| Basic Information | |
|---|---|
| Family ID | F018274 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 236 |
| Average Sequence Length | 42 residues |
| Representative Sequence | NTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 236 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 37.44 % |
| % of genes near scaffold ends (potentially truncated) | 41.53 % |
| % of genes from short scaffolds (< 2000 bps) | 74.15 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.559 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil (13.983 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.864 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.119 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.43% β-sheet: 17.14% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 236 Family Scaffolds |
|---|---|---|
| PF00378 | ECH_1 | 3.81 |
| PF13602 | ADH_zinc_N_2 | 3.81 |
| PF00440 | TetR_N | 2.97 |
| PF00106 | adh_short | 2.54 |
| PF00589 | Phage_integrase | 2.12 |
| PF07786 | HGSNAT_cat | 1.69 |
| PF12697 | Abhydrolase_6 | 1.69 |
| PF13561 | adh_short_C2 | 1.27 |
| PF13460 | NAD_binding_10 | 1.27 |
| PF07883 | Cupin_2 | 1.27 |
| PF08240 | ADH_N | 1.27 |
| PF00069 | Pkinase | 0.85 |
| PF09828 | Chrome_Resist | 0.85 |
| PF13414 | TPR_11 | 0.85 |
| PF13495 | Phage_int_SAM_4 | 0.85 |
| PF07992 | Pyr_redox_2 | 0.85 |
| PF12706 | Lactamase_B_2 | 0.85 |
| PF08592 | Anthrone_oxy | 0.85 |
| PF00561 | Abhydrolase_1 | 0.85 |
| PF01594 | AI-2E_transport | 0.85 |
| PF14087 | DUF4267 | 0.42 |
| PF04073 | tRNA_edit | 0.42 |
| PF13340 | DUF4096 | 0.42 |
| PF01862 | PvlArgDC | 0.42 |
| PF00753 | Lactamase_B | 0.42 |
| PF07298 | NnrU | 0.42 |
| PF01638 | HxlR | 0.42 |
| PF08031 | BBE | 0.42 |
| PF02954 | HTH_8 | 0.42 |
| PF05199 | GMC_oxred_C | 0.42 |
| PF00903 | Glyoxalase | 0.42 |
| PF01546 | Peptidase_M20 | 0.42 |
| PF01041 | DegT_DnrJ_EryC1 | 0.42 |
| PF07859 | Abhydrolase_3 | 0.42 |
| PF00702 | Hydrolase | 0.42 |
| PF05977 | MFS_3 | 0.42 |
| PF03793 | PASTA | 0.42 |
| PF07732 | Cu-oxidase_3 | 0.42 |
| PF03458 | Gly_transporter | 0.42 |
| PF13185 | GAF_2 | 0.42 |
| PF03061 | 4HBT | 0.42 |
| PF00891 | Methyltransf_2 | 0.42 |
| PF02036 | SCP2 | 0.42 |
| PF00135 | COesterase | 0.42 |
| PF08818 | DUF1801 | 0.42 |
| PF14552 | Tautomerase_2 | 0.42 |
| PF04191 | PEMT | 0.42 |
| PF01431 | Peptidase_M13 | 0.42 |
| PF06537 | DHOR | 0.42 |
| PF00248 | Aldo_ket_red | 0.42 |
| PF07366 | SnoaL | 0.42 |
| PF03466 | LysR_substrate | 0.42 |
| PF13847 | Methyltransf_31 | 0.42 |
| PF00196 | GerE | 0.42 |
| PF00149 | Metallophos | 0.42 |
| PF12680 | SnoaL_2 | 0.42 |
| PF06912 | DUF1275 | 0.42 |
| PF04389 | Peptidase_M28 | 0.42 |
| PF05694 | SBP56 | 0.42 |
| PF13372 | Alginate_exp | 0.42 |
| PF16640 | Big_3_5 | 0.42 |
| PF02321 | OEP | 0.42 |
| PF02518 | HATPase_c | 0.42 |
| PF00171 | Aldedh | 0.42 |
| PF00474 | SSF | 0.42 |
| PF01545 | Cation_efflux | 0.42 |
| PF06114 | Peptidase_M78 | 0.42 |
| PF00343 | Phosphorylase | 0.42 |
| PF13432 | TPR_16 | 0.42 |
| PF00078 | RVT_1 | 0.42 |
| PF02423 | OCD_Mu_crystall | 0.42 |
| PF04542 | Sigma70_r2 | 0.42 |
| PF00027 | cNMP_binding | 0.42 |
| PF00271 | Helicase_C | 0.42 |
| PF13517 | FG-GAP_3 | 0.42 |
| PF02776 | TPP_enzyme_N | 0.42 |
| PF14534 | DUF4440 | 0.42 |
| PF13683 | rve_3 | 0.42 |
| PF12704 | MacB_PCD | 0.42 |
| PF14026 | DUF4242 | 0.42 |
| PF02416 | TatA_B_E | 0.42 |
| PF02899 | Phage_int_SAM_1 | 0.42 |
| PF00072 | Response_reg | 0.42 |
| PF11066 | DUF2867 | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 236 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.39 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 1.69 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.85 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.42 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.42 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.42 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.42 |
| COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 0.42 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.42 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.42 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.42 |
| COG3619 | Uncharacterized membrane protein YoaK, UPF0700 family | Function unknown [S] | 0.42 |
| COG1945 | Pyruvoyl-dependent arginine decarboxylase | Amino acid transport and metabolism [E] | 0.42 |
| COG4094 | Uncharacterized membrane protein | Function unknown [S] | 0.42 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.42 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.42 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.42 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.42 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.42 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.42 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.42 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.42 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.42 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.42 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.42 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.42 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.42 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.42 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.42 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.42 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.42 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.42 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.42 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.42 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.42 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.42 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.42 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.42 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.56 % |
| Unclassified | root | N/A | 11.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001087|JGI12677J13195_1002876 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300001867|JGI12627J18819_10030078 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
| 3300001867|JGI12627J18819_10345665 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10027381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2051 | Open in IMG/M |
