Metagenome / Metatranscriptome Family F018095

Overview

Basic Information

• Family ID: F018095
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 237
• Average Sequence Length: 38 residues
• Representative Sequence: MDAKWNNIVDNTMVRIGMVVVGFGAWLAIGYGLLAA
• Number of Associated Samples: 168
• Number of Associated Scaffolds: 237

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 78.29 %
• % of genes near scaffold ends (potentially truncated): 12.66 %
• % of genes from short scaffolds (< 2000 bps): 53.16 %
• Associated GOLD sequencing projects: 149
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (50.211 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.456 % of family members)
• Environment Ontology (ENVO): Unclassified (29.536 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (49.789 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 51.56%
  β-sheet: 0.00%
  Coil/Unstructured: 48.44%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 237 Family Scaffolds
PF04551	GcpE	54.43
PF03631	Virul_fac_BrkB	13.92
PF02518	HATPase_c	4.22
PF02566	OsmC	2.11
PF00486	Trans_reg_C	1.27
PF01411	tRNA-synt_2c	1.27
PF02515	CoA_transf_3	0.42
PF04366	Ysc84	0.42
PF07813	LTXXQ	0.42
PF01134	GIDA	0.42
PF00069	Pkinase	0.42
PF07638	Sigma70_ECF	0.42
PF01381	HTH_3	0.42
PF13478	XdhC_C	0.42
PF01040	UbiA	0.42
PF07228	SpoIIE	0.42
PF00282	Pyridoxal_deC	0.42
PF13432	TPR_16	0.42
PF00582	Usp	0.42
PF04307	YdjM	0.42

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 237 Family Scaffolds
COG0821	4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE	Lipid transport and metabolism [I]	54.43
COG1295	Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)	Function unknown [S]	13.92
COG1764	Organic hydroperoxide reductase OsmC/OhrA	Defense mechanisms [V]	2.11
COG1765	Uncharacterized OsmC-related protein	General function prediction only [R]	2.11
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	1.69
COG3678	Periplasmic chaperone Spy, Spy/CpxP family	Posttranslational modification, protein turnover, chaperones [O]	1.69
COG0013	Alanyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	1.27
COG0076	Glutamate or tyrosine decarboxylase or a related PLP-dependent protein	Amino acid transport and metabolism [E]	0.42
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.42
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	0.42
COG1988	Membrane-bound metal-dependent hydrolase YbcI, DUF457 family	General function prediction only [R]	0.42
COG2930	Lipid-binding SYLF domain, Ysc84/FYVE family	Lipid transport and metabolism [I]	0.42

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.21 %
All Organisms	root	All Organisms	49.79 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.21 %
cellular organisms	root	All Organisms → cellular organisms	49.79 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.21 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	49.79 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.21 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	17.72 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.42 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.42 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.21 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	15.61 %
Candidatus Hydrogenedentes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes	0.42 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.42 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.42 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.21 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	12.66 %
Candidatus Angelobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter	2.53 %
unclassified Candidatus Hydrogenedentes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes	0.42 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.42 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.42 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.21 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	12.66 %
unclassified Candidatus Angelobacter	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter	2.53 %
Candidatus Hydrogenedentes bacterium ADurb.Bin101	species	All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium ADurb.Bin101	0.42 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.42 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.42 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.21 %
Candidatus Angelobacter sp. Gp1-AA117	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	2.53 %
Acidobacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium	0.84 %
Candidatus Hydrogenedentes bacterium ADurb.Bin101	species	All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium ADurb.Bin101	0.42 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.42 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.42 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2189573001|GZR05M102F7CIH	Not Available	532
3300000156|NODE_c0620528	All Organisms → cellular organisms → Bacteria	1824
3300001305|C688J14111_10001422	All Organisms → cellular organisms → Bacteria → Acidobacteria	6333
3300001867|JGI12627J18819_10302255	Not Available	644
3300002245|JGIcombinedJ26739_100538127	All Organisms → cellular organisms → Bacteria	1045
3300002568|C688J35102_120965757	All Organisms → cellular organisms → Bacteria	3442
3300002914|JGI25617J43924_10197941	Not Available	668
3300004104|Ga0058891_1560186	All Organisms → cellular organisms → Bacteria	1096
3300004479|Ga0062595_100723414	All Organisms → cellular organisms → Bacteria	804
3300005168|Ga0066809_10017727	All Organisms → cellular organisms → Bacteria	1414
3300005332|Ga0066388_102346000	All Organisms → cellular organisms → Bacteria	966
3300005345|Ga0070692_10267746	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1030
3300005434|Ga0070709_10058354	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	2447
3300005434|Ga0070709_10197290	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1423
