Metagenome Family F018311

Basic Information
Family ID	F018311
Family Type	Metagenome
Number of Sequences	235
Average Sequence Length	45 residues
Representative Sequence	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPP
Number of Associated Samples	78
Number of Associated Scaffolds	235

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	68.16 %
% of genes near scaffold ends (potentially truncated)	67.23 %
% of genes from short scaffolds (< 2000 bps)	94.89 %
Associated GOLD sequencing projects	76
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.32

Most Common Taxonomy
Group	Eukaryota (52.766 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (94.043 % of family members)
Environment Ontology (ENVO)	Unclassified (94.043 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (94.043 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 19.18% β-sheet: 0.00% Coil/Unstructured: 80.82%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 235 Family Scaffolds
PF03732	Retrotrans_gag	14.04

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	67.23 %
Unclassified	root	N/A	32.77 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	67.23 %
Unclassified	root	N/A	32.77 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	52.77 %
Unclassified	root	N/A	32.77 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	14.47 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	52.77 %
Unclassified	root	N/A	32.77 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	14.47 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	52.77 %
Unclassified	root	N/A	32.77 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	14.47 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	52.77 %
Unclassified	root	N/A	32.77 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	14.47 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	52.77 %
Unclassified	root	N/A	32.77 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	14.47 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	52.77 %
Unclassified	root	N/A	32.77 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	14.47 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	52.77 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	52.77 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	52.77 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	52.77 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	52.77 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	52.77 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	52.77 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	52.77 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	52.77 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %

Name	Rank	Taxonomy	Distribution
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	42.55 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	5.96 %

Name	Rank	Taxonomy	Distribution
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	42.55 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	5.96 %

Name	Rank	Taxonomy	Distribution
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	42.55 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	5.96 %

Name	Rank	Taxonomy	Distribution
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	42.55 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	5.96 %

Name	Rank	Taxonomy	Distribution
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	42.55 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	5.96 %

Name	Rank	Taxonomy	Distribution
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	41.28 %
Unclassified	root	N/A	32.77 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	14.47 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	5.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005334\|Ga0068869_101378181	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	624	Open in IMG/M
3300009036\|Ga0105244_10595976	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	507	Open in IMG/M
3300009148\|Ga0105243_11778774	Not Available	647	Open in IMG/M
3300009148\|Ga0105243_12362832	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	570	Open in IMG/M
3300013296\|Ga0157374_12240736	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	573	Open in IMG/M
3300013297\|Ga0157378_12195663	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	603	Open in IMG/M
3300013297\|Ga0157378_12387305	Not Available	581	Open in IMG/M
3300013297\|Ga0157378_12515950	Not Available	567	Open in IMG/M
3300013297\|Ga0157378_13000829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	524	Open in IMG/M
3300014969\|Ga0157376_10855086	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	925	Open in IMG/M
3300015267\|Ga0182122_1021581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	701	Open in IMG/M
3300015267\|Ga0182122_1034630	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	618	Open in IMG/M
3300015268\|Ga0182154_1018824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	729	Open in IMG/M
3300015268\|Ga0182154_1067370	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	516	Open in IMG/M
3300015268\|Ga0182154_1074087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	501	Open in IMG/M
3300015269\|Ga0182113_1032940	Not Available	695	Open in IMG/M
3300015269\|Ga0182113_1095321	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	505	Open in IMG/M
3300015274\|Ga0182188_1025856	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	633	Open in IMG/M
3300015274\|Ga0182188_1046087	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	546	Open in IMG/M
3300015275\|Ga0182172_1061555	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	538	Open in IMG/M
3300015275\|Ga0182172_1073083	Not Available	510	Open in IMG/M
3300015275\|Ga0182172_1075554	Not Available	504	Open in IMG/M
3300015276\|Ga0182170_1036480	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	626	Open in IMG/M
3300015277\|Ga0182128_1004480	Not Available	1108	Open in IMG/M
3300015277\|Ga0182128_1046344	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	589	Open in IMG/M
3300015277\|Ga0182128_1047302	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	586	Open in IMG/M
3300015277\|Ga0182128_1071301	Not Available	519	Open in IMG/M