| 3300004267|Ga0066396_10021380 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300005178|Ga0066688_10251435 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300005332|Ga0066388_101513211 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300005332|Ga0066388_105978499 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005332|Ga0066388_106922908 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005347|Ga0070668_102185042 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005436|Ga0070713_100167405 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300005439|Ga0070711_100002202 | All Organisms → cellular organisms → Bacteria | 11062 | Open in IMG/M |
| 3300005445|Ga0070708_100002781 | All Organisms → cellular organisms → Bacteria | 13589 | Open in IMG/M |
| 3300005445|Ga0070708_100002971 | All Organisms → cellular organisms → Bacteria | 13175 | Open in IMG/M |
| 3300005445|Ga0070708_101242212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300005467|Ga0070706_100233883 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300005468|Ga0070707_101703300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300005533|Ga0070734_10002039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 26423 | Open in IMG/M |
| 3300005538|Ga0070731_10004191 | All Organisms → cellular organisms → Bacteria | 12541 | Open in IMG/M |
| 3300005541|Ga0070733_10748432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300005542|Ga0070732_10136129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1459 | Open in IMG/M |
| 3300005542|Ga0070732_10765111 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005542|Ga0070732_10868124 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005545|Ga0070695_100178999 | Not Available | 1501 | Open in IMG/M |
| 3300005556|Ga0066707_10105997 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300005569|Ga0066705_10089710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1810 | Open in IMG/M |
| 3300005764|Ga0066903_100046914 | All Organisms → cellular organisms → Bacteria | 5197 | Open in IMG/M |
| 3300005764|Ga0066903_108637907 | Not Available | 518 | Open in IMG/M |
| 3300005843|Ga0068860_101177849 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300006041|Ga0075023_100238757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 720 | Open in IMG/M |
| 3300006052|Ga0075029_100734152 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006086|Ga0075019_10258070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1042 | Open in IMG/M |
| 3300006162|Ga0075030_100003047 | All Organisms → cellular organisms → Bacteria | 15268 | Open in IMG/M |
| 3300006163|Ga0070715_10312154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
| 3300006173|Ga0070716_100217196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1282 | Open in IMG/M |
| 3300006173|Ga0070716_100757065 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300006174|Ga0075014_100607360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 626 | Open in IMG/M |
| 3300006175|Ga0070712_101471696 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006797|Ga0066659_11907417 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006806|Ga0079220_12134389 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006954|Ga0079219_10375570 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300009012|Ga0066710_100232516 | All Organisms → cellular organisms → Bacteria | 2653 | Open in IMG/M |
| 3300009162|Ga0075423_12034971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300009520|Ga0116214_1143377 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300009545|Ga0105237_11090739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300009700|Ga0116217_10222045 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1235 | Open in IMG/M |
| 3300009764|Ga0116134_1357840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300009792|Ga0126374_10015235 | All Organisms → cellular organisms → Bacteria | 3196 | Open in IMG/M |
| 3300009792|Ga0126374_10380336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
| 3300010043|Ga0126380_11098402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300010048|Ga0126373_10685383 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300010048|Ga0126373_11308960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 790 | Open in IMG/M |
| 3300010048|Ga0126373_11421333 | Not Available | 759 | Open in IMG/M |
| 3300010048|Ga0126373_13201477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300010358|Ga0126370_10613618 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → unclassified Cytophagaceae → Cytophagaceae bacterium | 941 | Open in IMG/M |
| 3300010360|Ga0126372_10016201 | All Organisms → cellular organisms → Bacteria | 4224 | Open in IMG/M |
| 3300010361|Ga0126378_10073085 | All Organisms → cellular organisms → Bacteria | 3293 | Open in IMG/M |
| 3300010361|Ga0126378_10712060 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300010361|Ga0126378_11418576 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 786 | Open in IMG/M |
| 3300010361|Ga0126378_11955028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300010361|Ga0126378_12731244 | Not Available | 564 | Open in IMG/M |
| 3300010361|Ga0126378_12775856 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 559 | Open in IMG/M |
| 3300010362|Ga0126377_10419548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1354 | Open in IMG/M |
| 3300010366|Ga0126379_11324710 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300010366|Ga0126379_11996080 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300010375|Ga0105239_10485566 | Not Available | 1404 | Open in IMG/M |
| 3300010376|Ga0126381_100017846 | All Organisms → cellular organisms → Bacteria | 8221 | Open in IMG/M |
| 3300010376|Ga0126381_105064389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300010376|Ga0126381_105074499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300010379|Ga0136449_100290601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2991 | Open in IMG/M |
| 3300010379|Ga0136449_100661218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1763 | Open in IMG/M |
| 3300010398|Ga0126383_11925347 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300010398|Ga0126383_12320497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300012202|Ga0137363_11332813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300012211|Ga0137377_10135942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2350 | Open in IMG/M |
| 3300012211|Ga0137377_10868771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300012685|Ga0137397_11314155 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012918|Ga0137396_10009704 | All Organisms → cellular organisms → Bacteria | 5848 | Open in IMG/M |