3300005436|Ga0070713_100041465	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3750
3300005436|Ga0070713_100324987	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1421
3300005439|Ga0070711_101472192	Not Available	594
3300005526|Ga0073909_10015082	All Organisms → cellular organisms → Bacteria	2423
3300005526|Ga0073909_10682072	Not Available	514
3300005529|Ga0070741_10006059	All Organisms → cellular organisms → Bacteria	26268
3300005533|Ga0070734_10002477	All Organisms → cellular organisms → Bacteria	22202
3300005533|Ga0070734_10073032	Not Available	2037
3300005537|Ga0070730_10034976	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3753
3300005537|Ga0070730_10080060	Not Available	2290
3300005537|Ga0070730_10128013	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1737
3300005542|Ga0070732_10072849	All Organisms → cellular organisms → Bacteria	2004
3300005542|Ga0070732_10201833	All Organisms → cellular organisms → Bacteria	1188
3300005542|Ga0070732_10514353	Not Available	725
3300005555|Ga0066692_10024319	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3125
3300005560|Ga0066670_10643707	Not Available	644
3300005563|Ga0068855_100404545	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1495
3300005575|Ga0066702_10435663	Not Available	803
3300005575|Ga0066702_10584498	All Organisms → cellular organisms → Bacteria	672
3300005616|Ga0068852_101679396	Not Available	658
3300005650|Ga0075038_10880862	All Organisms → cellular organisms → Bacteria	844
3300005712|Ga0070764_10873161	Not Available	562
3300005764|Ga0066903_100233555	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2809
3300005764|Ga0066903_100306269	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2520
3300005764|Ga0066903_100580118	All Organisms → cellular organisms → Bacteria	1935
3300005764|Ga0066903_100862128	All Organisms → cellular organisms → Bacteria	1632
3300005949|Ga0066791_10005606	All Organisms → cellular organisms → Bacteria → Acidobacteria	2965
3300005993|Ga0080027_10127825	All Organisms → cellular organisms → Bacteria	966
3300006028|Ga0070717_10217197	Not Available	1679
3300006028|Ga0070717_10574754	All Organisms → cellular organisms → Bacteria	1022
3300006028|Ga0070717_10757409	Not Available	883
3300006028|Ga0070717_11414346	Not Available	632
3300006050|Ga0075028_100231162	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1009
3300006163|Ga0070715_10394896	All Organisms → cellular organisms → Bacteria	767
3300006173|Ga0070716_101356826	Not Available	576
3300006175|Ga0070712_100048559	All Organisms → cellular organisms → Bacteria	2942
3300006176|Ga0070765_101439426	Not Available	649
3300006800|Ga0066660_10418263	All Organisms → cellular organisms → Bacteria	1112
3300006800|Ga0066660_10815401	All Organisms → cellular organisms → Bacteria	760
3300006854|Ga0075425_100471270	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium	1446
3300006871|Ga0075434_101257133	All Organisms → cellular organisms → Bacteria	752
3300006954|Ga0079219_10064799	Not Available	1643
3300009038|Ga0099829_10066870	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2715
3300009088|Ga0099830_10136599	All Organisms → cellular organisms → Bacteria	1872
3300009090|Ga0099827_11361044	Not Available	618
3300009143|Ga0099792_10034659	All Organisms → cellular organisms → Bacteria	2365
3300009174|Ga0105241_10074565	All Organisms → cellular organisms → Bacteria	2642
3300009650|Ga0105857_1042457	Not Available	1195
3300010046|Ga0126384_10842052	Not Available	824
3300010048|Ga0126373_10642720	All Organisms → cellular organisms → Bacteria	1116
3300010154|Ga0127503_10373922	All Organisms → cellular organisms → Bacteria	760
3300010358|Ga0126370_11071233	All Organisms → cellular organisms → Bacteria	741
3300010358|Ga0126370_11967704	Not Available	570
3300010359|Ga0126376_12861067	Not Available	532
3300010361|Ga0126378_10000107	All Organisms → cellular organisms → Bacteria	62100
3300010361|Ga0126378_10693231	All Organisms → cellular organisms → Bacteria	1130
3300010361|Ga0126378_12176573	Not Available	633
3300010371|Ga0134125_10082244	Not Available	3583
3300010371|Ga0134125_10092039	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	3373
3300010371|Ga0134125_10102475	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	3187
3300010373|Ga0134128_10517147	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1330
3300010375|Ga0105239_13381235	All Organisms → cellular organisms → Bacteria	519
3300011120|Ga0150983_10730695	All Organisms → cellular organisms → Bacteria	818
3300011120|Ga0150983_14660609	Not Available	632
3300011120|Ga0150983_14904451	All Organisms → cellular organisms → Bacteria	790
3300011120|Ga0150983_14986156	Not Available	1501
3300011269|Ga0137392_10035962	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	3635
3300011269|Ga0137392_10480190	All Organisms → cellular organisms → Bacteria	1032
3300011271|Ga0137393_10044531	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3441
3300012189|Ga0137388_11466026	All Organisms → cellular organisms → Bacteria	620
3300012202|Ga0137363_10000005	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	128481
3300012202|Ga0137363_10009584	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	6152
3300012210|Ga0137378_10027140	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5054
3300012210|Ga0137378_10061537	All Organisms → cellular organisms → Bacteria	3392
3300012212|Ga0150985_112747276	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1555
3300012349|Ga0137387_10601071	All Organisms → cellular organisms → Bacteria	797
3300012351|Ga0137386_10401970	All Organisms → cellular organisms → Bacteria	986
3300012357|Ga0137384_10000013	All Organisms → cellular organisms → Bacteria	135645
3300012359|Ga0137385_10787425	All Organisms → cellular organisms → Bacteria	790
3300012582|Ga0137358_10230398	Not Available	1262
3300012683|Ga0137398_10703711	Not Available	702
3300012685|Ga0137397_10803797	Not Available	698
3300012930|Ga0137407_10135270	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2160
