheds | TLQRDELLTQSKILEKETSPPAKEANQHSKAEPYETKHGQDL* |
Ga0070715_107572212 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTLQRDELLTQSEILEKETLPPEKEADQHAEAEPDEAHPGQDL* |
Ga0070715_108769383 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | DELLTQSEILEKETLPPEKEADQHAEAEPDEAHHGQDL* |
Ga0070712_1000444982 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTLQHDELLTQSEILDKETLPPVKKADQYAEPEPDESHHGQDL* |
Ga0070712_1000736725 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTLQHDELLTQSEILEKETLPPEKEADQHAGAEPDEAHHGQDL* |
Ga0070712_1013085483 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MVQASEKPETRARMSALQHDELLTQSEILEKETLPPAKEADQ |
Ga0070765_10000167113 | 3300006176 | Soil | MSTLQGDELLTQSKILKKEPSPPAKEANQHSEEKPYETKHDEDL* |
Ga0097621_1006519143 | 3300006237 | Miscanthus Rhizosphere | ELLTQSEILEKETLPPAKEADQHAEAEPDEANHG* |
Ga0075521_101713182 | 3300006642 | Arctic Peat Soil | MSTLQRDELLTQSEILEKESSPPAKKAAQHYEEEPDEAKHGQEL* |
Ga0075521_105739911 | 3300006642 | Arctic Peat Soil | ARMSTLQRDELLTQSEILEKESSPPAKKAAQHYEAEPDEAKHGQDL* |
Ga0066658_102245471 | 3300006794 | Soil | PGMSTLERDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGPDL* |
Ga0066658_103038951 | 3300006794 | Soil | DELLTQSEILKKESSPLTKEADQHSQAERDEAKHGLDL* |
Ga0066659_111861351 | 3300006797 | Soil | LLTQSEILKKEASPLAKEADQHPEAEPDEAKHGQDL* |
Ga0066660_100882842 | 3300006800 | Soil | MSTLQRDELLTQNKILEKEASPLAKEANQYPEAEPYETKHGVDL* |
Ga0066660_102853194 | 3300006800 | Soil | EAETRARMPTLQRDELLTQSEILKKEASPLAKEADQHPEAETDEAKHGQD* |
Ga0075425_1003189203 | 3300006854 | Populus Rhizosphere | MSTLQREALLTQSEILEKETSPPAKEAYHHSKTERDEARHGQDL* |
Ga0099791_100087551 | 3300007255 | Vadose Zone Soil | MSTLQRDELLTQSEILKKETSPLTKEAHQHSEAEPDEAKHGQGL* |
Ga0099794_101113661 | 3300007265 | Vadose Zone Soil | MLTLQHDELLTQSEILEKETSPPAKEADQHSEAEPDESKHGQDL* |
Ga0099829_101437293 | 3300009038 | Vadose Zone Soil | MSTLQRDELLTQSKIFEKETSPPAKDANQHSEAEPYKTKHSQDL* |
Ga0099830_106960102 | 3300009088 | Vadose Zone Soil | EEAEARARISTLQRDELLTQSKIFEKETSPRAKEADQHSEAESYETKHGQDL* |
Ga0066709_1011719873 | 3300009137 | Grasslands Soil | MSTLQRDELLTQSEILKKESSPLTKEADQHSQAERDEAKHGLDL* |
Ga0116221_10870311 | 3300009523 | Peatlands Soil | MLTLQHDELLTQSEILEKKTLPPAKEAHQRSEAEPD* |
Ga0126373_102248082 | 3300010048 | Tropical Forest Soil | MSTLQHDELLTQSEILEKETSPPTKEADQHSETEPDEAKHGPDL* |
Ga0134082_100397065 | 3300010303 | Grasslands Soil | IEEAETWPGMSTLERDELLTQSEILKKESSPLTKEADQHSQAERDEAKHGLDL* |