3300015277\|Ga0182128_1074684	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	512	Open in IMG/M
3300015281\|Ga0182160_1048487	Not Available	591	Open in IMG/M
3300015281\|Ga0182160_1061195	Not Available	553	Open in IMG/M
3300015282\|Ga0182124_1046365	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	595	Open in IMG/M
3300015282\|Ga0182124_1057137	Not Available	561	Open in IMG/M
3300015282\|Ga0182124_1057729	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	559	Open in IMG/M
3300015283\|Ga0182156_1031175	Not Available	680	Open in IMG/M
3300015283\|Ga0182156_1036402	Not Available	651	Open in IMG/M
3300015283\|Ga0182156_1037499	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	646	Open in IMG/M
3300015283\|Ga0182156_1063598	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	555	Open in IMG/M
3300015285\|Ga0182186_1051290	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	581	Open in IMG/M
3300015286\|Ga0182176_1023636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	751	Open in IMG/M
3300015286\|Ga0182176_1024843	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	740	Open in IMG/M
3300015286\|Ga0182176_1027244	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	719	Open in IMG/M
3300015286\|Ga0182176_1047818	Not Available	605	Open in IMG/M
3300015286\|Ga0182176_1053483	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	584	Open in IMG/M
3300015286\|Ga0182176_1073969	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	527	Open in IMG/M
3300015287\|Ga0182171_1029908	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	688	Open in IMG/M
3300015287\|Ga0182171_1041277	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	629	Open in IMG/M
3300015287\|Ga0182171_1076114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	526	Open in IMG/M
3300015288\|Ga0182173_1030727	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	676	Open in IMG/M
3300015288\|Ga0182173_1077153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	520	Open in IMG/M
3300015288\|Ga0182173_1083795	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	507	Open in IMG/M
3300015289\|Ga0182138_1015104	Not Available	828	Open in IMG/M
3300015289\|Ga0182138_1037276	Not Available	649	Open in IMG/M
3300015289\|Ga0182138_1073666	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	533	Open in IMG/M
3300015292\|Ga0182141_1050867	Not Available	604	Open in IMG/M
3300015294\|Ga0182126_1049769	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	612	Open in IMG/M
3300015294\|Ga0182126_1080847	Not Available	530	Open in IMG/M
3300015294\|Ga0182126_1081304	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	529	Open in IMG/M
3300015295\|Ga0182175_1024680	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	753	Open in IMG/M
3300015295\|Ga0182175_1033251	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	693	Open in IMG/M
3300015295\|Ga0182175_1085807	Not Available	525	Open in IMG/M
3300015295\|Ga0182175_1093813	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	510	Open in IMG/M
3300015296\|Ga0182157_1049057	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	630	Open in IMG/M
3300015296\|Ga0182157_1051326	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	622	Open in IMG/M
3300015298\|Ga0182106_1021854	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	794	Open in IMG/M
3300015298\|Ga0182106_1062148	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	588	Open in IMG/M
3300015299\|Ga0182107_1017503	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	848	Open in IMG/M
3300015299\|Ga0182107_1064316	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	585	Open in IMG/M
3300015299\|Ga0182107_1083769	Not Available	539	Open in IMG/M
3300015300\|Ga0182108_1026783	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	758	Open in IMG/M
3300015300\|Ga0182108_1042155	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	667	Open in IMG/M
3300015300\|Ga0182108_1043619	Not Available	660	Open in IMG/M
3300015300\|Ga0182108_1089358	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	532	Open in IMG/M
3300015302\|Ga0182143_1102957	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	504	Open in IMG/M
3300015303\|Ga0182123_1027754	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	722	Open in IMG/M
3300015303\|Ga0182123_1041000	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	648	Open in IMG/M
3300015303\|Ga0182123_1056539	Not Available	593	Open in IMG/M
3300015303\|Ga0182123_1076887	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	542	Open in IMG/M
3300015303\|Ga0182123_1080570	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	535	Open in IMG/M
3300015303\|Ga0182123_1083490	Not Available	529	Open in IMG/M
3300015305\|Ga0182158_1080645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	545	Open in IMG/M
3300015305\|Ga0182158_1087044	Not Available	532	Open in IMG/M
3300015305\|Ga0182158_1091899	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	523	Open in IMG/M
3300015307\|Ga0182144_1022649	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	799	Open in IMG/M
3300015307\|Ga0182144_1047725	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	645	Open in IMG/M
3300015307\|Ga0182144_1059035	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	606	Open in IMG/M
3300015307\|Ga0182144_1071680	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	572	Open in IMG/M
3300015308\|Ga0182142_1084990	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	553	Open in IMG/M
3300015308\|Ga0182142_1103385	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	520	Open in IMG/M
3300015308\|Ga0182142_1110686	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	509	Open in IMG/M
3300015314\|Ga0182140_1005201	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1227	Open in IMG/M
3300015314\|Ga0182140_1028984	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	761	Open in IMG/M
3300015314\|Ga0182140_1080808	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	564	Open in IMG/M
3300015314\|Ga0182140_1095391	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	535	Open in IMG/M
3300015314\|Ga0182140_1103255	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	521	Open in IMG/M