3300012931|Ga0153915_11978412	Not Available	682
3300012931|Ga0153915_12504971	Not Available	603
3300012931|Ga0153915_12697139	Not Available	581
3300012944|Ga0137410_10449327	All Organisms → cellular organisms → Bacteria	1046
3300012951|Ga0164300_11065316	All Organisms → cellular organisms → Bacteria	525
3300012955|Ga0164298_10003397	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5392
3300012957|Ga0164303_10225163	All Organisms → cellular organisms → Bacteria	1057
3300012957|Ga0164303_11549751	Not Available	503
3300012958|Ga0164299_10822659	All Organisms → cellular organisms → Bacteria	665
3300012960|Ga0164301_10403964	Not Available	957
3300012987|Ga0164307_10098798	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1821
3300013296|Ga0157374_12935873	Not Available	504
3300015241|Ga0137418_11239947	Not Available	523
3300015373|Ga0132257_104479280	Not Available	508
3300017994|Ga0187822_10180233	All Organisms → cellular organisms → Bacteria	694
3300018468|Ga0066662_10105990	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2007
3300018468|Ga0066662_10836796	All Organisms → cellular organisms → Bacteria	897
3300018468|Ga0066662_11122900	Not Available	788
3300018468|Ga0066662_12806999	Not Available	517
3300019789|Ga0137408_1112275	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1915
3300020078|Ga0206352_10437333	All Organisms → cellular organisms → Bacteria	582
3300020078|Ga0206352_11287862	Not Available	519
3300020140|Ga0179590_1073602	Not Available	903
3300020170|Ga0179594_10117640	All Organisms → cellular organisms → Bacteria	966
3300020199|Ga0179592_10127429	All Organisms → cellular organisms → Bacteria	1168
3300020579|Ga0210407_10000921	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	29836
3300020579|Ga0210407_10296195	All Organisms → cellular organisms → Bacteria	1263
3300021178|Ga0210408_10000272	All Organisms → cellular organisms → Bacteria	72745
3300021403|Ga0210397_10000008	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	309956
3300021403|Ga0210397_11135731	Not Available	607
3300021404|Ga0210389_11147933	Not Available	599
3300021404|Ga0210389_11273511	Not Available	564
3300021475|Ga0210392_10749421	Not Available	728
3300021560|Ga0126371_10023680	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5687
3300021560|Ga0126371_13078901	All Organisms → cellular organisms → Bacteria	564
3300022507|Ga0222729_1042055	All Organisms → cellular organisms → Bacteria	611
3300022531|Ga0242660_1078580	All Organisms → cellular organisms → Bacteria	773
3300022531|Ga0242660_1172220	All Organisms → cellular organisms → Bacteria	580
3300022531|Ga0242660_1214927	Not Available	534
3300025544|Ga0208078_1006179	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	2968
3300025898|Ga0207692_10957342	All Organisms → cellular organisms → Bacteria	564
3300025913|Ga0207695_10103707	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2835
3300025913|Ga0207695_11046503	Not Available	696
3300025915|Ga0207693_10805271	All Organisms → cellular organisms → Bacteria	724
3300025921|Ga0207652_10286446	Not Available	1486
3300025928|Ga0207700_10017736	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	4762
3300025929|Ga0207664_11905737	Not Available	517
3300026078|Ga0207702_10179510	All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium ADurb.Bin101	1949
3300026216|Ga0209903_1004801	All Organisms → cellular organisms → Bacteria	2809
3300026319|Ga0209647_1003892	All Organisms → cellular organisms → Bacteria → Acidobacteria	11433
3300026319|Ga0209647_1111429	All Organisms → cellular organisms → Bacteria → Acidobacteria	1280
3300026551|Ga0209648_10206636	All Organisms → cellular organisms → Bacteria	1493
3300026557|Ga0179587_10013586	All Organisms → cellular organisms → Bacteria	4272
3300027376|Ga0209004_1005336	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1748
3300027591|Ga0209733_1031733	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1420
3300027616|Ga0209106_1017421	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium	1545
3300027773|Ga0209810_1007187	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	9345
3300027826|Ga0209060_10000681	All Organisms → cellular organisms → Bacteria	51903
3300027826|Ga0209060_10049198	Not Available	2038
3300027846|Ga0209180_10531755	Not Available	656
3300027857|Ga0209166_10014380	All Organisms → cellular organisms → Bacteria	5048
3300027857|Ga0209166_10192656	All Organisms → cellular organisms → Bacteria	1098
3300027862|Ga0209701_10107893	All Organisms → cellular organisms → Bacteria	1734
3300027882|Ga0209590_10393749	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	894
3300028536|Ga0137415_11479932	Not Available	504
3300028800|Ga0265338_10079213	All Organisms → cellular organisms → Bacteria	2766
3300030842|Ga0075404_11180869	Not Available	868
3300031057|Ga0170834_108466107	All Organisms → cellular organisms → Bacteria	1170
3300031122|Ga0170822_13320736	All Organisms → cellular organisms → Bacteria	1268
3300031231|Ga0170824_101811027	Not Available	850
3300031231|Ga0170824_103582025	All Organisms → cellular organisms → Bacteria	573
3300031469|Ga0170819_10322333	Not Available	675
3300031469|Ga0170819_14769843	All Organisms → cellular organisms → Bacteria	566
3300031469|Ga0170819_16618702	All Organisms → cellular organisms → Bacteria	826
3300031740|Ga0307468_102355933	Not Available	518
3300032205|Ga0307472_101272028	All Organisms → cellular organisms → Bacteria	707
3300033480|Ga0316620_10467810	All Organisms → cellular organisms → Bacteria	1157
3300033486|Ga0316624_10056186	All Organisms → cellular organisms → Bacteria	2547

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	89.45%
Host-Associated	Host-Associated	10.13%
Engineered	Engineered	0.42%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	84.81%
Plants	Host-Associated → Plants	9.70%
Aquatic	Environmental → Aquatic	4.64%
Human	Host-Associated → Human	0.42%