| 3300014151|Ga0181539_1159378 | Not Available | 894 | Open in IMG/M |
| 3300014497|Ga0182008_10606091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300015357|Ga0134072_10054720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
| 3300015374|Ga0132255_101562943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 999 | Open in IMG/M |
| 3300016371|Ga0182034_10851731 | Not Available | 782 | Open in IMG/M |
| 3300017822|Ga0187802_10103024 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300017926|Ga0187807_1055648 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300017927|Ga0187824_10052717 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300017928|Ga0187806_1341619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300017928|Ga0187806_1378093 | Not Available | 509 | Open in IMG/M |
| 3300017932|Ga0187814_10115257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 994 | Open in IMG/M |
| 3300017932|Ga0187814_10194434 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300017933|Ga0187801_10129441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 973 | Open in IMG/M |
| 3300017937|Ga0187809_10215384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300017943|Ga0187819_10099153 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300017943|Ga0187819_10271404 | Not Available | 990 | Open in IMG/M |
| 3300017943|Ga0187819_10296394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300017955|Ga0187817_10086360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1965 | Open in IMG/M |
| 3300017955|Ga0187817_10860681 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300017955|Ga0187817_10909240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300017955|Ga0187817_10964812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300017961|Ga0187778_10018658 | All Organisms → cellular organisms → Bacteria | 4255 | Open in IMG/M |
| 3300017970|Ga0187783_10003964 | All Organisms → cellular organisms → Bacteria | 10946 | Open in IMG/M |
| 3300017970|Ga0187783_10059021 | All Organisms → cellular organisms → Bacteria | 2829 | Open in IMG/M |
| 3300017970|Ga0187783_10188681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1516 | Open in IMG/M |
| 3300017970|Ga0187783_10802822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 679 | Open in IMG/M |
| 3300017970|Ga0187783_11054882 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300017970|Ga0187783_11225283 | Not Available | 541 | Open in IMG/M |
| 3300017972|Ga0187781_10018253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4917 | Open in IMG/M |
| 3300017972|Ga0187781_10025800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4067 | Open in IMG/M |
| 3300017972|Ga0187781_10120696 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
| 3300017972|Ga0187781_10262198 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300017972|Ga0187781_10727649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 718 | Open in IMG/M |
| 3300017972|Ga0187781_11155125 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300017973|Ga0187780_10629225 | Not Available | 771 | Open in IMG/M |
| 3300017974|Ga0187777_11442542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300017975|Ga0187782_10210089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1457 | Open in IMG/M |
| 3300017975|Ga0187782_11246532 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300017996|Ga0187891_1118262 | Not Available | 978 | Open in IMG/M |
| 3300018002|Ga0187868_1109707 | Not Available | 1053 | Open in IMG/M |
| 3300018006|Ga0187804_10111556 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300018007|Ga0187805_10359428 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300018007|Ga0187805_10525959 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300018012|Ga0187810_10140726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300018012|Ga0187810_10247970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300018062|Ga0187784_10189396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 1680 | Open in IMG/M |
| 3300018085|Ga0187772_10055911 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
| 3300018085|Ga0187772_11094073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300018085|Ga0187772_11478630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300018086|Ga0187769_11310620 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300019082|Ga0187852_1156965 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300020581|Ga0210399_10041764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica | 3675 | Open in IMG/M |
| 3300020583|Ga0210401_10032831 | All Organisms → cellular organisms → Bacteria | 4941 | Open in IMG/M |
| 3300020583|Ga0210401_10044935 | All Organisms → cellular organisms → Bacteria | 4178 | Open in IMG/M |
| 3300020583|Ga0210401_10306400 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300021046|Ga0215015_10077977 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300021088|Ga0210404_10074735 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300021088|Ga0210404_10432965 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300021170|Ga0210400_10427980 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300021180|Ga0210396_10009228 | All Organisms → cellular organisms → Bacteria | 9335 | Open in IMG/M |
| 3300021407|Ga0210383_11167157 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300021420|Ga0210394_11521045 | Not Available | 565 | Open in IMG/M |
| 3300021432|Ga0210384_11542195 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300021474|Ga0210390_10198173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1698 | Open in IMG/M |
| 3300021478|Ga0210402_10253421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1625 | Open in IMG/M |
| 3300021478|Ga0210402_10714294 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300021479|Ga0210410_10000403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 50172 | Open in IMG/M |
| 3300021479|Ga0210410_10293115 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300021559|Ga0210409_10036302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4699 | Open in IMG/M |
| 3300021560|Ga0126371_10185911 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300021560|Ga0126371_12199387 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300021560|Ga0126371_12483586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300021560|Ga0126371_13415242 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300022717|Ga0242661_1076348 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300023090|Ga0224558_1013467 | All Organisms → cellular organisms → Bacteria | 4675 | Open in IMG/M |