Ga0134082_100579383 | 3300010303 | Grasslands Soil | LERDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGPDL* |
Ga0134082_101514893 | 3300010303 | Grasslands Soil | TQSEILKKESSPLTKEADQHSQAERDEAKHGLDL* |
Ga0134082_101907011 | 3300010303 | Grasslands Soil | MSTLQRDKLLTQSEILKKETWPPTKEADQHSEAEREEAKHGQGL* |
Ga0134109_101396142 | 3300010320 | Grasslands Soil | MSTLQRDELLTQSEILKKETSPLTKEANQHSEAEPDEAKHGQGL* |
Ga0134067_100113185 | 3300010321 | Grasslands Soil | MLTLQRDELLTQSEILKKESSPLTKEADQHSQAERDEAKHGLDL* |
Ga0074045_100059059 | 3300010341 | Bog Forest Soil | MSTLQHDELLTQSEILEKETLPPAKEADQHAEAERDEAHHGQDL* |
Ga0074045_100099511 | 3300010341 | Bog Forest Soil | MSTLQRDELLTQSEILEKETLPVKEADQRAEAEPDEAHHGQDL* |
Ga0074045_100258367 | 3300010341 | Bog Forest Soil | MLSLQHGELLTQSEILEKETLPPAKEADQPAEAEPDEAHHGQDL* |
Ga0074045_103266372 | 3300010341 | Bog Forest Soil | MSTLQRDELLTQSEILEKETLPPVKEADQHAEAEPDEAHHDQDL* |
Ga0074044_101306691 | 3300010343 | Bog Forest Soil | MSTLQRDELLTQSEILKKETSPLTKEADQHSEAERDEAKHGLDL* |
Ga0126370_124290001 | 3300010358 | Tropical Forest Soil | MSTLEHDELLTQSEILEKETLPPAKEAAQHAEAEPDEANHDQDL* |
Ga0126379_103376792 | 3300010366 | Tropical Forest Soil | MSTLQHDELLTQSEILEKETLSPAKKADQYAEAESDEGHHDQDL* |
Ga0136449_1007359711 | 3300010379 | Peatlands Soil | MSMLQHDELLTQSEILEKETLPPAKEADQHAEAEPDEAHHGQDL* |
Ga0126383_114757341 | 3300010398 | Tropical Forest Soil | EKPETRARMSTLQHDELLTQSEILEKETLPPAKKADQHAEAEPDEAHHGQDL* |
Ga0126383_130443671 | 3300010398 | Tropical Forest Soil | MSTLQHDELLTQSEILEKETLPPAKEADQHAEAEPDEANHGQDL* |
Ga0137392_110804991 | 3300011269 | Vadose Zone Soil | MSTLQRDELLTQSKILEKETSPPAKEAYHHSKAEPDEAEYGQDL* |
Ga0137393_101370411 | 3300011271 | Vadose Zone Soil | RDELLTQSKILEKETSPLAKEANQHSEAEPYKTKHSQDL* |
Ga0137389_117834182 | 3300012096 | Vadose Zone Soil | QRDELLTQSKILEKETSPLAKEANQHSEAEPYKTKHSQDL* |
Ga0137364_100198603 | 3300012198 | Vadose Zone Soil | VAGELLLSMLQSDDLLTQSEILEKETSPPAKDAAQHSETMPEEAKHGQDL* |
Ga0137382_100225582 | 3300012200 | Vadose Zone Soil | MLQSDDLLTQSEILEKETSPPAKDAAQHSETMPEEAKHGQDL* |
Ga0137382_112857682 | 3300012200 | Vadose Zone Soil | MSTLQRDELLTQSEILKNETSPLTKEACQHSEAEPNEAKHGQDL* |
Ga0137363_115850581 | 3300012202 | Vadose Zone Soil | EELIEEAEARARISTFQRDELLTQSKIFEKQTLPPAKEADQHSEA* |
Ga0137399_101647282 | 3300012203 | Vadose Zone Soil | MSTLQRKELFTQSEILQKETLPPAKEAYQHSQAELYEAKHGQDL* |
Ga0137399_101869693 | 3300012203 | Vadose Zone Soil | MSTLQRHELLTQSEILKKETSPLTKEADQHSEAERDEAKHGLDL* |