Solid Waste	Engineered → Solid Waste	0.42%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	84.81%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.06%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.64%
Sediment	Environmental → Aquatic → Sediment	2.53%
Freshwater	Environmental → Aquatic → Freshwater	2.11%
Digestive System	Host-Associated → Human → Digestive System	0.42%
Grass	Engineered → Solid Waste → Grass	0.42%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	63.71%
Loam	Environmental → Terrestrial → Soil → Loam	18.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.22%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.80%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.95%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.53%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.69%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.27%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.42%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.42%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.42%
Composting	Engineered → Solid Waste → Grass → Composting	0.42%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	40.51%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	11.39%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.55%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	8.86%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.44%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.22%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.80%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.53%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	2.11%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.27%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.27%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.84%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.84%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.84%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.42%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.42%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.42%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.42%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.42%
Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor	0.42%

Habitat

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	16.46%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	7.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	7.17%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	7.17%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	5.91%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	5.49%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.06%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	4.64%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.22%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.80%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.80%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	3.38%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.95%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	2.53%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.53%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.11%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.27%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.27%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.84%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.84%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.84%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.84%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.84%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.84%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.84%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.84%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.42%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.42%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.42%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.42%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.42%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.42%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.42%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.42%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.42%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.42%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.42%
Sugar Cane Bagasse Incubating Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor	0.42%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2189573001	Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)	Environmental
3300000156	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic	Engineered
3300001305	Grasslands soil microbial communities from Hopland, California, USA	Environmental
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental
3300002914	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm	Environmental
3300004100	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome)	Environmental
3300004104	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)	Environmental
3300004139	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome)	Environmental
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental
3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Host-Associated
3300005168	Soil and rhizosphere microbial communities from Laval, Canada - mgLPC	Environmental
3300005174	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129	Environmental
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005650	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome)	Environmental
3300005712	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005949	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051	Environmental
3300005993	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046	Environmental
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated
3300009650	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061	Environmental