| 3300025898|Ga0207692_10927596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300025910|Ga0207684_10115394 | All Organisms → cellular organisms → Bacteria | 2300 | Open in IMG/M |
| 3300025910|Ga0207684_10180735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1819 | Open in IMG/M |
| 3300025910|Ga0207684_11299665 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300025914|Ga0207671_10956097 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300025915|Ga0207693_10061483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2941 | Open in IMG/M |
| 3300025922|Ga0207646_11184789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300025928|Ga0207700_10238684 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300025939|Ga0207665_11244447 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300026489|Ga0257160_1054663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300026538|Ga0209056_10708691 | Not Available | 509 | Open in IMG/M |
| 3300026540|Ga0209376_1270906 | Not Available | 707 | Open in IMG/M |
| 3300026548|Ga0209161_10026122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4106 | Open in IMG/M |
| 3300027050|Ga0209325_1013606 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300027050|Ga0209325_1027361 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300027071|Ga0209214_1000301 | All Organisms → cellular organisms → Bacteria | 3188 | Open in IMG/M |
| 3300027266|Ga0209215_1000946 | All Organisms → cellular organisms → Bacteria | 2888 | Open in IMG/M |
| 3300027371|Ga0209418_1004311 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300027376|Ga0209004_1073966 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300027548|Ga0209523_1000243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5259 | Open in IMG/M |
| 3300027548|Ga0209523_1064981 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300027783|Ga0209448_10003335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 4966 | Open in IMG/M |
| 3300027826|Ga0209060_10039976 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
| 3300027842|Ga0209580_10076467 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300027842|Ga0209580_10578075 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300027908|Ga0209006_11471465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300027910|Ga0209583_10206815 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300027911|Ga0209698_10005456 | All Organisms → cellular organisms → Bacteria | 13740 | Open in IMG/M |
| 3300030706|Ga0310039_10233278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300030707|Ga0310038_10131340 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1268 | Open in IMG/M |
| 3300031018|Ga0265773_1037800 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031545|Ga0318541_10110359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1485 | Open in IMG/M |
| 3300031708|Ga0310686_100123539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300031715|Ga0307476_10027011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3783 | Open in IMG/M |
| 3300031715|Ga0307476_10146438 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300031715|Ga0307476_10561123 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300031715|Ga0307476_10706477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300031718|Ga0307474_10054474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 2956 | Open in IMG/M |
| 3300031718|Ga0307474_10371540 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300031718|Ga0307474_10733833 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300031720|Ga0307469_11181441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300031753|Ga0307477_10040744 | All Organisms → cellular organisms → Bacteria | 3189 | Open in IMG/M |
| 3300031753|Ga0307477_10233656 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300031753|Ga0307477_10742311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300031753|Ga0307477_10743656 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031754|Ga0307475_10120322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2067 | Open in IMG/M |
| 3300031754|Ga0307475_10199404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1600 | Open in IMG/M |
| 3300031754|Ga0307475_10460833 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300031754|Ga0307475_11438253 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031820|Ga0307473_10741510 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300031820|Ga0307473_10860334 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031820|Ga0307473_11502093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300031823|Ga0307478_10229783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1501 | Open in IMG/M |
| 3300031954|Ga0306926_10246512 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
| 3300031962|Ga0307479_10067030 | All Organisms → cellular organisms → Bacteria | 3462 | Open in IMG/M |
| 3300031962|Ga0307479_10096800 | All Organisms → cellular organisms → Bacteria | 2865 | Open in IMG/M |
| 3300031962|Ga0307479_10213999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1899 | Open in IMG/M |
| 3300031962|Ga0307479_10406942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1345 | Open in IMG/M |
| 3300031962|Ga0307479_11068092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300032076|Ga0306924_12255900 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300032174|Ga0307470_11505946 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032180|Ga0307471_100029267 | All Organisms → cellular organisms → Bacteria | 4210 | Open in IMG/M |
| 3300032180|Ga0307471_100749517 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300032205|Ga0307472_100571841 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300032205|Ga0307472_100736241 | Not Available | 892 | Open in IMG/M |
| 3300032829|Ga0335070_10001783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 24992 | Open in IMG/M |
| 3300032829|Ga0335070_11129696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 720 | Open in IMG/M |
| 3300032892|Ga0335081_10341627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 1957 | Open in IMG/M |
| 3300032898|Ga0335072_11290871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300033402|Ga0326728_10070619 | All Organisms → cellular organisms → Bacteria | 4644 | Open in IMG/M |