3300015314\|Ga0182140_1112022	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	508	Open in IMG/M
3300015314\|Ga0182140_1117048	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	501	Open in IMG/M
3300015321\|Ga0182127_1065485	Not Available	617	Open in IMG/M
3300015321\|Ga0182127_1085581	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	568	Open in IMG/M
3300015322\|Ga0182110_1064296	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	619	Open in IMG/M
3300015322\|Ga0182110_1085372	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	567	Open in IMG/M
3300015322\|Ga0182110_1092837	Not Available	552	Open in IMG/M
3300015322\|Ga0182110_1093264	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	551	Open in IMG/M
3300015322\|Ga0182110_1098163	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	542	Open in IMG/M
3300015323\|Ga0182129_1080485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	563	Open in IMG/M
3300015323\|Ga0182129_1106990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	515	Open in IMG/M
3300015341\|Ga0182187_1074143	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	716	Open in IMG/M
3300015341\|Ga0182187_1143118	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	569	Open in IMG/M
3300015341\|Ga0182187_1180916	Not Available	522	Open in IMG/M
3300015341\|Ga0182187_1201611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	500	Open in IMG/M
3300015343\|Ga0182155_1165914	Not Available	564	Open in IMG/M
3300015343\|Ga0182155_1190250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	535	Open in IMG/M
3300015343\|Ga0182155_1214228	Not Available	512	Open in IMG/M
3300015344\|Ga0182189_1071867	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	771	Open in IMG/M
3300015344\|Ga0182189_1139215	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	608	Open in IMG/M
3300015344\|Ga0182189_1169106	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	565	Open in IMG/M
3300015345\|Ga0182111_1078130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	775	Open in IMG/M
3300015345\|Ga0182111_1097879	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	714	Open in IMG/M
3300015345\|Ga0182111_1179540	Not Available	567	Open in IMG/M
3300015345\|Ga0182111_1181133	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	566	Open in IMG/M
3300015345\|Ga0182111_1197984	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	546	Open in IMG/M
3300015345\|Ga0182111_1199087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	545	Open in IMG/M
3300015346\|Ga0182139_1117169	Not Available	668	Open in IMG/M
3300015346\|Ga0182139_1126056	Not Available	650	Open in IMG/M
3300015346\|Ga0182139_1155667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	601	Open in IMG/M
3300015346\|Ga0182139_1243469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	503	Open in IMG/M
3300015347\|Ga0182177_1067638	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	821	Open in IMG/M
3300015347\|Ga0182177_1186492	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	563	Open in IMG/M
3300015351\|Ga0182161_1038554	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	1053	Open in IMG/M
3300015351\|Ga0182161_1111526	Not Available	710	Open in IMG/M
3300015351\|Ga0182161_1131543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	667	Open in IMG/M
3300015351\|Ga0182161_1154180	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	627	Open in IMG/M
3300015351\|Ga0182161_1268524	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	501	Open in IMG/M
3300015355\|Ga0182159_1133321	Not Available	762	Open in IMG/M
3300015355\|Ga0182159_1168796	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	691	Open in IMG/M
3300015355\|Ga0182159_1261271	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	572	Open in IMG/M
3300015355\|Ga0182159_1286800	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	549	Open in IMG/M
3300015355\|Ga0182159_1300527	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	538	Open in IMG/M
3300015355\|Ga0182159_1300973	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	538	Open in IMG/M
3300015355\|Ga0182159_1313498	Not Available	528	Open in IMG/M
3300015355\|Ga0182159_1330613	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	516	Open in IMG/M
3300015355\|Ga0182159_1337741	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	511	Open in IMG/M
3300015361\|Ga0182145_1089872	Not Available	652	Open in IMG/M
3300015361\|Ga0182145_1190248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	506	Open in IMG/M
3300017404\|Ga0182203_1076187	Not Available	645	Open in IMG/M
3300017404\|Ga0182203_1108222	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	577	Open in IMG/M
3300017404\|Ga0182203_1133562	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	538	Open in IMG/M
3300017407\|Ga0182220_1029516	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	720	Open in IMG/M
3300017407\|Ga0182220_1052890	Not Available	616	Open in IMG/M
3300017407\|Ga0182220_1063812	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	585	Open in IMG/M
3300017409\|Ga0182204_1104810	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	524	Open in IMG/M
3300017409\|Ga0182204_1108151	Not Available	519	Open in IMG/M
3300017409\|Ga0182204_1110178	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	516	Open in IMG/M
3300017410\|Ga0182207_1153061	Not Available	528	Open in IMG/M
3300017410\|Ga0182207_1161770	Not Available	517	Open in IMG/M
3300017411\|Ga0182208_1014232	Not Available	972	Open in IMG/M
3300017411\|Ga0182208_1061362	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	635	Open in IMG/M
3300017411\|Ga0182208_1074252	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	599	Open in IMG/M
3300017411\|Ga0182208_1103051	Not Available	541	Open in IMG/M
3300017411\|Ga0182208_1129490	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	502	Open in IMG/M
3300017413\|Ga0182222_1106496	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	504	Open in IMG/M
3300017415\|Ga0182202_1071078	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	625	Open in IMG/M
3300017415\|Ga0182202_1091267	Not Available	577	Open in IMG/M