Ga0137399_111600472 | 3300012203 | Vadose Zone Soil | MSTLQSDELLTQSKILEKETSPLAKEANQHSEAEPY |
Ga0137362_101028893 | 3300012205 | Vadose Zone Soil | MSTLQRDELLTQNKTIEKETSLPAKEANQHSKEEPYETKHDEDL* |
Ga0137379_111094842 | 3300012209 | Vadose Zone Soil | RMSTLQHDELLTQSKILEKETSPPAKEANQHAEEEPYETKHDEDL* |
Ga0137377_115994772 | 3300012211 | Vadose Zone Soil | PRMSTLQRDELLTQSEILKKESSPLTKDADQHSQAERDEAKHGLDL* |
Ga0134028_10916583 | 3300012224 | Grasslands Soil | ARMSTLQRDELLTQSEILKKETSPLTKEANQHSEAEPDEAKHGQGL* |
Ga0137371_105542481 | 3300012356 | Vadose Zone Soil | MSTLQRDKLLTQSEILKKETWPPTKEADQHSEAEPDEAKHGQGL* |
Ga0137360_105892773 | 3300012361 | Vadose Zone Soil | MSTLEHDELLTQSEILEKETLPPEKQADQHAEAEPDEAHHSHDL* |
Ga0137360_115478413 | 3300012361 | Vadose Zone Soil | STLQRDELLTQSKILEKETSPLAKEANQHSEAEPYKTKHSQDL* |
Ga0137361_100052851 | 3300012362 | Vadose Zone Soil | MSTLQRDELLTQSKILKKETSPLTKEANQHSEAEPDEAKHGQGL* |
Ga0137361_100141153 | 3300012362 | Vadose Zone Soil | MSTLQSEELLKQSDILEKETLPPAEEAVQRSEAEPEEVKHGQDL* |
Ga0137390_1000888011 | 3300012363 | Vadose Zone Soil | MSTLQRDELLTQSEILEKETSPPAKKADQHSEAEPDESKHGQDL* |
Ga0137359_101056371 | 3300012923 | Vadose Zone Soil | MSTLQRGELLTQSKILEKETSPLAKEANQHSEAEPYKTKHSQDL* |
Ga0137359_111884293 | 3300012923 | Vadose Zone Soil | ELLTQNKTIEKETSLPAKEANQHSKEEPYETKHDEDL* |
Ga0137416_112353991 | 3300012927 | Vadose Zone Soil | KTRARMSTLQRDELLTQSKILEKETSPLAKEANQHSEAEPYKTKHSQDL* |
Ga0137404_108003472 | 3300012929 | Vadose Zone Soil | MSTLQREELLAQSEILEKETSSPAKKADQHAEAEPDEGHHGQNL* |
Ga0137407_100634043 | 3300012930 | Vadose Zone Soil | MSTLQRDELLTQSKILEKEASPLAKEANQHSEAEPYKT* |
Ga0137410_110137552 | 3300012944 | Vadose Zone Soil | MSTLQSDELLTQSKVLEKETSPLAKEANQHSEAEPYKTKHSQDL* |
Ga0164303_105452881 | 3300012957 | Soil | MSTLQRDDLLTQSKILEKETSPLAKEANQHSKAEPYKTKHGQDL* |
Ga0164303_114637482 | 3300012957 | Soil | MSTLQRDELLTQSKILEKETSPLAKEADKQSKEPDEAKHGQDL* |
Ga0164301_106923082 | 3300012960 | Soil | HPIDARASMSTLQRDELLTQSKIFEKETSPPAKEAGKHSKTEPDEAKHGQDL* |
Ga0126369_124847112 | 3300012971 | Tropical Forest Soil | MSTLQHDELLTQSEILEKETLPPAKEADQHAEAEPDGANHGQDL* |
Ga0134110_101595961 | 3300012975 | Grasslands Soil | MSTLERDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGLDL* |
Ga0134076_100924192 | 3300012976 | Grasslands Soil | MSTLQRDELLTQSEILKKESSPLTKEADQHSQVERDEAKHGLDL* |
Ga0134087_101935502 | 3300012977 | Grasslands Soil | MSTLQRDKLLTQSEILKKETWPPTKEADQHSEAEREEAKHGEGL* |