| 3300033402|Ga0326728_10729721 | Not Available | 737 | Open in IMG/M |
| 3300033402|Ga0326728_10748410 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300033977|Ga0314861_0001483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 30148 | Open in IMG/M |
| 3300033977|Ga0314861_0014553 | All Organisms → cellular organisms → Bacteria | 5287 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 13.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 9.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.32% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 9.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.51% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.27% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.27% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.42% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.42% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001087 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12677J13195_10028761 | 3300001087 | Forest Soil | YHRFRLGHESLDVTLAYLKGKDAESEEEEAQEHANSSSLALYA* |
| JGI12627J18819_100300782 | 3300001867 | Forest Soil | VNTIRIRLGHESLDVTLAYLKGKDDKSEEAQEHANSSSLALYA* |
| JGI12627J18819_103456652 | 3300001867 | Forest Soil | MKTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| JGIcombinedJ51221_100273812 | 3300003505 | Forest Soil | MMSLHVESLDVTLAYLKGKDAESEEAQEHANSSSLARYA* |
| Ga0066396_100213801 | 3300004267 | Tropical Forest Soil | EEGVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0066688_102514352 | 3300005178 | Soil | MKTIRIRESLDVTLAYLKGKDAESEKAQERANSSSLALYA* |
| Ga0066388_1015132113 | 3300005332 | Tropical Forest Soil | NGMNPFGHESLDVTLAYMKGKDAESEEAQEHANSSSLALYA* |
| Ga0066388_1033596902 | 3300005332 | Tropical Forest Soil | GCPARRESFDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0066388_1059784992 | 3300005332 | Tropical Forest Soil | EEGISVNTIRIRLGHESLDVTLADLKGKDTESEEAQEHANSSSLALYA* |
| Ga0066388_1069229081 | 3300005332 | Tropical Forest Soil | LHEEGVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALCD* |
| Ga0070668_1021850421 | 3300005347 | Switchgrass Rhizosphere | MTTIRIRLGHESLDVTLAFLKGKDAESEEAQEHANSSLALYA* |
| Ga0070713_1001674052 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VNTIRIRLGHESLDVTLAYLKGKDAEFEEAQEHASSNSSAFYA* |
| Ga0070711_1000022028 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSGSQNRR* |
| Ga0070708_10000278118 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0070708_1000029719 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTIRIRLGHESLDVPLAYLNGKDAESEEAPEDANSLAV* |
| Ga0070708_1012422121 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VEWPCVRTIRIRLGHESLDVTLSYLKGKDAESAGAQEHANRSSLALYA* |
| Ga0070706_1002338832 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTIRIRVGHESLDVTLAYLKGKDAESEEAQERANSSRQNGR* |
| Ga0070707_1017033002 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0070734_1000203924 | 3300005533 | Surface Soil | MNTIRIRVGHESLDVTLAYLKGKDAESEEAQERANSSSQNGR* |
| Ga0070731_1000419113 | 3300005538 | Surface Soil | LHLRAAKSLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0070733_107484321 | 3300005541 | Surface Soil | LAIRDVRTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0070732_101361292 | 3300005542 | Surface Soil | HESLDVTLAYLKGKDPESEEAQEHANSSSLALYA* |
| Ga0070732_107651111 | 3300005542 | Surface Soil | HESLDVTLAYFKCKDAESEEAQEHANSSSLALYA* |
| Ga0070732_108681241 | 3300005542 | Surface Soil | DSVYGTGVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0070695_1001789991 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VKTIRIRLGHESLDVMLAYLNGKDAESEEAQEHANSSSLALYPKS* |
| Ga0066707_101059971 | 3300005556 | Soil | MHRSCHAKRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0066705_100897103 | 3300005569 | Soil | VNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANGRCLALSA* |
| Ga0066903_1000469141 | 3300005764 | Tropical Forest Soil | IRFRIGNEIGGRDLAYLKGKDAESEETRERANSNSLALYA* |
| Ga0066903_1086379072 | 3300005764 | Tropical Forest Soil | MACECYRGESRDLALAYFKGKDAESEKAQEHANSSSLAQYA* |
| Ga0068860_1011778491 | 3300005843 | Switchgrass Rhizosphere | VRVKTIRIRLGHESLDVMLAYLNGKDAESEEAQEHANSSSLALYPKS* |
| Ga0075023_1002387571 | 3300006041 | Watersheds | MSTIRIRLGHESLDVTLAYLKGKGAESEEAREHANSSSLALYA* |
| Ga0075029_1007341522 | 3300006052 | Watersheds | LTKVASINTIRIRLGHESLDVTLGYLKGKDAESEEAQEHANKSSLAQYA* |
| Ga0075019_102580701 | 3300006086 | Watersheds | IRLGHESLDVTLAYLKSKHAESEEAQEHANSGSPALYA* |
| Ga0075030_1000030479 | 3300006162 | Watersheds | LTKSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQKHANSSSLALYA* |
| Ga0070715_103121542 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSGSQNR |
| Ga0070716_1002171963 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0070716_1007570652 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DINTIRIRLEHESLDVTHAYLKGKDAESEEAQEHANSSSLAVYA* |
| Ga0075014_1006073602 | 3300006174 | Watersheds | YQNPWLDVTLAYLKSKHAESEEAQEHANSGSPALYA* |
| Ga0070712_1014716961 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LQIRVSHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0066659_119074172 | 3300006797 | Soil | MKTIRIRESLDVTLAYLKGKDAESEEAQERANGSSLALYA* |
| Ga0079220_121343892 | 3300006806 | Agricultural Soil | MSTILIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALHA* |
| Ga0079219_103755701 | 3300006954 | Agricultural Soil | MNTIRIRVGHESLDVTLAYLKGKDAESEEAQERANSS |
| Ga0066710_1002325167 | 3300009012 | Grasslands Soil | MHRSCHAKRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0075423_120349712 | 3300009162 | Populus Rhizosphere | LGHESLDVTLVYLKGKDAELEEAQEHANSSSLAVYA* |
| Ga0116214_11433773 | 3300009520 | Peatlands Soil | LGHESLDVTLAYLKGKDAESEEAQEHANSSSLSLYA* |
| Ga0105237_110907391 | 3300009545 | Corn Rhizosphere | RLGHESLDVMLAYLNGKDAESEEAQEHANSSSLALYPKS* |
| Ga0116217_102220452 | 3300009700 | Peatlands Soil | VLGHESLDVRLAYLKGKDAESEEAQEHANSSSLAFYA* |
| Ga0116134_13578401 | 3300009764 | Peatland | LHEEGVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0126374_100152354 | 3300009792 | Tropical Forest Soil | HEEGVFVNTIRTRLGHESLDVTLAYLKGKDAESVKAQEHANSSSLALYA* |
| Ga0126374_103803362 | 3300009792 | Tropical Forest Soil | LKEGVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0126380_110984022 | 3300010043 | Tropical Forest Soil | LKEGVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHAN |
| Ga0126373_106853832 | 3300010048 | Tropical Forest Soil | LPQSSESLGATLAYLKDKDAESEEAQEHANSSNVALYA* |