3300017415\|Ga0182202_1112619	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	539	Open in IMG/M
3300017417\|Ga0182230_1084073	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	578	Open in IMG/M
3300017420\|Ga0182228_1086006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	583	Open in IMG/M
3300017424\|Ga0182219_1054211	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	675	Open in IMG/M
3300017424\|Ga0182219_1132143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	512	Open in IMG/M
3300017424\|Ga0182219_1139184	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	503	Open in IMG/M
3300017425\|Ga0182224_1088047	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	617	Open in IMG/M
3300017425\|Ga0182224_1123754	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	554	Open in IMG/M
3300017425\|Ga0182224_1128114	Not Available	547	Open in IMG/M
3300017425\|Ga0182224_1154380	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	514	Open in IMG/M
3300017425\|Ga0182224_1161686	Not Available	506	Open in IMG/M
3300017427\|Ga0182190_1062939	Not Available	698	Open in IMG/M
3300017427\|Ga0182190_1063919	Not Available	694	Open in IMG/M
3300017427\|Ga0182190_1098166	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	602	Open in IMG/M
3300017427\|Ga0182190_1107059	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	584	Open in IMG/M
3300017427\|Ga0182190_1113852	Not Available	572	Open in IMG/M
3300017427\|Ga0182190_1148737	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	521	Open in IMG/M
3300017427\|Ga0182190_1157975	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	510	Open in IMG/M
3300017430\|Ga0182192_1013371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1185	Open in IMG/M
3300017430\|Ga0182192_1116841	Not Available	577	Open in IMG/M
3300017430\|Ga0182192_1131907	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	553	Open in IMG/M
3300017430\|Ga0182192_1150311	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	528	Open in IMG/M
3300017433\|Ga0182206_1137770	Not Available	527	Open in IMG/M
3300017436\|Ga0182209_1042515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	786	Open in IMG/M
3300017436\|Ga0182209_1162273	Not Available	514	Open in IMG/M
3300017438\|Ga0182191_1043496	Not Available	808	Open in IMG/M
3300017438\|Ga0182191_1169997	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	515	Open in IMG/M
3300017442\|Ga0182221_1068817	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	666	Open in IMG/M
3300017442\|Ga0182221_1080341	Not Available	636	Open in IMG/M
3300017442\|Ga0182221_1096875	Not Available	600	Open in IMG/M
3300017442\|Ga0182221_1111845	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	574	Open in IMG/M
3300017442\|Ga0182221_1128609	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	550	Open in IMG/M
3300017443\|Ga0182193_1044683	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	825	Open in IMG/M
3300017443\|Ga0182193_1054880	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	773	Open in IMG/M
3300017443\|Ga0182193_1118396	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	601	Open in IMG/M
3300017443\|Ga0182193_1161590	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	539	Open in IMG/M
3300017443\|Ga0182193_1189554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	509	Open in IMG/M
3300017680\|Ga0182233_1081684	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	587	Open in IMG/M
3300017681\|Ga0182226_1055611	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	718	Open in IMG/M
3300017681\|Ga0182226_1075437	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	623	Open in IMG/M
3300017681\|Ga0182226_1117815	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	507	Open in IMG/M
3300017682\|Ga0182229_1050874	Not Available	703	Open in IMG/M
3300017682\|Ga0182229_1078347	Not Available	573	Open in IMG/M
3300017682\|Ga0182229_1081805	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	562	Open in IMG/M
3300017683\|Ga0182218_1105654	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	565	Open in IMG/M
3300017683\|Ga0182218_1146637	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	510	Open in IMG/M
3300017683\|Ga0182218_1149215	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	507	Open in IMG/M
3300017684\|Ga0182225_1029225	Not Available	825	Open in IMG/M
3300017684\|Ga0182225_1071441	Not Available	626	Open in IMG/M
3300017685\|Ga0182227_1051965	Not Available	731	Open in IMG/M
3300017685\|Ga0182227_1098053	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	569	Open in IMG/M
3300017685\|Ga0182227_1106733	Not Available	551	Open in IMG/M
3300017686\|Ga0182205_1058836	Not Available	718	Open in IMG/M
3300017686\|Ga0182205_1123103	Not Available	563	Open in IMG/M
3300017686\|Ga0182205_1138863	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	540	Open in IMG/M
3300017689\|Ga0182231_1060695	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	713	Open in IMG/M
3300017689\|Ga0182231_1093267	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	579	Open in IMG/M
3300017690\|Ga0182223_1112152	Not Available	518	Open in IMG/M
3300025935\|Ga0207709_11686415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	527	Open in IMG/M
3300025942\|Ga0207689_11487305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	566	Open in IMG/M
3300026023\|Ga0207677_10893692	Not Available	800	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	94.04%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.26%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.70%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	94.04%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.26%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.28%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.43%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	94.04%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.26%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.28%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.43%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	94.04%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.55%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.70%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.28%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.43%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1013781811	3300005334	Miscanthus Rhizosphere	MVPNPWERGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPPD*