Ga0164305_105363271 | 3300012989 | Soil | MSTLQHDELLTQSEILKKETLPPEKEADQHAEAEPDEAHHGQDL* |
Ga0157374_116746402 | 3300013296 | Miscanthus Rhizosphere | LLTQSEILEKETLPPEKEADQQSEAEPDEAHHGQDL* |
Ga0134078_100163623 | 3300014157 | Grasslands Soil | MSTLERDELLTQSEILKKETSPLTKEANQHSEAEPDEAKHGQGL* |
Ga0181532_100334202 | 3300014164 | Bog | MSMLQREELLTQSEILEKETSPRAKEADQHAEAEPDEVHHGQDL* |
Ga0182017_100001152 | 3300014494 | Fen | MSTLQRDELLTQSEILEKETSPPAKEAAQHSEAEPDEAKHGQDL* |
Ga0134073_100037101 | 3300015356 | Grasslands Soil | MSTLERDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGPDL* |
Ga0134073_100810662 | 3300015356 | Grasslands Soil | RMLTLQRDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGLDL* |
Ga0134089_102214152 | 3300015358 | Grasslands Soil | MSTLQRDELLTQSEILKKESSPLTKEADQHSEAEREEAKHAQGL* |
Ga0182036_119138401 | 3300016270 | Soil | TLQHDELLTQSEILEKETLPPAKEADQHAEAEPDEAHHGQDL |
Ga0182035_116793591 | 3300016341 | Soil | LIEKPETRARMSTLEHDELLTQSEILKKEIWPPVKKADQYAEAEPDESHHGQDL |
Ga0182038_116899921 | 3300016445 | Soil | EKPETRARMSTLQHDELLTQSEILEKETLPPAKEADQHAEAEPDEAHHGPDL |
Ga0181505_101259702 | 3300016750 | Peatland | MLQHDELLTQSEILEKETLPPAKEADQHAEAEPDEAHHGQDL |
Ga0187802_100027781 | 3300017822 | Freshwater Sediment | MSTLQRDELLTQREILEEESSPPAKEVYQHSEAERKDAKHDQDL |
Ga0187801_102439551 | 3300017933 | Freshwater Sediment | MSTLQRDELLTQSEILEKGTSLPAKEAHQHSEAAPEDAKHGQDL |
Ga0187801_103381311 | 3300017933 | Freshwater Sediment | MSTLQHDELLTQSEILEKETLPPAKEAGQHAEAEPDEAKHGQDL |
Ga0187819_100033531 | 3300017943 | Freshwater Sediment | RMSTLQHDELLTQSEILEKETVPAAKEAYQHSEAEPEETKHSPDL |
Ga0187817_100436693 | 3300017955 | Freshwater Sediment | LQHDELLTQSEILEKETVPAAKEAYQHSEAEPEETKHSPDL |
Ga0187816_101288443 | 3300017995 | Freshwater Sediment | MSTLQHDELLTQNKILEKQASPLAKEANQYSEAEPYETKHGV |
Ga0066655_106260092 | 3300018431 | Grasslands Soil | MSTLERDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGLDL |
Ga0066667_100321734 | 3300018433 | Grasslands Soil | MSTLERDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGPDL |
Ga0182028_13613382 | 3300019788 | Fen | MSTLQHDELLTQREILEKETSPRAKEVNQSSEAEPGEA |
Ga0210407_100227471 | 3300020579 | Soil | MSTFQRDELLTQSKILEKETSPPAKEAAQHSKAEPDEA |
Ga0210407_100776041 | 3300020579 | Soil | MMVTKILQEQSTLQHDELLTQSEILEKETLPPAKEAHQHAEAEPDEAHHGQDL |
Ga0210407_101886565 | 3300020579 | Soil | DRARMSTFQRDELLTQSKILEKETSPPAKEAAQHSKAEPDEAKHGHDL |
Ga0210407_101887122 | 3300020579 | Soil | MSTFQHDELLTQSEILGKETLPPAKEADRHAGVELDEAHHVQDS |