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental
3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)	Environmental
3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)	Environmental
3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)	Environmental
3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)	Environmental
3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)	Environmental
3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)	Environmental
3300020140	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)	Environmental
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental
3300020199	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)	Environmental
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental
3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Environmental
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)	Environmental
3300022507	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)	Environmental
3300022531	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)	Environmental
3300022724	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)	Environmental
3300025544	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)	Environmental
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated
3300026216	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes)	Environmental
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental
3300027376	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes)	Environmental
3300027587	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)	Environmental
3300027591	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)	Environmental
3300027616	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)	Environmental
3300027773	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)	Environmental
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental
3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Host-Associated
3300030842	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)	Environmental
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031122	Oak Spring Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental
3300031469	Fir Spring Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FD2_08480930	2189573001	Grass Soil	MDAKWNDIVDNTMVRIGMVVIGFGAWLAIGYGLLAA
NODE_06205282	3300000156	Sugar Cane Bagasse Incubating Bioreactor	MSAKWNNVVDNAMVRIAMVVAGFGAWLAIGYRLLAG*
C688J14111_100014226	3300001305	Soil	MDAKWNNIVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
JGI12627J18819_103022551	3300001867	Forest Soil	MSAKWNNVVDNAMVRIAMVAVVFGAWLAIGYRLLSV*
JGIcombinedJ26739_1005381272	3300002245	Forest Soil	MDAKWNNVVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
C688J35102_1209657575	3300002568	Soil	LEEIMDAKWNNIVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
JGI25617J43924_101979411	3300002914	Grasslands Soil	VNSEEIMDAKWNNIIDNAMVRVTLVVLGFGAWLAISYGLLSL*
Ga0058904_13142922	3300004100	Forest Soil	QEAIMDAKWNKVIDNFAVRTGMLVFAFGVWLAIAYGVLAA*
Ga0058891_15601862	3300004104	Forest Soil	MENFGGDIMDAKWNNLIDNTLVRVLLIVVGFGVWLVVSYELLSL*
Ga0058897_109797701	3300004139	Forest Soil	QKRNDRREIMDAKWNNVVDNFVVRVTLIALGFGAWLAIGYGLLSL*
Ga0062595_1007234142	3300004479	Soil	NHSEAVIMDAKWNNLVDNMAVRIGLVVVGFSAWLALGYSLLS*
Ga0058861_100499772	3300004800	Host-Associated	MVQAEPVMDAKWNRIIDNGAVRIGMIVAVFGVWLAISYGLLAA*
Ga0066809_100177272	3300005168	Soil	LEAVMDAKWNNIVDNTMVRIGMVVIGFGAWLAIGYGLLAA*
Ga0066680_108267132	3300005174	Soil	SKARQKDLQHETNSLEAVMDAKWNDIVDNTMVRIGMVVIGFGAWLAIGYGLLAA*
Ga0066388_1023460002	3300005332	Tropical Forest Soil	MEAVMDAKWNAIVDNTAVRIAMVVVGFGAWLAIGYSLLLV*
Ga0070692_102677462	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	MQHNSLEDVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0070709_100583543	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MEAVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0070709_101972902	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MQHNSLEDVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLSA*
Ga0070713_1000414652	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	VQHNSLEDVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0070713_1003249872	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	LEDVMDAKWNNIVDNTMVRIAMVVVGFSAWLAIGYGLLAA*
Ga0070713_1023598542	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MEIGSDFMDAKWNNIVDNAAVRMGAVIVVFGAWLAISYSLMK*
Ga0070711_1014721922	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	LEAFMDAKWNNIVDNTMVRIGMVVIGFGAWLALGYGLLAA*
Ga0073909_100150823	3300005526	Surface Soil	MDAKWNNIVDNTMVRVGMVIVGFGAWLAIGYSLLAS*
Ga0073909_106820721	3300005526	Surface Soil	MDAKWNNIVDNTMVRVGMVIVGFGAWLAIGYGLLAS*
Ga0070741_1000605918	3300005529	Surface Soil	MSAKWNNVIDNAMVRIAMVVVGFGTWLAIGYRLLAG*
Ga0070741_100457712	3300005529	Surface Soil	MDAKWNKVVDNFAVRTGMLVLGFAVWLAVAYGVLAA*
Ga0070734_1000247720	3300005533	Surface Soil	MDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYSLLAA*
Ga0070734_100730324	3300005533	Surface Soil	MDAKWNNLVDNTMVRIAMVVVGFGAWLAIGYGLLAV*
Ga0070730_100349762	3300005537	Surface Soil	MDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0070730_100800603	3300005537	Surface Soil	MDAKWNNIADNTMVRIGLVVVGFGAWLAIGYGLLAA*
Ga0070730_101280132	3300005537	Surface Soil	MDAKWNNVVDNMAVRIGLVIVGFGAWLALGYGLLSI*
Ga0068853_1011644692	3300005539	Corn Rhizosphere	MVQAESVMDAKWNRIIDNGAVRIGMIVAIFGVWLAISYGLLAA*
Ga0070732_100728493	3300005542	Surface Soil	MDAKWNDIVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0070732_102018332	3300005542	Surface Soil	SGGVMDAKWNNIVDNTMVRIGLVVVGFGAWLAIGYGLLAA*
Ga0070732_105143532	3300005542	Surface Soil	MDAKWNNIVDNTMVRIGLVVVGFGAWLAIGYGLLA
Ga0066661_102191743	3300005554	Soil	MDSKWNKVVDNFAVRTGMLVLGFGVWLAVAYGVLAA*
Ga0066692_100243192	3300005555	Soil	MDAKWNNIVDNTMVRIAMVVVGFGAWLAVSYGLLSA*
Ga0066670_106437072	3300005560	Soil	MDAKWNAVVDNLAVRTLLLAAGFGTWLAIGYGLLSLS*