Ga0105244_105959763	3300009036	Miscanthus Rhizosphere	MVPNSWRRGVEESYDFDVTKLDKLFDFLLEKGQIKLPDGHVILPLIS*
Ga0105243_117787741	3300009148	Miscanthus Rhizosphere	TLMVPNPWGKRVEESYDFDIIKSDKLFDFLLEKGHIKLPANHVMLPPD*
Ga0105243_123628322	3300009148	Miscanthus Rhizosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLLDNHVMLPLIS*
Ga0157374_122407362	3300013296	Miscanthus Rhizosphere	MIPNPWGKGVEESYDFDVTKSDKLFDFLLEKGQIKLPANHVILPPD*
Ga0157378_121956631	3300013297	Miscanthus Rhizosphere	NPWGKEVEESYDFDVTKADKLFDFLLEKGQIKLPANHVILPPD*
Ga0157378_123873053	3300013297	Miscanthus Rhizosphere	GVEENYDFNVMKSDKLFDFLLEKEQIKLLDNHVMLPLIS*
Ga0157378_125159503	3300013297	Miscanthus Rhizosphere	MIVMVPNPWGRRVEESYDFDITKADKLFDFLHEKGQIKLSDNHVM
Ga0157378_130008293	3300013297	Miscanthus Rhizosphere	MVPNPWGRGVEESYDFDIIKSDKLFDFLLEKGQIKLPDNHVMF
Ga0157376_108550862	3300014969	Miscanthus Rhizosphere	VSNPWGKGVEESYDFDVTKSDKLFDFLLEKGQIK*
Ga0182122_10215812	3300015267	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDNFFDFLLEKGQIKLPDGHVTLPPD*
Ga0182122_10346302	3300015267	Miscanthus Phyllosphere	MVPNSWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDGHV
Ga0182154_10188242	3300015268	Miscanthus Phyllosphere	MVPNPWERGVEESYDFDVTKSDKLFDFLLEKGQIKLLDNQVMLPPD*
Ga0182154_10673702	3300015268	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPNGHVVLPPDQLNNK
Ga0182154_10740871	3300015268	Miscanthus Phyllosphere	MVPNPWGKGVEERYNFDVTKSDKLFDFLLEKGQIKLSDNHVMLPPDQLK
Ga0182113_10329401	3300015269	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVIKSDKLFDFLLKKGQIKLPANHVILPLDQLKNKKF
Ga0182113_10953211	3300015269	Miscanthus Phyllosphere	MGPNPWGSGVEESYDFDVTKSDKLFDFLLEKGQIKLLDGHVM
Ga0182188_10258561	3300015274	Miscanthus Phyllosphere	MVSNPWRRGVEESYDFDVTKSDKLFDFLLEKGQIKLPNNHV
Ga0182188_10460871	3300015274	Miscanthus Phyllosphere	MVPNPLGKGVEEIYDFDVTKSDKLFDFLLERGHIKLPTNHVMLPPD*
Ga0182172_10615552	3300015275	Miscanthus Phyllosphere	VPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDN
Ga0182172_10730832	3300015275	Miscanthus Phyllosphere	MVPNPWRNEVEENYDFDVIKVDKLFDFLLEKGQIKLPANYVILPPDQLKNKKF
Ga0182172_10755542	3300015275	Miscanthus Phyllosphere	PNPWGKGVKESYDFDVTISDKLFDFLLEKGQIKLPDGHVMLPP*
Ga0182170_10364801	3300015276	Miscanthus Phyllosphere	EVEESYDFDVTKADKLFDFLLEKGQIKLPANHVILPPD*
Ga0182128_10044803	3300015277	Miscanthus Phyllosphere	MVPNPWGKEVKESYDFDVIKADKLFDFLLEKGQIKLPANHVILPPDQLKI*
Ga0182128_10463441	3300015277	Miscanthus Phyllosphere	VPNPWGKGVEERYDFDITKSDKLFDFLLEKGQIKLPDNHIMLPPK*
Ga0182128_10473021	3300015277	Miscanthus Phyllosphere	MVPNPWEKEVEESYDFDVTKANKLFDFLLEKGQIKLPTNHVILPPD*
Ga0182128_10713011	3300015277	Miscanthus Phyllosphere	MVLNPWEKGVEESYDFDITKSDKLFNFLLEKGQIKLLANHVILSPYQLKNKKFYK
Ga0182128_10746841	3300015277	Miscanthus Phyllosphere	MVPNPWGRGVKESYDFDVTKSDKLFDFLLEKGQIKLPDGHVMLPPDQLKNKKF
Ga0182160_10484871	3300015281	Miscanthus Phyllosphere	MVPNPWGKEVEESYDFDVIKSDKLFDFLLERGQIKLLANHVMLPPN*
Ga0182160_10611951	3300015281	Miscanthus Phyllosphere	MVSNPWGRGVEESYDFDVIKSSKLFDFLLERGQIKLFTNHVML
Ga0182124_10463652	3300015282	Miscanthus Phyllosphere	MVPNPWGRRVKESYDFDVTKSDKLFDFLLEKGQIKLPDNHIMLPPE*
Ga0182124_10571372	3300015282	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFDVTKSDKFFDFLLEKGQIKLPANHV
Ga0182124_10577291	3300015282	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGRSSCPDGHVMLPPDQLKK*
Ga0182156_10311753	3300015283	Miscanthus Phyllosphere	EESYDFDVTKVDKLFDLLLEKGQIKLPANHVILPPDQLKNKKFCK*
Ga0182156_10364022	3300015283	Miscanthus Phyllosphere	GRGVDESYNFDVTKSDKLFDFLLEKGQIKLPDSHVMLPPD*
Ga0182156_10374992	3300015283	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNHVML
Ga0182156_10635982	3300015283	Miscanthus Phyllosphere	VPNPWGRGVEESYDFDVTKLDKLFNFLLEKGQIKLPDGHVMLPP
Ga0182186_10512902	3300015285	Miscanthus Phyllosphere	MIPNPWGKKVEESYDFDVTKVDKLFDFLLEKGQIKLPTNHVILPPDQLKNKKF*
Ga0182176_10236361	3300015286	Miscanthus Phyllosphere	MVPNPWGRGVKESYEFDVTKSDKLFDFLLEKGHIKLPDNHVMLPPD*
Ga0182176_10248432	3300015286	Miscanthus Phyllosphere	MVPNPWERGVKESYDYDVTKSDKLFDFLLEKGQIKLSDGHVMLPLIN*
Ga0182176_10272441	3300015286	Miscanthus Phyllosphere	MMVPNPWGKGVEESYDFDVTKSDKLFNFLLEKGQIKLPANHVILPLD*
Ga0182176_10478181	3300015286	Miscanthus Phyllosphere	MVPNPWGRGVEVSYDFDVTKSDELFDFLLEKGQIKLPDNHVMLPLNS*
Ga0182176_10534831	3300015286	Miscanthus Phyllosphere	MVPNPWGKGIEESYDFDVTKSDKLFDFLLEKGQIKLLDNHIMLPLNN*
Ga0182176_10739691	3300015286	Miscanthus Phyllosphere	SYDFDVTKSDKLFDFLIEKGQIKLPDGHVMLPPD*
Ga0182171_10299081	3300015287	Miscanthus Phyllosphere	MVPNPWGRGVKESYDFDVMKSDKLFDFLLEKGQIKLPDNHVMLPPKQLKNKKFYKF
Ga0182171_10412772	3300015287	Miscanthus Phyllosphere	AEWNWGKKIVMVPNPWRRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDGHVMLPPD*
Ga0182171_10761143	3300015287	Miscanthus Phyllosphere	MVPNPWGRRVEESYDFDVTKSDKLFDFLLKKWQIKLPDGHVVLPSDQLKNKKLC
Ga0182173_10307273	3300015288	Miscanthus Phyllosphere	MVPNPWGRGVKESYDFDVTKLDKLFDFLLEKGQIKFPDGHVMLPLD*
Ga0182173_10771531	3300015288	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKL
Ga0182173_10837951	3300015288	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDNFFDFLLEKGQIKLPDGHVMLPPDQLKNKK
Ga0182138_10151042	3300015289	Miscanthus Phyllosphere	MIVMVPNPWGKEVEESYYFDVTKADKLFDFLLEKG*
Ga0182138_10372762	3300015289	Miscanthus Phyllosphere	MVPNPWRRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDGYVMLPPD*
Ga0182138_10736661	3300015289	Miscanthus Phyllosphere	MVPNPWGRGVKESYDFDVTKSDKLFNFLLEKGQIKLFDGHVMLPQIS*
Ga0182141_10508671	3300015292	Miscanthus Phyllosphere	VVPNPWGRGVEESYDFDVTKSGKLFDFLLEKGQIKLLDNHVMLP*
Ga0182126_10497692	3300015294	Miscanthus Phyllosphere	MVPNPWGKQVEESYDFDVSKAHKLFDFLLEKGQIKLSTNHVILPPD*
Ga0182126_10808472	3300015294	Miscanthus Phyllosphere	MVPNLWGKGVKESYDFNITKSDKLFDFMLKKGQIKLPDNHIMLPLDQLKNKK
Ga0182126_10813041	3300015294	Miscanthus Phyllosphere	MVPNPWGKEVEESYDFDVTKADKLFDFLLEKGQNKLPANHVILPLD*
Ga0182175_10246801	3300015295	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPP
Ga0182175_10332513	3300015295	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDGHIMLPPDQLKNKKFCKF
Ga0182175_10784801	3300015295	Miscanthus Phyllosphere	MVPSPWGRGVEESYDFDVMKLDKLFDFLLEKGQIKLLNNHVMLSPEQLKNKKFC
Ga0182175_10858071	3300015295	Miscanthus Phyllosphere	MVPNPWGRGIEESYDFDITKSDKLFNFLLEKGHIKLSDNHVMLPPDQLKK
Ga0182175_10938132	3300015295	Miscanthus Phyllosphere	VPNPWGRGVKESYDFDITKSDKLFDFLLQKGQIKLPDNYVMLPPD*
Ga0182157_10490571	3300015296	Miscanthus Phyllosphere	MVLNPWGRGVKESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPPNQLKNKKL
Ga0182157_10513261	3300015296	Miscanthus Phyllosphere	MVPNPWVRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNH
Ga0182106_10218542	3300015298	Miscanthus Phyllosphere	MVPNPWRKGVEENYGFNVTKSDKLFDFLLEKGQIKLLANHVILPPDQLKNKKFY
Ga0182106_10621481	3300015298	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFDITKSDKLFDFLLERGQIKLPTNHVMLPPN*
Ga0182107_10175032	3300015299	Miscanthus Phyllosphere	MVLSPWGKGVEDSYDFDVTKLDKLFNFLLEKGEIKLSTNH
Ga0182107_10643161	3300015299	Miscanthus Phyllosphere	MVPSPWGKGLEESYDFDITKLDKLFDFLIERGQIKLPANHVMLTPDQLRN
Ga0182107_10837691	3300015299	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLSDGHVMLPLIS*
Ga0182108_10267831	3300015300	Miscanthus Phyllosphere	VRNPWGRGVEESYDFDVTKLDKLFDFLLEKGHIKLPDNHVML
Ga0182108_10328442	3300015300	Miscanthus Phyllosphere	MVKFPNHWGKEVEESYDFDVTKSDKLCDLLLEKGHIKLSGNHVMLPPDQLKNKKF
Ga0182108_10421553	3300015300	Miscanthus Phyllosphere	MVPNPWEKEVEESYDFDVTKADKLFDFLLEKGQIKLPANHVILPSDQLKNKKFYK
Ga0182108_10436191	3300015300	Miscanthus Phyllosphere	MVPTPWGRGVEESYDFDVTKLDKLFDFLLEKGQIKLPDNHVMLPPDQLK
Ga0182108_10893582	3300015300	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFDVTKSDKLFDFLLEKGQIKLPNNHVMLPPN
Ga0182143_11029572	3300015302	Miscanthus Phyllosphere	MVPNPWKRGVKESYDFDVTKSDKLFDFLLEKGQIKLPDGHVMLP
Ga0182123_10277542	3300015303	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVMKSDKLFDSLLEKGQIKLPDNHVMLPLNN*
Ga0182123_10410001	3300015303	Miscanthus Phyllosphere	VMVPNPWGRGVEESYDFDVTKSNKLFDFLLEKGQIKLSDGHVMLPPD*
Ga0182123_10565393	3300015303	Miscanthus Phyllosphere	MVSNPSGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPANHVILPPDQMKNKKFYKFYN
Ga0182123_10605163	3300015303	Miscanthus Phyllosphere	EVEESYDFDVTKADTLFDFLLEKGQIKLPANHVILPPDQLKNKKFCK*
Ga0182123_10768871	3300015303	Miscanthus Phyllosphere	NPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNLVMLPPD*
Ga0182123_10805702	3300015303	Miscanthus Phyllosphere	MVPNPWERGVEERFDFDITKSDKLFDFLLEKGQIKLPDNHVMLPPDQLKNKKFCKFH
Ga0182123_10834901	3300015303	Miscanthus Phyllosphere	MVPNSWGKGVEESYDFDVTKLDKLFNFLLERGQIKLPANHV
Ga0182158_10688441	3300015305	Miscanthus Phyllosphere	MIEWNWGKKIVMVLNPWGKGVEESYDFDVTKSDKLFNFLLEKGQIKLPDGHVMLPLD*
Ga0182158_10806451	3300015305	Miscanthus Phyllosphere	MVSNPWERGVKESYDFDVTKSDNLFDFLLEKGQIKLPDGHV
Ga0182158_10870441	3300015305	Miscanthus Phyllosphere	RGVEESYDFDVTKSDKLFDFLLEREQIKLPTNHVMLPSD*
Ga0182158_10918991	3300015305	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDITKLDKLFDFLLEKGHIKLPDNHVMLPPDQLKNKKF*
Ga0182144_10226492	3300015307	Miscanthus Phyllosphere	MAPNPWGKGVEESYDFNIIKSDKLFDFLLERGHIK
Ga0182144_10477251	3300015307	Miscanthus Phyllosphere	MVPNPWGRRVEESYDFDVTKSDELFDFLLEKGQIKLPDNHVMLPLIN*
Ga0182144_10590351	3300015307	Miscanthus Phyllosphere	MSNPWGRGVEECYDFDVTKSDKLFDFLFEKGQIKLLN
Ga0182144_10716801	3300015307	Miscanthus Phyllosphere	MVLNPWGKEVEENYDFDVTKADKLFDFLLEKGQIKLPANHVILPPDQLKNKKF*
Ga0182142_10849902	3300015308	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFDVTKSDKLFDFLLERKQIKLPANHVMLPPD*
Ga0182142_10901352	3300015308	Miscanthus Phyllosphere	LGEGVEESYDFEVTKSDKLFDFLLEKGQIKLPTNHV
Ga0182142_11033852	3300015308	Miscanthus Phyllosphere	ESYDLDATKSDKLCDFLLKKGQIKLPDGHVMLPPD*
Ga0182142_11106863	3300015308	Miscanthus Phyllosphere	MVPNLWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLLNGHVMLPPD*
Ga0182140_10052011	3300015314	Miscanthus Phyllosphere	KKTVMVPNPWGRGVKESYDFDVTKLDKLFDFLLEKGQIKLPDGHVMLSPD*
Ga0182140_10289841	3300015314	Miscanthus Phyllosphere	MVPNPWGKVVEESYDFDITKLDKLFDFLLEKGQIKLSDNHV
Ga0182140_10808083	3300015314	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDGHVMLPPD*
Ga0182140_10953911	3300015314	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDITKSDKLFDFLLEKGQIKLPDGHVMLPP
Ga0182140_11032552	3300015314	Miscanthus Phyllosphere	MVMVSNPWERGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPP
Ga0182140_11120222	3300015314	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFDITKSDKLFDFLLEKGQIKLSDNHVMLPPDQLK
Ga0182140_11170481	3300015314	Miscanthus Phyllosphere	MVPNPWGRGVKESYDFDVTKSDKLFDFLLEKGQIKLP
Ga0182127_10654851	3300015321	Miscanthus Phyllosphere	MVPNPWGRGVKESYDFDVTKSDKLFDFLLEKGQIK
Ga0182127_10855813	3300015321	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLERGQIKLPDGHVMLPPD
Ga0182110_10642961	3300015322	Miscanthus Phyllosphere	PWGKEVEESYDFDVTKADKLFDFLLEKGQIKLPANHVILPPD*
Ga0182110_10853721	3300015322	Miscanthus Phyllosphere	VEESYDFDVTKSDKLFDFLLEKGQIKLLDNHVMLPLIS*
Ga0182110_10928372	3300015322	Miscanthus Phyllosphere	MVSNPWGKGVEESYDFDFTKLDKLFDFLLERGQIKLPANHV
Ga0182110_10932641	3300015322	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDG
Ga0182110_10981632	3300015322	Miscanthus Phyllosphere	MVSNPWGKGVEESYDFNVIKADKHFDFLLERGHIKLPANHVMLPPD*
Ga0182129_10804852	3300015323	Miscanthus Phyllosphere	MVPNPWRRGVEESYDFDVTKSDKLFDFLLEKGQIMLPAD*
Ga0182129_11069901	3300015323	Miscanthus Phyllosphere	MVSNSWGKGVEESYNFDVTKSDKLFDFLLEREQIKLPTNHVMLPLDQLKNKNFCK
Ga0182187_10741432	3300015341	Miscanthus Phyllosphere	MVPNPWEKGVEESYDFDVTKSDKLFNFLLEKGQIKLPANHVILPLD*
Ga0182187_11431181	3300015341	Miscanthus Phyllosphere	MVLNPWRGGVKESYDFDVTKLDKLFDFLLEKGQIKLPDNHVMLPPE*
Ga0182187_11809161	3300015341	Miscanthus Phyllosphere	MVSNPWGREVEESYDFDITKSNKLFDFLLERGQIKLLDNHVMLPPNQLKNK
Ga0182187_12016112	3300015341	Miscanthus Phyllosphere	MVPNPWGRGVEETYDFNITKLDKLFDFLLVKGQIKLPD
Ga0182109_10729343	3300015342	Miscanthus Phyllosphere	EESYDFDVTKSDKLFDFLLEKGQIKLSDNHVMLPPK*
Ga0182155_11659142	3300015343	Miscanthus Phyllosphere	MVPNPWKGGVEESYDFDVTKLDKLFDFLLQKGQIKLPDGHVM
Ga0182155_11902502	3300015343	Miscanthus Phyllosphere	MVPNPWGRGVGESYDFDVIKSDKLFDFLLEKGQIKLPNGHVMLPPD
Ga0182155_12142282	3300015343	Miscanthus Phyllosphere	MVPNPLGKGVEEIYDFDVTKSDKLFDFLLERGQIKMV