Ga0210403_105918692 | 3300020580 | Soil | LRDASTLQHDELLMQSEIFEKETLPPAKEADRHAEAEPDEAHHGQDL |
Ga0210403_113624761 | 3300020580 | Soil | MSTFQRDELLTQSKILEKETSPPAKEAAQHSKVEPNEAKRGHDL |
Ga0210395_113751161 | 3300020582 | Soil | RMSTFQRNELLTQSEILEKETLPSAKEAYQHSEEDPDKAKHDQNL |
Ga0210401_101878971 | 3300020583 | Soil | ARMSTFQRDELLTQSKILEKETSPPAKEAAQHSKAEPNAWLKSSLT |
Ga0210406_100138141 | 3300021168 | Soil | MSTLQHDELLTQSEILEKETLLPEKEADQRAEAEPDEAHHGQDL |
Ga0210406_100866001 | 3300021168 | Soil | MSTLQRDELLTQSKILEKETAPAAKEADQHSEAEPEETKHSQGL |
Ga0210406_105780651 | 3300021168 | Soil | LQHDELLTQSEILEKETLLPEKEADQRAEAEPDEAHHGQDL |
Ga0210400_109550811 | 3300021170 | Soil | VEARARMSTLQRDELLTQSKILKKEPSPPAKEANQHSEEKPYETKHDEDL |
Ga0210405_100479772 | 3300021171 | Soil | MSTLQHDELLTQSEILDKETLPPAKEADQHAEAEPDEARHGQDL |
Ga0210405_104353212 | 3300021171 | Soil | ELLTQSEILEKETLPPEKEADQHAEAEPDEAHHGQDL |
Ga0210405_105309111 | 3300021171 | Soil | AFQRDELLAQSKILEKETSPPAKEAAQHSKAEPDEAKHGHDL |
Ga0210408_106647011 | 3300021178 | Soil | MSTLQGDELLTQSEILKKEALPSAKEADQHAEADLDEAKHGQDL |
Ga0210396_105162891 | 3300021180 | Soil | LTQSEILEKETLPPAKEADQHAEAEPDEAHHVQDL |
Ga0210389_103324222 | 3300021404 | Soil | MSTLQRDALLTQSEIFEKETSPPAKEAYHHSKAERDEAKHGQDS |
Ga0210383_106379132 | 3300021407 | Soil | MSALQHDELLTQSEILEKETLPPEKEADQHAEAEPDEAHHGQDL |
Ga0210392_100485241 | 3300021475 | Soil | TLQRDALLTQSEIFEKETSPPAKEAYHHSKAERDEAKHGQDS |
Ga0210392_109404642 | 3300021475 | Soil | QRGELLTQSGILERETLPPAKDAYQHSEARPAEAQRGQDL |
Ga0210402_114206042 | 3300021478 | Soil | QADDRARMSTFQRDELLTQSKILEKETSPPAKEAAQHSKAEPDEAKHGHDL |
Ga0210402_117466772 | 3300021478 | Soil | MSTFQRDELLTQSKILEKETSPPAKEAAQHSKAEPNA |
Ga0210410_1001245913 | 3300021479 | Soil | MSTLQGDELLTQSKILKKEPSPPAKEANQHSEEKPYETKHDEDL |
Ga0210410_100425165 | 3300021479 | Soil | DVSRDELLTQSKILEKETSPPAKEAAQHSKAEPDEAKHGHDL |
Ga0208479_10078544 | 3300025474 | Arctic Peat Soil | MSTLQGDELLTQSEILEKESSPPTKKAAQHYEAEPDEAKHGQDL |
Ga0208479_10167321 | 3300025474 | Arctic Peat Soil | EEAEARARMSTLQRDELLTQSEILEKESSPPAKKAAQHYEAEPDEA |
Ga0209584_100217524 | 3300025878 | Arctic Peat Soil | MSTLQRDELLTQSEILEKESSPPAKKAAQHYEAEPDEAKHGQDL |
Ga0207693_102083381 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RMSTLQHDELLTQSEILEKETLPPEKEADQHAGAEPDEAHHGQDL |
Ga0207693_105890351 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RMSTLQHDELLTQSEILEKETLPPEKEADQHAEAEPDEAHHGQDL |