Ga0068855_1004045452	3300005563	Corn Rhizosphere	MDAKWNKIVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0066702_104356632	3300005575	Soil	MDAKWNNLVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0066702_105844982	3300005575	Soil	MDAKWNNIVDNMAVRIAMVVVGFGAWLAIGYSLLAV*
Ga0068854_1007919902	3300005578	Corn Rhizosphere	MVQAESVMDAKWNRIIDNGAVRIGMIVAVFGVWLAISYGLLAA*
Ga0068856_1001606712	3300005614	Corn Rhizosphere	MDAKWNKVVDNAAVRIAAMLAFFGVWLAISYGLLAA*
Ga0068856_1027211412	3300005614	Corn Rhizosphere	MDAKWNRIIDNGAVRIGMIVAIFGVWLAISYGLLAA*
Ga0068852_1016793962	3300005616	Corn Rhizosphere	MDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAG*
Ga0075038_108808621	3300005650	Permafrost Soil	HLLEEVMDSKWNNIVDNTMVRIGMLVVGFGAWLAIGYRLLAV*
Ga0070764_108731611	3300005712	Soil	MDAKWNNVIDNTMVRIAMVVVGFGAWLAIGYGLMSL*
Ga0066903_1002335552	3300005764	Tropical Forest Soil	MDAKWNNIVDNMAVRIGLVVVGFSAWLALGYSLLSA*
Ga0066903_1003062692	3300005764	Tropical Forest Soil	MDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYSLLAG*
Ga0066903_1005801181	3300005764	Tropical Forest Soil	MDAKWNNVVDKAMVRIAMVVVVFSAWFAIGYRLLAG*
Ga0066903_1008621282	3300005764	Tropical Forest Soil	MDAKWNAIVDNTAVRIAMVVVGFSAWLAIGYSLLLV*
Ga0066791_100056062	3300005949	Soil	MDAKWNNIIDSAAVRMGMLVAVFGAWLAISYSLLK*
Ga0080027_101278252	3300005993	Prmafrost Soil	AHLLEEVMDSKWNNIVDNTMVRIGMLVVGFGAWLAIGYRLLAV*
Ga0070717_102171971	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLSA*
Ga0070717_105747542	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MDAKWNNIVDNTMVRVGMVIIGFGAWLAIGYGLLAS*
Ga0070717_107574093	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MDAKWNNIVDNTMVRIAMVVVGFSAWLAIGYGLLAA*
Ga0070717_114143461	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MDAKWNDIVDNTMVRIGMVVIGFGAWLAIGYGLLAA*
Ga0066652_1015130922	3300006046	Soil	MIMDAKWNNVADNLAVRALLLVAGFGTWLAVSYGLLSLA*
Ga0075024_10000023015	3300006047	Watersheds	MDPKWNNIVDNMAVRIVLIIAGFSVWLAVSYGLLSA*
Ga0075028_1000186793	3300006050	Watersheds	MEAVMDSKWNAIVDNIAVRIGMVIVGFSVWLAVSYGLLSA*
Ga0075028_1002311622	3300006050	Watersheds	MDAKWNNIADNTMVRIALVVVGFGAWLALGYGLLAA*
Ga0070715_103948962	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	RRVIMDAKWNNIVDNTIVRIGMVVAGFSAWLLVGYRLLSL*
Ga0075018_100468942	3300006172	Watersheds	MDSKWNAIVDNIAVRIGMVIVGFSVWLAVSYGLLSA*
Ga0070716_1013568261	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MEAVMDAKWNNIVDNTVVRIAMVVVGFGAWLAIGYGLLAA*
Ga0070712_1000485594	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MDAKWNNIVDNTMVRIGMVVIGFGAWLAIGYGLLAA*
Ga0070765_1014394262	3300006176	Soil	MDAKWNNLVDNAMVRIAMVVVGFGAWFAIGNTLLAS*
Ga0075021_109905921	3300006354	Watersheds	MDARWNKVVDNIVVRITLIAVGFGAWLAVSYSLLSL*
Ga0066653_101587291	3300006791	Soil	RTIMDAKWNAVVDNLAVRTLLLAAGFGTWLAIGYGLLSLS*
Ga0066658_102121523	3300006794	Soil	MDAKWNKVVDNFAVRAGMLVLAFGVWLAIAYGVLAGQ*
Ga0066660_104182632	3300006800	Soil	MDAKWNNIVDNMAVRIAMVVVGFGAWSAIGYSLLAV*
Ga0066660_106793852	3300006800	Soil	MDAKWNKVVDNLAVRTLMLAAGFGAWLAISYGLLSLS*
Ga0066660_108154011	3300006800	Soil	WRTIMDAKWNNVVDHIAVRIGMVVIGFGAWFALGYSLLAG*
Ga0075425_1004712702	3300006854	Populus Rhizosphere	MDAKWNAVADNLAVRALLVVAGFGAWLAISYGLLSLS*
Ga0075434_1012571332	3300006871	Populus Rhizosphere	MDAKWNAIVDNTAVRIAMVVVGFGAWLAIGYSLLLV*
Ga0075426_108683531	3300006903	Populus Rhizosphere	MDAKWNRIIDNGAVRIVMIVAVFGVWLAISYGLLAA*
Ga0079219_100647991	3300006954	Agricultural Soil	MDAKWNNIVDSAAVRIGTVVVGFSVWLAICYGLLSSY*
Ga0099795_100478882	3300007788	Vadose Zone Soil	LQHENKQIFLEDVMDAKWNDIVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
Ga0099829_100668702	3300009038	Vadose Zone Soil	MDAKWNNVIDNGAVRISMVVVAFSAWLAISYSLLAN*
Ga0099830_101365992	3300009088	Vadose Zone Soil	MDAKWNNVIDNGAVRISMMVVAFSAWLAISYSLLAN*
Ga0099830_108446042	3300009088	Vadose Zone Soil	MDAKWNKVVDNMAVRMVLLVAGFGAWFAIGYGLLSL*
Ga0099827_113610441	3300009090	Vadose Zone Soil	MDAKWNNVMDNALVRVTLVIVGFGAWLAISYGLLSL*
Ga0105240_126227782	3300009093	Corn Rhizosphere	VQAESVMDAKWNRIIDNGAVRIGMIVAIFGVWLAISYGLLAA*
Ga0099792_100346592	3300009143	Vadose Zone Soil	MDAKWNDIVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
Ga0105241_100745654	3300009174	Corn Rhizosphere	MDAKWNNIVDNTMVRIGMVVVGFSAWLAIGYGLLAS*
Ga0105237_108741221	3300009545	Corn Rhizosphere	MDAKWNRIIDNGAVRIGMIVAVFGVWLAISYGLLAA*
Ga0105857_10424572	3300009650	Permafrost Soil	MDSKWNNIVDNTMVRIGMLVVGFGAWLAIGYRLLAV*
Ga0126384_108420522	3300010046	Tropical Forest Soil	MDAKWNNIVDNMAVRIAMVVVGFGAWLAIGYSLLAA*
Ga0126373_106427202	3300010048	Tropical Forest Soil	MSAKWNNVIDNAMVRIAMVVVVFGAWLAIGYRLLAG*
Ga0127503_103739222	3300010154	Soil	MDAKWNDLVDNTMVRIAMVVVGFGAWLAIGYSLLLV*
Ga0126370_110712332	3300010358	Tropical Forest Soil	MDAKWNDIVDNTMVRIAMVVIGFGAWLAIGYGLLAA*
Ga0126370_119677041	3300010358	Tropical Forest Soil	MDAKWNDIVDNTMVRIGMVVIGFGAWLAIGYGLLAG*
Ga0126376_128610672	3300010359	Tropical Forest Soil	MDAKWNDTVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
Ga0126378_1000010733	3300010361	Tropical Forest Soil	MDAKWNNIVDNAAVRIAMVVVVFGAWFAIGYRLLAG*
Ga0126378_106932311	3300010361	Tropical Forest Soil	MSAKWNNVVDNTLVRIGMVVVVFGAWFAIGYRLLSL*
Ga0126378_121765732	3300010361	Tropical Forest Soil	MDAKWNNIVDHTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0134125_100822442	3300010371	Terrestrial Soil	MDAKWNNIMDNAAVRIGAVVVVLGVWVAIAYGLLAA*
Ga0134125_100920392	3300010371	Terrestrial Soil	MSAKWNNVIDNAMVRIAMVVVGFGAWLAIGYRLLAG*
Ga0134125_101024752	3300010371	Terrestrial Soil	MDAKWNNVIDNAAVRIGMVVAVFGVWLAVTYGLLAS*
Ga0134128_100789414	3300010373	Terrestrial Soil	MDAKWNKIVDNAAVRIAAMLAFFGVWLAISYGLLAA*
Ga0134128_105171472	3300010373	Terrestrial Soil	MDFLEDVMDAKWNNIVDNTMVRIGLVVVGFGAWLAIGYGLLAA*
Ga0105239_133812352	3300010375	Corn Rhizosphere	AKWNRIIDNGAVRIGMIVAVFGVWLAVSYGLLAA*
Ga0134126_126843521	3300010396	Terrestrial Soil	MVQAESVMDAKWNRIIDNGAVRIGMIVAVFGVWLAVSYGLLAA*
Ga0134127_118218052	3300010399	Terrestrial Soil	MDAKWNKIVDNAAVRVAAMLAFFGVCLAISYGLLAA*
Ga0150983_107306952	3300011120	Forest Soil	GILYLEITMDAKWNNIVDNAAVRIAMIVVGFGAWLAIGYGLLSI*
Ga0150983_119543251	3300011120	Forest Soil	KSSKQLQHENTADFLEDVMDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