| Ga0126373_113089602 | 3300010048 | Tropical Forest Soil | MWIARNQPRHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0126373_114213331 | 3300010048 | Tropical Forest Soil | LGHESLDVTLAYLKGKDAESEGAQEHANSSTLALYA* |
| Ga0126373_132014772 | 3300010048 | Tropical Forest Soil | VNTIRIRVGHESLDVTLAYLKGKDAESEEAKEHANSSSLALYA* |
| Ga0126370_106136182 | 3300010358 | Tropical Forest Soil | MENLRIGRGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0126372_100162015 | 3300010360 | Tropical Forest Soil | MKSLDLTLAYLKGKDAESEEAQEHANTSSLALYA* |
| Ga0126378_100730854 | 3300010361 | Tropical Forest Soil | MSAMRRLATTIRIRLGHESLDVTLAYVKGKDAESKEAQEHANSSSLAQYA* |
| Ga0126378_107120602 | 3300010361 | Tropical Forest Soil | LGHESQQVTLAYLNGKDAESEEAQERANSSSLALYA* |
| Ga0126378_114185761 | 3300010361 | Tropical Forest Soil | MDRFQARSNHDSLDVTLAYLKGKDAESEEAQELANSSSLALYA* |
| Ga0126378_119550281 | 3300010361 | Tropical Forest Soil | MNTIPIRLGHESLDVTIAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0126378_127312442 | 3300010361 | Tropical Forest Soil | VQRPPGNRLGYESLHMSIAYLKGKDAEAADAQEHANSRSGLALYA* |
| Ga0126378_127758561 | 3300010361 | Tropical Forest Soil | GVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0126377_104195481 | 3300010362 | Tropical Forest Soil | MLRREPLDVNFAYVKGKDAESEEAQEHANSSGLALYA* |
| Ga0126379_113247103 | 3300010366 | Tropical Forest Soil | QEQWFRRHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0126379_119960802 | 3300010366 | Tropical Forest Soil | FRSFLLRSVSHESLDVTLAYLKGKDAESEEAQEHANSTSLALYA* |
| Ga0105239_104855662 | 3300010375 | Corn Rhizosphere | KTIRIRLGHESLDVMLAYLNGKDAESEEAQEHANSSSLALYPKS* |
| Ga0126381_10001784612 | 3300010376 | Tropical Forest Soil | LSNKEDHQEQWFRRHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0126381_1050643891 | 3300010376 | Tropical Forest Soil | MRLGHESLDVTLAYLKGKDAESEEVQEHANSSSLALYA* |
| Ga0126381_1050744991 | 3300010376 | Tropical Forest Soil | AGAGWSIDTIRIRLGLEVFDVTLAHPQGKDAESEEAQEHANRGSLELYA* |
| Ga0136449_1002906016 | 3300010379 | Peatlands Soil | EGVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSGLAQYA* |
| Ga0136449_1006612183 | 3300010379 | Peatlands Soil | EGVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0126383_119253473 | 3300010398 | Tropical Forest Soil | GHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0126383_123204971 | 3300010398 | Tropical Forest Soil | ISEARASLHKSLQMTVAYLKGKDAEPEVASEHANSSSMALYA* |
| Ga0137363_113328131 | 3300012202 | Vadose Zone Soil | RLGHESLDVTLAYLKGKDAESKEAQEHANNSSLALYA* |
| Ga0137377_101359424 | 3300012211 | Vadose Zone Soil | RLGHESLDVTLAYLKGKDAESEQAQEHANTSSLAKYA* |
| Ga0137377_108687712 | 3300012211 | Vadose Zone Soil | HESLDVTLAYLKGKDAESEEAQEHANSSTLALYA* |
| Ga0137397_113141551 | 3300012685 | Vadose Zone Soil | RCVNKHLIQLGHESLDVTLAYLKGKDAESQEAQEYANSSSLALYA* |
| Ga0137396_100097045 | 3300012918 | Vadose Zone Soil | MSVSTIPIRFGHESLDVTLAYLKGKHAEPEEAQEHANGSTLGPYA* |
| Ga0181539_11593781 | 3300014151 | Bog | TQDLLLPPNTTRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSNLPLYA* |
| Ga0182008_106060911 | 3300014497 | Rhizosphere | IRIRLGHESLDVTLAYVKGESEEAQEHANSSSLALYA* |
| Ga0134072_100547201 | 3300015357 | Grasslands Soil | LGHESLDVTLAYLKGKDAESEQAQEHANTSSLAKYA* |
| Ga0132255_1015629433 | 3300015374 | Arabidopsis Rhizosphere | LGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA* |
| Ga0182034_108517312 | 3300016371 | Soil | VQRPPGNRLGYESLHMSIAYLKGKDAEAAEAQEHANSSSGLALYA |
| Ga0187802_101030242 | 3300017822 | Freshwater Sediment | LGHESLDVTLAYLKGKDAESEEAQEHANSSSLAMYA |
| Ga0187820_10065231 | 3300017924 | Freshwater Sediment | YRTCYRETLCEMKAPIPSSTDINTICVRPEHESFDVTFAYRKGKDAESEEAQEHANSSSLALYA |
| Ga0187807_10556481 | 3300017926 | Freshwater Sediment | MNTTRIRLGHESLDVTLAYLKGKDAESEEAQEHANNSSLALYA |
| Ga0187824_100527173 | 3300017927 | Freshwater Sediment | RTPNTTRIRLGHESLDVTLANLKGKDAESEEAQEHANSSNLPLYT |
| Ga0187806_13416192 | 3300017928 | Freshwater Sediment | NTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSNLPLYA |
| Ga0187806_13780931 | 3300017928 | Freshwater Sediment | LAICIQLGHESLEVTLAYFKGEGAESEEAQEHANSSSLALEAS |
| Ga0187814_101152571 | 3300017932 | Freshwater Sediment | IRLGHESLDVTLAYLKGKDAESEEAQEHANNSSLALYA |
| Ga0187814_101944342 | 3300017932 | Freshwater Sediment | LPSVRTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSNLPLYA |
| Ga0187801_100291133 | 3300017933 | Freshwater Sediment | MKAPIPSSTDINTICVRPEHESFDVTFAYRKGKDAESEEAQEHANSSSLALYA |
| Ga0187801_101294411 | 3300017933 | Freshwater Sediment | LAIRDVSTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANNSSLALYA |
| Ga0187809_102153841 | 3300017937 | Freshwater Sediment | NRKLAEIASMNTTRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSNLPLYA |
| Ga0187819_100991533 | 3300017943 | Freshwater Sediment | VELPSVRTIRIRLGHESLDVTLAYLKGKVAESEEAQEHANSS |
| Ga0187819_102714042 | 3300017943 | Freshwater Sediment | MNTIRIRLGHESLDVTLAYLKGKDAESEEAQAHANSSSLALYA |
| Ga0187819_102963941 | 3300017943 | Freshwater Sediment | VLDSKALRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0187817_100863604 | 3300017955 | Freshwater Sediment | VSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0187817_108606811 | 3300017955 | Freshwater Sediment | IRIRLGDESLDVTLYYLKGKDAESEEAQEHANGSSLALYA |
| Ga0187817_109092402 | 3300017955 | Freshwater Sediment | LQCPLIRIRIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0187817_109648121 | 3300017955 | Freshwater Sediment | NTTRIRLGHESLDVTLAYLKGKDAESEEAQEHANNSSLALYA |
| Ga0187778_100186583 | 3300017961 | Tropical Peatland | MNTIFIHLGCESLHVSLAYLKGKDAESEEAQEHANGSSLALYA |
| Ga0187783_1000396410 | 3300017970 | Tropical Peatland | VPIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0187783_100590213 | 3300017970 | Tropical Peatland | VAGVADTGKETVDVTLAYLKGKDAESEEAQEHAKYSGLALYA |
| Ga0187783_101886813 | 3300017970 | Tropical Peatland | VNTIRLRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0187783_108028221 | 3300017970 | Tropical Peatland | RLRHESLDVTLAYLKGKDAESDEAKEHANSGSLAIFA |
| Ga0187783_110548821 | 3300017970 | Tropical Peatland | LMRILGDESLDVTLAYLNGKDAESEEAQEHANSSSLALCA |
| Ga0187783_112252832 | 3300017970 | Tropical Peatland | IRLGHESLDPTLTYLKGKDAESKEAQEQAKSSSLALFA |
| Ga0187781_100182533 | 3300017972 | Tropical Peatland | MSTIRIRLGHESLDVTLAYLNGKDDESEEAQEHANSSSLALYA |