Ga0207663_103547442 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LVEKPETRARMSTLQHDELLTQSEILDKETLPPVKKADQYAEAEPDESHHGQDL |
Ga0207665_113316331 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | EKPAARARMSTLQRDELLTQSEILEKETLPPEKEADQHAEAEPDEANHG |
Ga0207665_113573211 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTLQRDELLTQSKILEKETSPLAKEANQHSKAEPYKTKHGQDL |
Ga0209265_10498291 | 3300026308 | Soil | RDELLTQSEILKKESSPLTKEADQHSQAERDEAKHGLDL |
Ga0209265_10610033 | 3300026308 | Soil | ELLTQSEILKKESSPLTKEADQHSEAERDEAKHGLDL |
Ga0209686_10130494 | 3300026315 | Soil | KLIEEAETWPGMSTLERDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGPDL |
Ga0209155_10992922 | 3300026316 | Soil | MSTLERDELLTQSEILKKESSPLTKEADQHSQAERDEAKHGLDL |
Ga0209472_10480672 | 3300026323 | Soil | MSTLQRDKLLTQSEILKKETWPPTKEADQHSEAEREEAKHGQGL |
Ga0209266_11438861 | 3300026327 | Soil | LTQSEIRKKETWPPTKEADQHSEAEREEAKHGQGL |
Ga0209473_10103415 | 3300026330 | Soil | GMSTLERDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGPDL |
Ga0209267_12036712 | 3300026331 | Soil | MSTLQRDKLLTQSEILKKETWPPTREADQHSEAEREE |
Ga0257158_10257341 | 3300026515 | Soil | MSTFQRDELLTQSEILEKETLPPEKEAYQHAEAEPDEAHHSQDL |
Ga0209808_10335044 | 3300026523 | Soil | KLIEEAETWPGMSTLERDELLTQSEILKKESSPLTKEADQHSQAERDEAKHGLDL |
Ga0209805_10185841 | 3300026542 | Soil | KLIEEAETWPGMSTLERDELLTQSEILKKESSPLTKEADQHSEAERDEAKHGLDL |
Ga0209648_100568686 | 3300026551 | Grasslands Soil | MSTFQRDELLTQSKILEKETSPPAKEAAQHSKAEPDEAKHGHDL |
Ga0209648_101065922 | 3300026551 | Grasslands Soil | MSTLQHDELLTQSEILEKETLPPEKEADQRAEAEPDEAHYGQDL |
Ga0209648_106416042 | 3300026551 | Grasslands Soil | QAEDRARMSTFQRDELLTQSKILEKETSPPAKEAAQHSKAEPEEAKHGHDL |
Ga0209577_100160516 | 3300026552 | Soil | LLTQSEILKKEASPLAKEADQHPEAEPDEAKHGQDL |
Ga0209577_101067112 | 3300026552 | Soil | MSTLQRDELLTQNKILEKEASPLAKEANQYPEAEPYETKHGVDL |
Ga0179587_103000472 | 3300026557 | Vadose Zone Soil | RSDELLTQSKILEKGTSPLAKEANQYSEAEPYKTKHSQDL |
Ga0209733_10064885 | 3300027591 | Forest Soil | RARMSTLQRNELLTQNKILKKETSPPAKEANQHAEEKPYETKHDEDL |
Ga0208324_11831321 | 3300027604 | Peatlands Soil | MLTLQHDELLTQSEILEKKTLPPAKEAHQRSEAEPDEAKHGQDL |
Ga0209447_100555471 | 3300027701 | Bog Forest Soil | MSTLQHDELLTQSEILEKETLPPAKEADQHAEGEPDKAKHGQDL |
Ga0209701_100863051 | 3300027862 | Vadose Zone Soil | MSTLQRDELLTQSEILEKETSPPAKKADQHSEAEPDESKHGQDL |
Ga0209415_100555463 | 3300027905 | Peatlands Soil | MQSLLRDELLTQSQILKKETSPLTKEADQHSEAEPDEAKHGQDL |