Ga0150983_146606091	3300011120	Forest Soil	MDSKWNSIIDHTGVRIAMVVIGFGAWLAISYGLLAA*
Ga0150983_149044512	3300011120	Forest Soil	MDAKWNRVVDNIAIRIGMVVVGFGLWLAISYGLLSL*
Ga0150983_149861561	3300011120	Forest Soil	MDAKWNNVVDNFVVRVTLIALGFGAWLAIGYGLLSL*
Ga0137392_100359623	3300011269	Vadose Zone Soil	MDAKWNNIIDNAMVRVTLVVLGFGAWLAISYGLLSL*
Ga0137392_104801902	3300011269	Vadose Zone Soil	LEDVMDAKWNDIVDNTMVRIGMVVLGFGAWLVIGYGLLAA*
Ga0137393_100445314	3300011271	Vadose Zone Soil	MDAKWNDIVDNTMVRIGMVVLGFGAWLVIGYGLLAA*
Ga0137388_114660261	3300012189	Vadose Zone Soil	MDSKWNSVVDNPAVRIAMVVVGFGAWLAISYGLLAA*
Ga0137363_1000000523	3300012202	Vadose Zone Soil	MENFGGDIMDAKWNNLIDNTLVRVLLIVVGFGVWLAVSYELLSL*
Ga0137363_100095844	3300012202	Vadose Zone Soil	LEGQIVDAKWNNIVDNTMVRIAMMVAGFGAWLVVSYGLLAA*
Ga0137378_100271402	3300012210	Vadose Zone Soil	MDTKWNNIFDNTAVRIAMIVVGFGAWLAIGYGILAS*
Ga0137378_100615372	3300012210	Vadose Zone Soil	MDAKWNNIVDNTAVRIVMIVVGFGTWLAIGYGILAA*
Ga0150985_1110353971	3300012212	Avena Fatua Rhizosphere	VKECSNRSVTYLEEVMDAKWNSVVDNMAVRISMVVIGFGAWFALGYSLLAG*
Ga0150985_1127472761	3300012212	Avena Fatua Rhizosphere	NGFFLEEIMDAKWNNIVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
Ga0137387_106010712	3300012349	Vadose Zone Soil	MDAKWNNIFDNTAVRIAMIVVGFGAWLAIGYGILAS*
Ga0137386_104019701	3300012351	Vadose Zone Soil	MDAKWNNIVDNTVVRIVMIVVGFGAWLAIGYGILAA*
Ga0137384_1000001347	3300012357	Vadose Zone Soil	MDAKWNAIVDNTAVRIAMVVVGFGAWLAISYGLLAA*
Ga0137385_107874252	3300012359	Vadose Zone Soil	EIVEASVDTKWNNIFDNTAVRIAMIVVGFGAWLAIGYGILAS*
Ga0137358_102303982	3300012582	Vadose Zone Soil	LEGQIVDAKWNNIVDNTMVRIAMMVAGFGAWLVVSYSLLAA*
Ga0137398_107037112	3300012683	Vadose Zone Soil	MDAKWNNIVDNTAVRIAMIVVGFGAWLAIGYGILAS*
Ga0137397_108037971	3300012685	Vadose Zone Soil	METKWNNITDNTVVRIALIVVGFGAWLAIGYGILAA*
Ga0137416_119458501	3300012927	Vadose Zone Soil	MGAKWNKVVDNFAVRAGMLVLAFGVWLAIAYGVLAGR*
Ga0137404_118261491	3300012929	Vadose Zone Soil	LQHENKQIFLEDVMDAKWNDIVDNTMVRIGMVMVGFGAWLAIGYGLLAA*
Ga0137407_101352701	3300012930	Vadose Zone Soil	NKQIFLEDVMDAKWNDIVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
Ga0137407_104899672	3300012930	Vadose Zone Soil	LQHENKQIFLEDVMDAKWNDIVDNTMVRIGMVVVGFGAWLAIGY
Ga0153915_119784121	3300012931	Freshwater Wetlands	MDAKWNNIVDNLAVRIGALVVGFGIWLAVSYALLAA*
Ga0153915_125049712	3300012931	Freshwater Wetlands	MDPKWNNLVDNMAVRIGMVVVGFALWLAVSYGLLSA*
Ga0153915_126971391	3300012931	Freshwater Wetlands	MDAKWNNIVDNLAVGIGALVLGFIIWLAVSYALVAA*
Ga0137410_104493272	3300012944	Vadose Zone Soil	MDAKWNNVMDNTAVRIGMLVVGFGAWLAIGYGLLAG*
Ga0164300_110653162	3300012951	Soil	WRRFMDAKWNNIVDNTMVRIGMVVIGFGAWLAIGYGLLAA*
Ga0164298_100033975	3300012955	Soil	MDAKWNNIVDNTMVRIGMVVVGFGAWLAISYGLLAA*
Ga0164303_102251632	3300012957	Soil	MDAKWNNIVDNTMVRIGLVVVGFGAWLAIGYSLLAA*
Ga0164303_115497511	3300012957	Soil	MDAKWNDIVDNTMVRIGMMVIGFGAWLAIGYGLLAA*
Ga0164299_108226591	3300012958	Soil	VMDAKWNNIVDKTMVRIGMVVIGFGAWLAIGYGLLAA*
Ga0164301_102270182	3300012960	Soil	LQHEKTTDFFLEDVMDAKWNNIVDNTMVRIGLVVVGFGAWLAIGYSLLAA*
Ga0164301_104039642	3300012960	Soil	MQHNSLEDVMDAKWNNIVDNTMVRIAMVVIGFGAWLAIGYGLLAA*
Ga0164307_100987982	3300012987	Soil	MDARWNTVVDHVAVRIGMVVIGFGAWFALGYGLLSA*
Ga0157374_129358731	3300013296	Miscanthus Rhizosphere	DFLEDVMDAKWNNIVDNTMVRIGMVVVGFSAWLAIGYGLLAS*
Ga0137418_104116832	3300015241	Vadose Zone Soil	MDAKWNKVVDNMAVRTVLLVAGFGAWFAIGYGLLSL*
Ga0137418_112399472	3300015241	Vadose Zone Soil	MDAKWNNIVDNTAVRIVMIVVGFGAWLAIGYGILAA*
Ga0137412_102184942	3300015242	Vadose Zone Soil	LQHDKQTDFLGGVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAG*
Ga0132257_1044792801	3300015373	Arabidopsis Rhizosphere	MEAVMDAKWNAIVDNTAVRIAMVVVGFSAWLAIGYSLLLV*
Ga0187822_101802332	3300017994	Freshwater Sediment	MDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0066655_104474681	3300018431	Grasslands Soil	MNAKWNKVVDNFAVRTGMLVLGFGVWLAVAYGVLAA
Ga0066662_100024947	3300018468	Grasslands Soil	MDAKWNKVVDNLAVRTLMLAAGFGAWLAISYGLLSLS
Ga0066662_101059902	3300018468	Grasslands Soil	MDAKWNKVVDNLAVRTVMLAVGFGTWLAIGYGLLSLS
Ga0066662_101153623	3300018468	Grasslands Soil	MDSKWNKVVDNFAVRTGMLVLGFGVWLAVAYGVLAA
Ga0066662_108367961	3300018468	Grasslands Soil	MDAKWNNVVDHIAVRIGMVVIGFGAWFALGYSLLAG
Ga0066662_109912422	3300018468	Grasslands Soil	MDAKWNKVVDNFAVRAGMLVLAFGVWLAIAYGVLAGQ
Ga0066662_111229002	3300018468	Grasslands Soil	MDAKWNNIVDNMAVRIAMVVVGFGAWLAIGYSLLAV
Ga0066662_128069992	3300018468	Grasslands Soil	MDAKWNAVVDNLAVRTLLLAAGFGTWLAIGYGLLSLS
Ga0066669_101016641	3300018482	Grasslands Soil	MDAKWNTIIDNLAVRTVLLVVGFGAWLAISYGFLAL
Ga0137408_11122752	3300019789	Vadose Zone Soil	MDAKWNDIVDNTMVRIGMVMVGFGAWLAIGYGLLAA
Ga0197907_108262162	3300020069	Corn, Switchgrass And Miscanthus Rhizosphere	MVQAEPVMDAKWNRIIDNGAVRIGMIVAVFGVWLAVSYGLLAA
Ga0206356_117512941	3300020070	Corn, Switchgrass And Miscanthus Rhizosphere	NAGFQEKVMDAKWNKVVDNAAVRIAAMLAFFGVWLAISYGLLAA
Ga0206355_11678532	3300020076	Corn, Switchgrass And Miscanthus Rhizosphere	MVQAESVMDAKWNRIIDNGAVRIGMIVAIFGVWLAISYGLLAA
Ga0206351_108829232	3300020077	Corn, Switchgrass And Miscanthus Rhizosphere	MDAKWNRIIDNGAVRIGMIVAIFGVWLAISYGLLAA
Ga0206352_102753691	3300020078	Corn, Switchgrass And Miscanthus Rhizosphere	MVQAESVMDAKWNRIIDNGAVRIGMIVAVFGVWLAISYGLLAA
Ga0206352_104373332	3300020078	Corn, Switchgrass And Miscanthus Rhizosphere	DAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0206352_112878621	3300020078	Corn, Switchgrass And Miscanthus Rhizosphere	MDAKWNNIVDNTMVRIGMVVVGFSAWLAIGYGLLAS
Ga0206352_113259851	3300020078	Corn, Switchgrass And Miscanthus Rhizosphere	RMVQAESVMDAKWNRIIDNGAVRIGMIVAVFGVWLAVSYGLLAA
Ga0206353_111243221	3300020082	Corn, Switchgrass And Miscanthus Rhizosphere	MDAKWNRIIDNGAVRIGMIVAVFGVWLAISYGLLAA
Ga0179590_10736022	3300020140	Vadose Zone Soil	MDAKWNNIVDNTMVRIGMVVVGFGAWLAIGYGLLAG
Ga0179594_101119032	3300020170	Vadose Zone Soil	LQHENKQIFLEDVMDAKWNDIVDNTMVRIGMVVVGFGAWLAIGYGLLAA
Ga0179594_101176402	3300020170	Vadose Zone Soil	MDAKWNTIVDNTAVRIAMVVVGFGAWLAISYGLLAA