| Ga0187781_100258002 | 3300017972 | Tropical Peatland | LALAASVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0187781_101206962 | 3300017972 | Tropical Peatland | LAELVSVNTIRIRFGHDSLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0187781_102621982 | 3300017972 | Tropical Peatland | MNTIRVRLSHESLDVTLAYLKGKDAESEEEQEHANSSSLAMYA |
| Ga0187781_107276492 | 3300017972 | Tropical Peatland | MSAYPAHESLDVALAYLKGKDAESEEAQEHANSSSLVLYA |
| Ga0187781_111551252 | 3300017972 | Tropical Peatland | VVMRIVGDESLDVTLAYLKGKDAESEEAQEHANSSSLALCA |
| Ga0187780_106292252 | 3300017973 | Tropical Peatland | MNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0187777_114425421 | 3300017974 | Tropical Peatland | MRCSGHESLDVTLAYLKGKDTQSEEAPEHANNSSLALYA |
| Ga0187782_102100892 | 3300017975 | Tropical Peatland | IRLCHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0187782_112465321 | 3300017975 | Tropical Peatland | LGHEVLDVSLAYLKGKDAESEEAKEHANSCSLALYA |
| Ga0187891_11182621 | 3300017996 | Peatland | PRLRSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSRLALYA |
| Ga0187868_11097072 | 3300018002 | Peatland | GHESLDVTLAYLKGKDAESEEAQEHANSSNLPLYA |
| Ga0187804_101115562 | 3300018006 | Freshwater Sediment | LREESILVNTIRIRLGHESLDVTLAYLKGKDGESEEAQEHANNSSLALYA |
| Ga0187805_103594281 | 3300018007 | Freshwater Sediment | MNTTRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0187805_105259592 | 3300018007 | Freshwater Sediment | VEWLCVKTIRIRFGHESLDVTLAYLKGNDAESEEAQEHAEWPGS |
| Ga0187810_101407261 | 3300018012 | Freshwater Sediment | VALRKDDPTIRIRLGHESLDVTLAYLKGKDAESSEAQEHANRSLALYA |
| Ga0187810_102479701 | 3300018012 | Freshwater Sediment | ISTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANNSSLALYA |
| Ga0187890_100027596 | 3300018044 | Peatland | VSQHTPSAKTVRLGHESLDVTLAYLKGKDAESEEAQEHANISSLALYA |
| Ga0187784_101893962 | 3300018062 | Tropical Peatland | MQEIAWPHPIHLGHESLDVTLAYLKGKDAESEEAQKHANSSSLALYA |
| Ga0187772_100559113 | 3300018085 | Tropical Peatland | VRIGPESLDVTLAYLKGKDAVSDEAQEHANSSSLAPYA |
| Ga0187772_110940731 | 3300018085 | Tropical Peatland | VNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSS |
| Ga0187772_114786301 | 3300018085 | Tropical Peatland | VNTIRIRLGNESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0187769_113106203 | 3300018086 | Tropical Peatland | MNTIRVRLSHESLDVTLAYLKGKDAESEEAKEHANSSNLALTHKG |
| Ga0187852_11569652 | 3300019082 | Peatland | VNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSRLALYA |
| Ga0210407_108370041 | 3300020579 | Soil | PSVKVVRLCRESPDVMLAYLKGKDAESEEAQEHANSSSLAIYARFLSP |
| Ga0210399_100417642 | 3300020581 | Soil | MNTIRIWLGHESLDVTLAYLKGKDAASEEAQEHANSSSLALYG |
| Ga0210401_100328316 | 3300020583 | Soil | MVRIRLGHESLAVTLSYLKGKDAESEKAQEHANSSSVAMYA |
| Ga0210401_100449353 | 3300020583 | Soil | MMSLHVESLDVTLAYLKGKDAESEEAQEHANSSSLARYA |
| Ga0210401_103064001 | 3300020583 | Soil | MNLQRESLDVTLACLQGKDAESEEAQEHANSSSLALYA |
| Ga0210401_108999712 | 3300020583 | Soil | MPGGSCCSPRVVLIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0215015_100779772 | 3300021046 | Soil | MKTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0210404_100747353 | 3300021088 | Soil | MKTIRIRLGHESLDVTLAYLKDKDAESEEAQEHANSSSLALYA |
| Ga0210404_104329652 | 3300021088 | Soil | MRSSPVILLSHQSLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0210400_104279802 | 3300021170 | Soil | GVSVNTIRIRLGHESPDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0210396_100092289 | 3300021180 | Soil | VRTIRIRIGHKLLDVTLAYPKGKDAESEETQEHANNVSLALYA |
| Ga0210383_111671571 | 3300021407 | Soil | MNLQRESLDVTLACLKGKDAESEEAQEHANSSSLALYA |
| Ga0210394_115210451 | 3300021420 | Soil | LGHESLDLTLAYLKGKDAESEEAQEHANTSSPALYA |
| Ga0210384_115421952 | 3300021432 | Soil | VNTIRIRLGHESLDVTLAYLKGKNAESEEAQEHAKSSSS |
| Ga0210390_101981732 | 3300021474 | Soil | VSVNNIRIRLGHESLDVTLTYLKGQDAESEEAQEHANSSSLAPYA |
| Ga0210402_102534212 | 3300021478 | Soil | MLGHESLDVRLAYLKGKDGESEEAQEHAYSSSLALYA |
| Ga0210402_107142942 | 3300021478 | Soil | MVRIRLGHESLHVTLSYLKGKDAESEEAQEHANSSSVAMYA |
| Ga0210410_1000040331 | 3300021479 | Soil | VRTIRIRIGHKLLDVTLAYPKGKDAESEETQEHANSSSLAQYA |
| Ga0210410_102931153 | 3300021479 | Soil | RIRLGHESLELTLPYLKGKDAESEEAQEHANSSSLALYA |
| Ga0210409_100363027 | 3300021559 | Soil | VNTIRILLGHESLDATLAYLKGKDAESEEAQEHANSSSLAQYT |
| Ga0126371_101859114 | 3300021560 | Tropical Forest Soil | LSNKEDHQEQWFRRHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0126371_121993871 | 3300021560 | Tropical Forest Soil | MNTIRIRLGHESLDVTLACPKGKDAELEEAQEHANSSSLVLYA |
| Ga0126371_124835861 | 3300021560 | Tropical Forest Soil | LGHESLDVTLAYLKGKDAESEEAQEHANSSRLALYA |
| Ga0126371_134152421 | 3300021560 | Tropical Forest Soil | NRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0242661_10763482 | 3300022717 | Soil | NNIRIRLGHESLDVTLTYLKGQDAESEEAQEHANSSSLAPYA |
| Ga0224558_10134673 | 3300023090 | Soil | MIQSGLGHESLDVTFAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0207692_109275961 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | THACLDVTLAYLKGKDAKSEEAQEHANSSSLALYA |
| Ga0207684_101153943 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTIRIRVGHESLDVTLAYLKGKDAESEEAQERANSSRQNGR |
| Ga0207684_101807352 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTIRIRLGHESLDVPLAYLNGKDAESEEAPEDANSLAV |
| Ga0207684_112996651 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VELPRARTIRIQLRHESRDTTLGYLKGKDAESEEAQEHANSSSLALYA |
| Ga0207671_109560972 | 3300025914 | Corn Rhizosphere | CSMTTIRIRLGHESLDVTLAFLKGKDAESEEAQEHANSSLALYA |
| Ga0207693_100614832 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVNIIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALFA |
| Ga0207646_111847892 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VEWPCVRTIRIRLGHESLDVTLSYLKGKDAESEEAQEHANSSSL |
| Ga0207700_102386842 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVNTIRIRLGHESLDVTLAYLKGKDAEFEEAQEHASSNSSAFYA |
| Ga0207665_112444472 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GVSVNTIRIRLDHESLDVTLAYHKGEDAESAEAQEHANSSSLALYA |
| Ga0257160_10546631 | 3300026489 | Soil | VNTVRIRLGHESLDVSLRYLKGRDAESDEAQEQANSSSLAKY |
| Ga0209056_107086912 | 3300026538 | Soil | MKTIRIRESLDVTLAYLKGKDAESEEAQERANSSSLALYA |
| Ga0209376_12709062 | 3300026540 | Soil | MKTIRIRESLDVTLAYLKGKDAESEEAQERANGSSLALYA |
| Ga0209161_1002612210 | 3300026548 | Soil | NTIRIRLGHESLDVTLAYLKGKDAESEQAQEHANTSSLAKYA |
| Ga0209325_10136062 | 3300027050 | Forest Soil | IRIRVGHESLDVTLAYVKGKDAESEEAQEHANSSSQNRR |
| Ga0209325_10273612 | 3300027050 | Forest Soil | LSHESLDVTLAYLKCKDAESEEAQEHANSSSLALYA |
| Ga0209214_10003014 | 3300027071 | Forest Soil | NSNCLRHESLDVTLAYLKGKDAECKEAEEHANSSSLALFA |