Ga0209526_100188623 | 3300028047 | Forest Soil | MSTLQRDELVTQRKILEKETPPPAKGANQHSEAEPYQTKHDQD |
Ga0209526_100292702 | 3300028047 | Forest Soil | MSTLQRDELLTQSKILEKETSPPAKEANQHSEAEPYETNHGQGL |
Ga0255358_10093961 | 3300028069 | Soil | STLQRDELLTQSEILEKETSPPAKEAAQHSEAEPDEAKHGQDL |
Ga0268264_100177124 | 3300028381 | Switchgrass Rhizosphere | MSTLQRDQLLTQSEILKKETSPLTKEADQHSEAEPDEAKHGQDL |
Ga0137415_104432731 | 3300028536 | Vadose Zone Soil | LLTQSKILEKGTSPLAKEANQYSEAEPYKTKHSQDL |
Ga0075395_109814972 | 3300030973 | Soil | MSTLQHDELLTQNEILEKETLPPAKEADQHAEAEPDEAHHGQDL |
Ga0170834_1056608322 | 3300031057 | Forest Soil | DELLTQSKILKKEPSPPAKEANQHSEEKPYEIRHDEDL |
Ga0170834_1101145582 | 3300031057 | Forest Soil | MSTLQHDELLTQSEILEKETLLPEKEADQRAEAEPDETHHGQDL |
Ga0170834_1103632811 | 3300031057 | Forest Soil | EARARMSTLQRDELLTQSKILKKEPSPPAKEANQHSEEKPYETKHDEDL |
Ga0170834_1108631481 | 3300031057 | Forest Soil | MSTLQHYELLTQSEILEKETLPPAKEADQHAEAEPDEAHHGQD |
Ga0265760_100744232 | 3300031090 | Soil | LTQSEILEKETLSPVKEAYHHSKAESDATKHGQDL |
Ga0170823_108242092 | 3300031128 | Forest Soil | MSTLQHYELLTQSEILEKETLPPAKEAEQHAEAEPDEAHHGQDS |
Ga0170823_128436705 | 3300031128 | Forest Soil | RARMSTLQRDELLTQSKILKKEPSPPAKEANQHSEEKPYETKHDEDL |
Ga0307498_102821482 | 3300031170 | Soil | MSTLQRNALLTQSEILEKETSPTAKEAYHHSKAERDEAKHGQ |
Ga0170824_1056248462 | 3300031231 | Forest Soil | RARMSTLQRDELLTQSKILKKEPSPPAKEANQHSEEKPYEIRHDEDL |
Ga0170824_1238519112 | 3300031231 | Forest Soil | MSTFQRDELLTQTKILEKETSPPAKEAAQHSKAAPNEAKHGHDL |
Ga0170824_1289770171 | 3300031231 | Forest Soil | MSTLQRDELLTQSEILEKETSLPAKEAHQHSEAEPEDAKHGQDL |
Ga0170820_102726071 | 3300031446 | Forest Soil | MSTFHRDELLTQSKILEKETSPPAKKAAQRSEAEPNEAKHGHDL |
Ga0170820_117189832 | 3300031446 | Forest Soil | STFQRDELLTQTKILEKETSPPAKEAAQHSKAAPNEAKHGHDL |
Ga0170820_154525372 | 3300031446 | Forest Soil | MSTLQRDELLTQSEILEKETSPPVKEAYHHSKAEPDEAKHDQDL |
Ga0318528_102202461 | 3300031561 | Soil | IEKPETRARMSTLEHDELLTQSEILEKETLPPAKEAAQHAEGEPDEANHDQDL |
Ga0318573_103736071 | 3300031564 | Soil | MSTLEHDELLTQSEILEKETLPPAKEAAQHAEAEPDEANHDQDL |
Ga0307476_110681872 | 3300031715 | Hardwood Forest Soil | LQRDELLTQSEILKKETSPAAKEADQHSEAEPDEAKHGQDL |
Ga0307469_124936761 | 3300031720 | Hardwood Forest Soil | MSTLQRDELLTQSKILKKKTSPPAKEANQHSEEKPYETKHDEDL |
Ga0307475_102632661 | 3300031754 | Hardwood Forest Soil | MSPLQHDELLTQSEILKKETLPPEKEADQHAEAEPDEAHHGQDL |
Ga0307475_103685811 | 3300031754 | Hardwood Forest Soil | TRARVSTLQHDELLTQSEILEKETLPPAKEADQHAEAEPDEAHHGQDL |
Ga0307475_106075101 | 3300031754 | Hardwood Forest Soil | TLQRNELLTQSEILKKETSPPTKEADQHSEAEPDEAKHGQDL |
Ga0318548_100769352 | 3300031793 | Soil | MSTLQHDELLTQSEILEKETLPPAKEAAQHAEGEPDEANHDQDL |
Ga0306925_113675261 | 3300031890 | Soil | MLTLQHDELLTQSEILEKETLPPAKEADQHAEAEPDEAHHGQDL |
Ga0318520_100684331 | 3300031897 | Soil | PETRARMSTLEHDELLTQSEILEKETLPPAKEAAQHAEAEPDEANHDQDL |
Ga0306923_100237701 | 3300031910 | Soil | MSTLEHDELLTQSEILEKETLPPAKEAAQHAEGEPDEANHDQDL |
Ga0306921_112422201 | 3300031912 | Soil | MSTLEHDELLTQSEILKKEIWPPVKKADQYAEAEPDESHHGQDL |
Ga0310912_101823563 | 3300031941 | Soil | MSTLQHDELLAQSEILEKETLPPVKKADQYAEAEPDETNHGQDL |
Ga0306926_104217191 | 3300031954 | Soil | LIEKPETRARMSTLEHDELLTQSEILEKETLPPAKEAAQHAEGEPDEANHDQDL |
Ga0307479_107128981 | 3300031962 | Hardwood Forest Soil | MSTLQHDELLTQSEILEKETLPPEKEADQHAQAEPDEAHHGQDL |
Ga0307479_107242812 | 3300031962 | Hardwood Forest Soil | VSTLQHDELLTQSEILEKETLPPEKEADQHAEAEPDEAHHGQDL |
Ga0307479_108155751 | 3300031962 | Hardwood Forest Soil | EQPKTRARMSTFQRKELLTRSEILEKETLPPAKEAYQYSEAEPEEAKHAQDL |
Ga0307470_105789911 | 3300032174 | Hardwood Forest Soil | MSTLQRDELLTQSKILEKETSPLAKEANQHSKAEPYKTKHSQDL |
Ga0307471_10000385112 | 3300032180 | Hardwood Forest Soil | LGIAQRDELLTQSEILDKETSPPAKEAYYHSKAEPDEAKHGQDL |
Ga0307471_1002392762 | 3300032180 | Hardwood Forest Soil | MPALQHDELLTQSEILEKETLPPEKEADQHAEAWPDEAHHGQDL |
Ga0307471_1002540341 | 3300032180 | Hardwood Forest Soil | LLTQSEILEKETLPPEKEADQHAEAEPDEAHHGQDL |
Ga0307471_1010933842 | 3300032180 | Hardwood Forest Soil | MSTLQRDELLTQSEILEKETSPPAKEAYHHSKAERDEAKHGQDL |
Ga0307471_1030246031 | 3300032180 | Hardwood Forest Soil | STLQHDELLTQSEILERETLPPVKEADQHAEAEPDAAHHGQDL |
Ga0307472_1000270311 | 3300032205 | Hardwood Forest Soil | HDELLTQSEILEKETLPPEKEADQHAEAEPDEAHHGQDL |
Ga0307472_1002057392 | 3300032205 | Hardwood Forest Soil | MSTLQRDELLTQSEILKKETSPPAKEADQHSEAEPDEAKHGQDL |
Ga0307472_1004703211 | 3300032205 | Hardwood Forest Soil | QHDELLTQSEILERETLPPVKEADQHAEAEPDAAHHGQDL |
Ga0307472_1009791731 | 3300032205 | Hardwood Forest Soil | MSTFQRDELLTQSKILEKETSPPAKEAAQHSKAEPNEAKHGHDL |
Ga0306920_1008924721 | 3300032261 | Soil | STPQHDELLTQSEILEKETLPPAKEADQHAEAEPDEAHHGQDL |
Ga0314861_0012004_1756_1887 | 3300033977 | Peatland | MSTLHRDELLTQSEILEKETVPRAKEANQRSEAEPDEAKHGQE |
Ga0334822_071640_197_331 | 3300034070 | Soil | MSTLQRDELLTQSEILEKETSPPAKEAAQHSEAEPDEAKHGQDL |
⦗Top⦘ |