Ga0179592_101274292	3300020199	Vadose Zone Soil	LEGQIVDAKWNNIVDNTMVRIAMMIAGFGAWLVVSYSLLAA
Ga0210407_100009215	3300020579	Soil	MDAKWNNVVDNFVVRVTLIALGFGAWLAIGYGLLSL
Ga0210407_102961952	3300020579	Soil	MDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLAA
Ga0154015_10694641	3300020610	Corn, Switchgrass And Miscanthus Rhizosphere	MDAKWNRIIDNGAVRIGMIVAVFGVWLAVSYGLLAA
Ga0210400_100086583	3300021170	Soil	MDAKWNKYIDNFAVRTGMLVLGFGMWLLISYGVLAA
Ga0210400_103303823	3300021170	Soil	MDAKWNKVIDNFAVRTGMLVFAFGVWLAIAYGVLAA
Ga0210408_100002729	3300021178	Soil	MDAKWNRVVDNIAIRIGMVVVGFGLWLAISYGLLSL
Ga0210397_10000008266	3300021403	Soil	MSAKWNNIIDNAMVRIAMVAVVFSTWLAIGYKLLSV
Ga0210397_108422971	3300021403	Soil	KAALTNRNYLEGCMDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLAV
Ga0210397_111357311	3300021403	Soil	MDAKWNNVIDNSMVRIAMVVVGFGAWLAIGYGLMSL
Ga0210389_111479331	3300021404	Soil	MDAKWNNLADNTMVRIAMVVVGFGAWLAIGYGLLAV
Ga0210389_112735111	3300021404	Soil	MDAKWNSIVDNSMVRIAMVVVGFGTWLAIGYGLLSI
Ga0210392_107494212	3300021475	Soil	MDAKWNNVIDNSMVRIAMVVVGFGAWLAIGYGLLAV
Ga0126371_100236803	3300021560	Tropical Forest Soil	MEIMMDAKWNNLVDNMAVRIGMMAVIFGAWLVISYGLLSA
Ga0126371_130789011	3300021560	Tropical Forest Soil	MSAKWNNVIDNAMVRIAMVVVVFGAWLAIGYRLLAG
Ga0224712_102187401	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	GFQEKVMDAKWNKVVDNAAVRIAAMLAFFGVWLAISYGLLAA
Ga0222729_10420552	3300022507	Soil	QKRNDRREIMDAKWNNVVDNFVVRVTLIALGFGAWLAIGYGLLSL
Ga0242660_10785801	3300022531	Soil	MENFGGDIMDAKWNNLIDNTLVRVLLIVVGFGVWLVVSYELLSL
Ga0242660_11722202	3300022531	Soil	MDAKWNNIVDNALVRTTLIVLGFGAWLAISYGLLSLF
Ga0242660_12149271	3300022531	Soil	IMDAKWNNIVDKTSVRLLLLAVGFGVWLAIGYGILAAA
Ga0242665_100245562	3300022724	Soil	NRQTVNNQEAVMDAKWNKVVDNFVVRTGMLVLGFGVWLAISYGVLAALG
Ga0208078_10061793	3300025544	Arctic Peat Soil	MDAKWNNIVHNTMVRIGMVVVGFGAWLAIGYGLLAA
Ga0207692_109573421	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	RFMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0207707_114027202	3300025912	Corn Rhizosphere	AESVMDAKWNRIIDNGAVRIGMIVAIFGVWLAISYGLLAA
Ga0207695_101037072	3300025913	Corn Rhizosphere	MDAKWNKIVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0207695_110465032	3300025913	Corn Rhizosphere	MDAKWNNVVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0207693_108052711	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	EDVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYSLLAA
Ga0207652_102864462	3300025921	Corn Rhizosphere	GGVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0207700_100177367	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	NEGVQHNSLEDVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLSA
Ga0207664_119057372	3300025929	Agricultural Soil	MDAKWNNIVDNTMVRIAMVVVGFSAWLAIGYGLLAA
Ga0207667_111366191	3300025949	Corn Rhizosphere	RERAAGFQEKVMDAKWNKVVDNAAVRIAAMLAFFGVWLAISYGLLAA
Ga0207702_101795102	3300026078	Corn Rhizosphere	MDAKWNDIVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0207702_102808492	3300026078	Corn Rhizosphere	MDAKWNKVVDNAAVRIAAMLAFFGVWLAISYGLLAA
Ga0209903_10048013	3300026216	Soil	MDAKWNNIIDSAAVRMGMLVAVFGAWLAISYSLLK
Ga0209647_100389211	3300026319	Grasslands Soil	MDAKWNNIVDNTAVRIAMLVVGFGAWLAIGYSLLAS
Ga0209647_11114292	3300026319	Grasslands Soil	MDAKWNTIVDNTAVRIAMVVVGFGAWLAISYGLLAAA
Ga0209648_102066362	3300026551	Grasslands Soil	MDAKWNNIIDNAMVRVTLVVLGFGAWLAISYGLLSL
Ga0179587_100135862	3300026557	Vadose Zone Soil	VDAKWNNIVDNTMVRIAMMIAGFGAWLVVSYSLLAA
Ga0209004_10053362	3300027376	Forest Soil	MDAKWNNIVDNTMVRIAMVVIGFGAWLAIGYGLLAA
Ga0209220_10236362	3300027587	Forest Soil	MDAKWNKVVDNFAVRTGMLVLGFGVWLAITYGVLAA
Ga0209733_10317333	3300027591	Forest Soil	MDSKWNNIVDNTMVRIGMLVVGFGAWLAIGYRLLAV
Ga0209106_10174212	3300027616	Forest Soil	MDAKWNNVMDNTAVRIGMLVVGFGAWLAIGYGLLAG
Ga0209810_10071876	3300027773	Surface Soil	MSAKWNNVVDNTMVRIGMVVVGFGTWFAIGYRLMSL
Ga0209060_1000068134	3300027826	Surface Soil	MDAKWNKVIDNMAIRTAMVAVGFGAWLALSYGLLAL
Ga0209060_100491982	3300027826	Surface Soil	MDAKWNNLVDNTMVRIAMVVVGFGAWLAIGYGLLAV
Ga0209180_105317551	3300027846	Vadose Zone Soil	MDAKWNNVIDNGAVRISMVVVAFSAWLAISYSLLAN
Ga0209166_100057176	3300027857	Surface Soil	MDAKWNKVVDNFVVRTGMLVIGFGVWLAITYGVLAA
Ga0209166_100143803	3300027857	Surface Soil	MDAKWNNVVDNMAVRIGLVIVGFGAWLALGYGLLSI
Ga0209166_101926562	3300027857	Surface Soil	MDAKWNNIADNTMVRIGLVVVGFGAWLAIGYGLLAA
Ga0209701_101078932	3300027862	Vadose Zone Soil	MDAKWNNVIDNGAVRISMMVVAFSAWLAISYSLLAN
Ga0209590_103937493	3300027882	Vadose Zone Soil	MDAKWNNVMDNALVRVTLVIVGFGAWLAISYGLLSL
Ga0209069_100278811	3300027915	Watersheds	MDPKWNNIVDNMAVRIVLIIAGFSVWLAVSYGLLSA
Ga0137415_114799321	3300028536	Vadose Zone Soil	MDAKWNNIVDNTAVRIAMIVVGFGAWLAIGYGILAS
Ga0265338_100792134	3300028800	Rhizosphere	MDAKWNNVIDNTMVRIAMVAVGFGAWLAIGYGLMSL
Ga0075404_111808693	3300030842	Soil	MDAKWNNLADNTMVRIGMVVVGFGAWLAIGYGLLAA
Ga0170834_1084661072	3300031057	Forest Soil	MDAKWNDIVDNTMVRIGMVVIGFGAWLAIGYGLLAG
Ga0170822_133207363	3300031122	Forest Soil	MDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLAS
Ga0170824_1018110273	3300031231	Forest Soil	MDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLA
Ga0170824_1035820251	3300031231	Forest Soil	DSPEDVMDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLAA
Ga0170819_103223332	3300031469	Forest Soil	MDAKWNNLVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0170819_147698431	3300031469	Forest Soil	PEDVMDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLAA
Ga0170819_166187022	3300031469	Forest Soil	GRDFMDAKWNNVIDRASVRISMVVLAFGAWLAISYSLLK
Ga0170818_1152331252	3300031474	Forest Soil	FTEIGRDFMDAKWNNVIDRASVRISMVVLAFGAWLAISYSLLK
Ga0307468_1023559331	3300031740	Hardwood Forest Soil	MDAKWNNIVDNTIVRIGMVVAGFSAWLLVGYRLLSL
Ga0307472_1012720281	3300032205	Hardwood Forest Soil	MDAKWNAIVDNAAVRIAMVVVGFSAWLAIGYSLLLV
Ga0310811_107814092	3300033475	Soil	MDAKWNKIVDNAAVRIAAMLAFFGVWLAISYGLLAA
Ga0316620_104678101	3300033480	Soil	EVMDAKWNNIVDNLAVRIGALVVGFGIWLAVSYALLAA
Ga0316624_100561861	3300033486	Soil	MDAKWNNIVDNLAVRIGALVVGFGIWLAVSYALLAA