Ga0182189_10718671	3300015344	Miscanthus Phyllosphere	NPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPLNN*
Ga0182189_11392153	3300015344	Miscanthus Phyllosphere	MVPNPWKRGVKESYDFDVTKSDKLFDFLLEKGQIKLPDG
Ga0182189_11691061	3300015344	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPPEQ
Ga0182111_10781301	3300015345	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLKKGQIKLLDNHVMLPPDQLKNK
Ga0182111_10978793	3300015345	Miscanthus Phyllosphere	MVSNPWGIGVEESYDFDVTKSDKLFDLLLEKGQLKLPDNHVMLPPD*
Ga0182111_11795402	3300015345	Miscanthus Phyllosphere	VIVPNPWGKGVKESYDFNVTKSDKLFDFLLEKGQIKLS
Ga0182111_11811331	3300015345	Miscanthus Phyllosphere	MVPNPWGKGIEESYDFNVTKSDKLFDFLLEKGQIKLLDNHVML
Ga0182111_11979841	3300015345	Miscanthus Phyllosphere	MVPNPWGRGVKESYDFDVTKSDKLFDFLLEKGQIKLPDNHVML
Ga0182111_11990871	3300015345	Miscanthus Phyllosphere	MVPDPWGRGVEESYDFDVTKLDKLFDFLLEKGQIKLPDNHVML
Ga0182139_11171692	3300015346	Miscanthus Phyllosphere	VTVSNPWGKGVEENYDFDVTKSDKLFDFLLEKGQIKLP
Ga0182139_11260561	3300015346	Miscanthus Phyllosphere	EESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPLIS*
Ga0182139_11556671	3300015346	Miscanthus Phyllosphere	MMPNPWGKGVEESYDFDVTKSDKFFDFLLERGQIKLSVNHVMLP
Ga0182139_12434693	3300015346	Miscanthus Phyllosphere	MVPNPWGRGIEESYDFDVTKSDKLFDFLLEKGQI*
Ga0182177_10676383	3300015347	Miscanthus Phyllosphere	EESYDFDVTKLDKLFDFLLEKGQIKLPDNHVMLPPE*
Ga0182177_11864921	3300015347	Miscanthus Phyllosphere	WNWGKKTVMVPNPLGRGVEESYDFDVTKSDKLFEFLLEKGQIKLPYNHVMLPPK*
Ga0182161_10385541	3300015351	Miscanthus Phyllosphere	MVPNPWGKGLEESYDFDVIKSDKLFDFLLEKGHIKLPANHV
Ga0182161_11115261	3300015351	Miscanthus Phyllosphere	MILNPWGKEVEESYDFDVIKADKLFDFLLEKGQIKLPVNHVILPPD*
Ga0182161_11315431	3300015351	Miscanthus Phyllosphere	MVPYPWERGVEESYDFDITKSDKLFKFLLEKGLIKLPDNHVMLPPDQLKNKK
Ga0182161_11541801	3300015351	Miscanthus Phyllosphere	MVLNPWGRGVKESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPPEQ
Ga0182161_11920242	3300015351	Miscanthus Phyllosphere	MVMVPNPWGRGVEESYDFDITKSDKLFDFLLEKG*
Ga0182161_12685241	3300015351	Miscanthus Phyllosphere	KTVMVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGEIKLPDNHVMLPP*
Ga0182159_11333211	3300015355	Miscanthus Phyllosphere	MVPNPWEREVEESYDFNITKSDKLFDFLLEKGHIKLPNDHVMLPL
Ga0182159_11687963	3300015355	Miscanthus Phyllosphere	GKKTVMVLNPWGRGVEESYDFDVTKSDKLFNFLLEKGQIKLLDNHVMLPPE*
Ga0182159_12612711	3300015355	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPLNN*
Ga0182159_12868002	3300015355	Miscanthus Phyllosphere	MVPNLWEKGVEESYDFDITKLDKLFDFLLEKGQIKLPANHVILPLDQLKNK
Ga0182159_13005271	3300015355	Miscanthus Phyllosphere	MVPKPWGSGIEESYDFDVTKSDKLFDFLLEKGQIKLLDG
Ga0182159_13009731	3300015355	Miscanthus Phyllosphere	MVPNPWRKGVEESYNFDVTKSDKIFDFLLERGQIKLLASHVMLPPDQLKNKKFCKFH
Ga0182159_13134983	3300015355	Miscanthus Phyllosphere	MVLNPCGKGVEESYDFDVTKSDKIFDFLLEKGQIKLPANHVMLPPNQL*
Ga0182159_13306132	3300015355	Miscanthus Phyllosphere	MVSNPWGRGVEESYDFDVTKLDKLFDFLLEKGQIKLPNNHVMLPPE*
Ga0182159_13377411	3300015355	Miscanthus Phyllosphere	MVPNPWGKGAKESYDFDVTKSDKLFDFLLEKGQIKLPTNHVMLPPD*
Ga0182145_10898721	3300015361	Miscanthus Phyllosphere	MVPNPWGRGDEESYDFDVIKLDKLFDFLLERGQIKLLTNHVMLPLD*
Ga0182145_11902484	3300015361	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGEIKLPDNHV
Ga0182203_10761872	3300017404	Miscanthus Phyllosphere	MVLNPWGKEVEESCDFDIIKVDKPFDFLLEKGQIKLPANHVILPPDQLKI
Ga0182203_11082221	3300017404	Miscanthus Phyllosphere	MVPNPWGRGIEESYDFDVTKSDKLFDFLLEKGQIKLPD
Ga0182203_11335621	3300017404	Miscanthus Phyllosphere	MVPNPWRKEVEESYDFDITKADKLFDFLLEKGHIKLLTSLLNG
Ga0182220_10295161	3300017407	Miscanthus Phyllosphere	MVPNSWGKGIEESYYFGVTKSDKLFDFLLERGQIKLPPNHVMLPPD
Ga0182220_10528901	3300017407	Miscanthus Phyllosphere	MVQNPWGRAVEESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPLIS
Ga0182220_10638121	3300017407	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGHIKLPDGHVMLPPDQLK
Ga0182220_10938401	3300017407	Miscanthus Phyllosphere	MVLNPWGKRVEESYDFDVTKSDKLFNFLLERGQIKLPANHVILPPNQLKNKKFYKFH
Ga0182204_11048101	3300017409	Miscanthus Phyllosphere	GKEVEESYDFDVTKADKLFDFLLEKGQIKLPANHVILPPD
Ga0182204_11081511	3300017409	Miscanthus Phyllosphere	KKIVMMPNPWGRGIKESYDFDVIKSDKLFDFLLKKG
Ga0182204_11101781	3300017409	Miscanthus Phyllosphere	MVPNPWESGVKESYDFNVTKLDKLFDFLLEKGHIKLPNNHVMLPPDQLKNK
Ga0182207_11530613	3300017410	Miscanthus Phyllosphere	MVPNSWGKEVEESYDFDVTKTDKIFDSLLEKGQIKLPANHVILPPDQ
Ga0182207_11617701	3300017410	Miscanthus Phyllosphere	MVPNPWGKRVEESYDFGITKSDKLFNFLLERGQIKLPDNHVMLPP
Ga0182208_10142322	3300017411	Miscanthus Phyllosphere	GKKIVMVPNPWGRENEESYDFDITKANMLFDFLLEKGQIKLPANHVILPPD
Ga0182208_10613621	3300017411	Miscanthus Phyllosphere	MVPNSWGKGVEESYDFDVTKLDKLFDFLLERGQIKLPANNVMLPPNS
Ga0182208_10742521	3300017411	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEERQIKL
Ga0182208_11030511	3300017411	Miscanthus Phyllosphere	MVLNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKL
Ga0182208_11294901	3300017411	Miscanthus Phyllosphere	MVPNPWGRGVKESYDFDVTKSDKLFDFLLKKGQIKLPDNHVMLPPD
Ga0182222_10966901	3300017413	Miscanthus Phyllosphere	MVLNPWGKEVEKSYDFNVTKANKLFDFLLEKGQIKLPVNHVILPPDQLKNKKFCK
Ga0182222_11064961	3300017413	Miscanthus Phyllosphere	EVEESYDFDVTKADKLFDFLLEKGQIKLPANHVILPPD
Ga0182202_10710781	3300017415	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDFTKLDKLFDFLLEKGQIKLPDGHVMLPPD
Ga0182202_10912672	3300017415	Miscanthus Phyllosphere	MVLNPWGRGVEESYDFDVTKSDKLVDFLLEKGQIKLPDNHIMLPLI
Ga0182202_11126191	3300017415	Miscanthus Phyllosphere	MVLNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNH
Ga0182230_10840731	3300017417	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFEVTKLDKLFIFLLEKGHIKLPANHVMLPLD
Ga0182228_10860061	3300017420	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFDVIKSDKLFNFLLEKGQIKLLANHVM
Ga0182219_10542113	3300017424	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFNVTKSDMLFDFLLEKGHIKLPANHVILPPDQLKNKKFCKF
Ga0182219_11321432	3300017424	Miscanthus Phyllosphere	MVPNPWGRGVGESYDFDVMKSNKLFDFLLEKGQIKLL
Ga0182219_11391841	3300017424	Miscanthus Phyllosphere	MVPNPWEKGVEESYDFDVTKSDKLFDFLLEKGQIKFPN
Ga0182224_10880471	3300017425	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVIKSYKLFDFLLEKGQIKLLDNHVMLP