| Ga0209215_10009462 | 3300027266 | Forest Soil | VNTIRTRLGHESLDVTLACLKGKDAESEEAQEHANSSSLALYA |
| Ga0209418_10043112 | 3300027371 | Forest Soil | VNTIRIRLGHESLDVTLAYLKGKDDKSEEAQEHANSSSLALYA |
| Ga0209004_10739661 | 3300027376 | Forest Soil | MSVSLNTIRIRLSRERVYVNLAYLKGKDAESEEAQEHTNSSSLALYA |
| Ga0209523_10002434 | 3300027548 | Forest Soil | MSIIRIRLGHESLDVTLAYVKGKEAESEEAQEHANSSSLALYA |
| Ga0209523_10649812 | 3300027548 | Forest Soil | VNTIRIRLGHESLDVTLAYLKGKDDKSEEAQEHAKSSSLALYA |
| Ga0209448_100033351 | 3300027783 | Bog Forest Soil | VLGHESLDVRLAYLKGKDAESEEAQEHANGSGPALYA |
| Ga0209060_100399762 | 3300027826 | Surface Soil | MNTIRIRVGHESLDVTLAYLKGKDAESEEAQERANSSSQNGR |
| Ga0209580_100764673 | 3300027842 | Surface Soil | MSTILIRLGHESLDVTLAYLKGKDSESEEAQEHANSSSLALHA |
| Ga0209580_105780752 | 3300027842 | Surface Soil | MSTILIRLGHESLDVTLAYLKGKDAESEEAQEHANSSGLALHA |
| Ga0209006_114714651 | 3300027908 | Forest Soil | GVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0209583_102068152 | 3300027910 | Watersheds | VEWPSVRTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0209698_100054566 | 3300027911 | Watersheds | LTKSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQKHANSSSLALYA |
| Ga0310039_102332782 | 3300030706 | Peatlands Soil | TIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0310038_101313402 | 3300030707 | Peatlands Soil | VLGHESLDVRLAYLKGKDAESEEAQEHANSSSLAFYA |
| Ga0265773_10378001 | 3300031018 | Soil | MRKNASVHIRIQLSHESLDVTLAYLKGKDAESETAPEHANSSSLALYA |
| Ga0318541_101103593 | 3300031545 | Soil | VLEPHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0310686_1001235391 | 3300031708 | Soil | DTLHEEGVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307476_100270113 | 3300031715 | Hardwood Forest Soil | MLIRLGHESLDVTLASLKGKEAESEEAQEHANSSSLALHA |
| Ga0307476_100400802 | 3300031715 | Hardwood Forest Soil | VNTIRIRPGHESLDVTLAYLKGKAAESEEAQEHANSS |
| Ga0307476_101464381 | 3300031715 | Hardwood Forest Soil | VSVNTIRLRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307476_105611232 | 3300031715 | Hardwood Forest Soil | MQLGHESLDVTLAYLKSKDAESEEAQEHANSSSLALYA |
| Ga0307476_107064771 | 3300031715 | Hardwood Forest Soil | IRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307474_100544743 | 3300031718 | Hardwood Forest Soil | VHESLDVTLAYLKVKDAESEKAQEHANSGNVALYA |
| Ga0307474_103715402 | 3300031718 | Hardwood Forest Soil | MSTILIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307474_107338332 | 3300031718 | Hardwood Forest Soil | VEWPCVTTILIRPGHESPDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307469_111814412 | 3300031720 | Hardwood Forest Soil | VERPRVRTLPIRLAHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307477_100407445 | 3300031753 | Hardwood Forest Soil | MSTILIRLRHESLDVTLAYLKGKDAESEEAQEHANSSSLALHA |
| Ga0307477_102336562 | 3300031753 | Hardwood Forest Soil | FGKSLDLPLAYLKGKDAESEETQEHANSSSLALYA |
| Ga0307477_103823404 | 3300031753 | Hardwood Forest Soil | SPRTRSSPVILLSHQSLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307477_107423111 | 3300031753 | Hardwood Forest Soil | MSTMLIRLGHESLDVTLASLKGKEAESEEAQEHANSSSLALHA |
| Ga0307477_107436562 | 3300031753 | Hardwood Forest Soil | SGFVLAGNAEVNPRLRSVNTMRIRLGPESLDVTLAYLKGKDAESEEAQEQANSSSLALYA |
| Ga0307475_100087746 | 3300031754 | Hardwood Forest Soil | VRKDEEFVNLIAAKALDVTLAYLKGKDAESEEAHEHANTSSLALYA |
| Ga0307475_101203222 | 3300031754 | Hardwood Forest Soil | MKTIRIRLGHESLDVTLAYLKGKDAESEEAQEHADSSSLALYA |
| Ga0307475_101994042 | 3300031754 | Hardwood Forest Soil | VNTIRIRPGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307475_104608332 | 3300031754 | Hardwood Forest Soil | NTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307475_114382532 | 3300031754 | Hardwood Forest Soil | VGPATIRIRLGQESLDVTLAYLKGKDAESEEAQEHANSSSLALHA |
| Ga0307473_107415102 | 3300031820 | Hardwood Forest Soil | VSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLAVYA |
| Ga0307473_108603342 | 3300031820 | Hardwood Forest Soil | TLHEEGVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307473_115020931 | 3300031820 | Hardwood Forest Soil | STIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307478_102297832 | 3300031823 | Hardwood Forest Soil | VNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0306926_102465123 | 3300031954 | Soil | HEEGVSVNTIRIWLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307479_100670303 | 3300031962 | Hardwood Forest Soil | MSTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307479_100968003 | 3300031962 | Hardwood Forest Soil | VSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANNSSLALYA |
| Ga0307479_102139991 | 3300031962 | Hardwood Forest Soil | MHFAPVSNYLGHESLDVTLAWGKDPESEAKEHANSSSLALYA |
| Ga0307479_104069422 | 3300031962 | Hardwood Forest Soil | VSVNTIRIRLGHESLDVALAYLKGKDAESEEAQEDANSSGLALYA |
| Ga0307479_110680921 | 3300031962 | Hardwood Forest Soil | VNTIRIRLGHESLYVTLAYLKGKDAESEEAQEHANNSSLALYA |
| Ga0306924_122559001 | 3300032076 | Soil | RIRLGHESLDVTLAYLKGKDAESEEAQDHANSSSLALYA |
| Ga0307470_115059461 | 3300032174 | Hardwood Forest Soil | MIRIQFGHESLDVTLAYLLKGKDAESEEAQEHANCSSLVLYA |
| Ga0307471_1000292672 | 3300032180 | Hardwood Forest Soil | LQIRVSHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307471_1007495171 | 3300032180 | Hardwood Forest Soil | LGRESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307472_1005718412 | 3300032205 | Hardwood Forest Soil | VLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0307472_1007362412 | 3300032205 | Hardwood Forest Soil | RIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0335070_1000178319 | 3300032829 | Soil | MKTIRIRLGHESLDVTLAYLKVKDAESEEAQEHANSSSLAPYA |
| Ga0335070_111296963 | 3300032829 | Soil | TICIRLGHEWFVTLAYLKGKDAESEEAQEHANSSSSLALYA |
| Ga0335081_103416272 | 3300032892 | Soil | VALRKERFRIRLGHGSLDVTLAYLKGKDAGSEKAQEHANSSLALYA |
| Ga0335072_112908712 | 3300032898 | Soil | VELPSVRTIRIRLGHESLDVTLAYLKGKDAESEEAQEYANSSSLALYA |
| Ga0326728_100706191 | 3300033402 | Peat Soil | VALRKTIHIRLGHESLDVTLAYLNGKDAESEEAQEHAHSSSLALYA |
| Ga0326728_107297211 | 3300033402 | Peat Soil | SVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0326728_107484102 | 3300033402 | Peat Soil | HEEGVSVNTIRIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0314861_0001483_4732_4857 | 3300033977 | Peatland | VKTIRLGHESLDVTLAYLKGKDAESEEAQEHANSSSLALYA |
| Ga0314861_0014553_2736_2849 | 3300033977 | Peatland | VGHGSLDVTLAYLKGKDAESEEAQEHANNSSLALYAS |
| ⦗Top⦘ |