Ga0182224_11237541	3300017425	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKLDKLFDFLLEKGQIKLLDNHVMLP
Ga0182224_11281143	3300017425	Miscanthus Phyllosphere	MVPNPWGREVEDSYDFDVTKSDKFFDFLLEKVQIKLLDGHVM
Ga0182224_11543801	3300017425	Miscanthus Phyllosphere	MVPNPWGRGIKESYDFDVTKSDKLFDFLLEKGQIKLSDNH
Ga0182224_11616861	3300017425	Miscanthus Phyllosphere	VPNPWGREVEESYDFDVIKSNKLFDFLLERGQIKLPANYDMLPPDQLKN
Ga0182190_10629392	3300017427	Miscanthus Phyllosphere	MVSNLWGRGVENYDFDVTKLDKLFDVTKLDKLFDFLLEKGQIKLLDGHVMLPLIS
Ga0182190_10639191	3300017427	Miscanthus Phyllosphere	MVPNPWGRGIEESYDFDVTKSDKLFDFLLERGEIKLPANHVMLSPD
Ga0182190_10981663	3300017427	Miscanthus Phyllosphere	MVPNPWEKEVEESFDFDVTKADKIFDFLLEKGQIKLPANYVILPPY
Ga0182190_11070591	3300017427	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFDITKSDMLFDFLLERGHIKLPTNHVML
Ga0182190_11138521	3300017427	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKLDKLFDFLLEKGQIKLPN
Ga0182190_11487372	3300017427	Miscanthus Phyllosphere	KKTVMVPNPWGRGVEESYDFNVTKSDKLFNFLLEKGQIKLSDNHVMLPPD
Ga0182190_11579752	3300017427	Miscanthus Phyllosphere	MVPTPWGKGVEESYDFDVTKSDKLFDFLLEKGQIKLPANHVMLPPDQLKNKKFY
Ga0182192_10133715	3300017430	Miscanthus Phyllosphere	MVHNPWERGVEESYDFDVTKSDKLFDFLLEKGHIKLP
Ga0182192_11168412	3300017430	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFHVTKSYKLFNFLLEKGQIKLPNGHV
Ga0182192_11319072	3300017430	Miscanthus Phyllosphere	EWNWGKKTVMVPNPWERGVKESYDFDVTKLDKLFDFLLEKGQIKLPDNHIMLPPE
Ga0182192_11503112	3300017430	Miscanthus Phyllosphere	MVPNPWGRGIEESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPP
Ga0182206_11377701	3300017433	Miscanthus Phyllosphere	MAEWNWGKKTVMVSNPWGKGVEESYDFNVIKADKHFDFLLERGHIKLPANHVMLPPD
Ga0182209_10425152	3300017436	Miscanthus Phyllosphere	MVPNLWGRGVEESYDFDVTKSDKLFDFLLDKGQIKLPDGHVILPPDQLKNKKFCK
Ga0182209_11622732	3300017436	Miscanthus Phyllosphere	MVPNPWGRGVEESNDFDVIKSDKLFDFLLEKGQIKLLDNHVMLPPDQLKNKK
Ga0182191_10434961	3300017438	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPLNS
Ga0182191_11699971	3300017438	Miscanthus Phyllosphere	VIMPNPWGRGVEESYDFNVTKLDKLFDFLLEKGQIKLLDNHVMLP
Ga0182221_10688172	3300017442	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFDVTKSDKLFNFLLEKGQIKLPDN
Ga0182221_10803413	3300017442	Miscanthus Phyllosphere	MVPNPWGKGVEESCDFDVTKSDKLFDFLIERGHIKLPTNHVMLPPDQLKN
Ga0182221_10968751	3300017442	Miscanthus Phyllosphere	MVPNPWGKGVEESFDFDVTKLDKLFDFLLEKGQIQLPTNH
Ga0182221_11118451	3300017442	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFDVTKSDKLFDFLLERGHIKLPANHVMLPPDQ
Ga0182221_11286093	3300017442	Miscanthus Phyllosphere	MVSNRWGRGVKESYDFDVTKLDKLFDFLLEKGQIKLSDNHVML
Ga0182193_10446833	3300017443	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSDKLFDYLLEKGHIKLPDNHVMLPLIS
Ga0182193_10548801	3300017443	Miscanthus Phyllosphere	MVQNPWGKGVEESYDFDVTKLDKLFDFFLEKGYVKLPAIMSYYPQIS
Ga0182193_11183961	3300017443	Miscanthus Phyllosphere	MVTNPWGRGVKESYDFDVTKSDKLFDFLLEKGQIKLPDGHVMLPLIC
Ga0182193_11615901	3300017443	Miscanthus Phyllosphere	PWGKEVEESYDFDVTKADKLFDFLLEKGQIKLPNNRVILPPD
Ga0182193_11895541	3300017443	Miscanthus Phyllosphere	MVPNPWGRGVKESYDFDVTKLDKLFDFLLEKGQIKLPDNHVMLPL
Ga0182233_10816844	3300017680	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFNVTKLNKLFDFLLEKGQIKLLD
Ga0182226_10556112	3300017681	Miscanthus Phyllosphere	MVLDPCGRGVEESYDFDVTKSDKLFDFLLEKGQIKLLDNHIMLPPEQLKNKK
Ga0182226_10754371	3300017681	Miscanthus Phyllosphere	MVPNPWGKEVEESYDFDVTKADKLFDFLLKKGQIKLPTNHVMLPLD
Ga0182226_11178152	3300017681	Miscanthus Phyllosphere	EWNWGKKTVMVPNPWGRGVEESYDFDVTKLDKLFDFLLEKGQIKLPDGHVMLPLIS
Ga0182229_10508743	3300017682	Miscanthus Phyllosphere	MVSNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPNNHVMLPPE
Ga0182229_10783471	3300017682	Miscanthus Phyllosphere	MVPNPWGRGIEESYDFDVTKSDKLFDFLLEKGQIKLL
Ga0182229_10818052	3300017682	Miscanthus Phyllosphere	MVPNPWGIGVEESYDFDITKSDKLFDFLLEKGQIKLPDGHVMLPPD
Ga0182218_11056542	3300017683	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFNITKSDKLFDFLLEKGQIKLPANHVMLPPDHLRNKKFCKF
Ga0182218_11466371	3300017683	Miscanthus Phyllosphere	MVPNPWGRGVEESFNFDITKSDKLFDFLIEKGQIKLSDNHVVLPPDQLKNKKYCKFYNAASH
Ga0182218_11492152	3300017683	Miscanthus Phyllosphere	MVPNPWGRGVEESYDFDVTKSNKLFDFLLEKGQIKLPDGHVMLPPDQLK
Ga0182225_10292251	3300017684	Miscanthus Phyllosphere	VPSPWGKEENYDFDVTKADKLFDFLLDKGQIKLLANYVKLLPEELKHKKF
Ga0182225_10714411	3300017684	Miscanthus Phyllosphere	MVPNPWGKRVEESYDFDVTKTDKLFNFLLEMGQIKLLDNHVM
Ga0182227_10441431	3300017685	Miscanthus Phyllosphere	LGRGIEERYDFDVTKPDKLFDFLLERGQIKLPTNHVMLPPNQ
Ga0182227_10519653	3300017685	Miscanthus Phyllosphere	MVPNPWGKEVEESCDFDILKVDKPFDFLLKKGQIKLPANHVILPPDQLKNKFCK
Ga0182227_10980531	3300017685	Miscanthus Phyllosphere	TVMVLNPWGRGVEESYDFDVMKSDKLFDFLLEKGQIKLPDNHVMLPLIS
Ga0182227_11067332	3300017685	Miscanthus Phyllosphere	MMLNPWGSGVKESYDFDVTKSNKLFDFLLEKGQIKLPDNHVMLPLEQLK
Ga0182205_10588362	3300017686	Miscanthus Phyllosphere	WGKKTVMVPNPWGRGVKESYAFDVTKLDKLFDFLLEKGQIKLPDNHVMLPPE
Ga0182205_11231031	3300017686	Miscanthus Phyllosphere	PWGRGVKESYDFDVPKSDKLFDFLLEKGHIKLPNNHVLLPPDQ
Ga0182205_11358752	3300017686	Miscanthus Phyllosphere	DCMELGKKTVMVPNPWGRGVEESYDFDVTKLDKLFDFLLKKGHIKLPDGHVMLSLD
Ga0182205_11388631	3300017686	Miscanthus Phyllosphere	MVPNPLGRGIEESYDFDVTKSDKLFDFLLEKGQIKLSDNHVMLP
Ga0182231_10606951	3300017689	Miscanthus Phyllosphere	MVPNPWGKGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNHVMLPPDQLKNK
Ga0182231_10932672	3300017689	Miscanthus Phyllosphere	MPNPWGRGIEESYDYDVTKLDKLFDFLLEKGQIKLPDNHVMLPP
Ga0182223_11121521	3300017690	Miscanthus Phyllosphere	MVPNSWGRGVEESYDFDVTKLDRLFDFLLEKGQIKLLDNHVMLPLIS
Ga0207709_116864153	3300025935	Miscanthus Rhizosphere	MVPNPWGRGVEESYDFDVTKSDKLFDFLLEKGQIKLPDNHV
Ga0207689_114873052	3300025942	Miscanthus Rhizosphere	MVSNPWGRGIEESYDFDVTKSYKLFDFLLEKGQIKLP
Ga0207677_108936922	3300026023	Miscanthus Rhizosphere	MILNPWGKEVEESYDFDVIKADKLFNLLLKKGQIKLPANHVIL
Ga0207683_117912342	3300026121	Miscanthus Rhizosphere	LGKRVEESYDFDVIKSDKLFDFLLEKGQIKLPDNHV

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.32
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.32
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F018311

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign