NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F018095

Metagenome / Metatranscriptome Family F018095

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F018095
Family Type Metagenome / Metatranscriptome
Number of Sequences 237
Average Sequence Length 38 residues
Representative Sequence MDAKWNNIVDNTMVRIGMVVVGFGAWLAIGYGLLAA
Number of Associated Samples 168
Number of Associated Scaffolds 237

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 78.29 %
% of genes near scaffold ends (potentially truncated) 12.66 %
% of genes from short scaffolds (< 2000 bps) 53.16 %
Associated GOLD sequencing projects 149
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (50.211 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(16.456 % of family members)
Environment Ontology (ENVO) Unclassified
(29.536 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.789 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 51.56%    β-sheet: 0.00%    Coil/Unstructured: 48.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 237 Family Scaffolds
PF04551GcpE 54.43
PF03631Virul_fac_BrkB 13.92
PF02518HATPase_c 4.22
PF02566OsmC 2.11
PF00486Trans_reg_C 1.27
PF01411tRNA-synt_2c 1.27
PF02515CoA_transf_3 0.42
PF04366Ysc84 0.42
PF07813LTXXQ 0.42
PF01134GIDA 0.42
PF00069Pkinase 0.42
PF07638Sigma70_ECF 0.42
PF01381HTH_3 0.42
PF13478XdhC_C 0.42
PF01040UbiA 0.42
PF07228SpoIIE 0.42
PF00282Pyridoxal_deC 0.42
PF13432TPR_16 0.42
PF00582Usp 0.42
PF04307YdjM 0.42

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 237 Family Scaffolds
COG08214-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpELipid transport and metabolism [I] 54.43
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 13.92
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 2.11
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 2.11
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.69
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 1.69
COG0013Alanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.27
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.42
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.42
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.42
COG1988Membrane-bound metal-dependent hydrolase YbcI, DUF457 familyGeneral function prediction only [R] 0.42
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.42


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A50.21 %
All OrganismsrootAll Organisms49.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M102F7CIHNot Available532Open in IMG/M
3300000156|NODE_c0620528All Organisms → cellular organisms → Bacteria1824Open in IMG/M
3300001305|C688J14111_10001422All Organisms → cellular organisms → Bacteria → Acidobacteria6333Open in IMG/M
3300001867|JGI12627J18819_10302255Not Available644Open in IMG/M
3300002245|JGIcombinedJ26739_100538127All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300002568|C688J35102_120965757All Organisms → cellular organisms → Bacteria3442Open in IMG/M
3300002914|JGI25617J43924_10197941Not Available668Open in IMG/M
3300004104|Ga0058891_1560186All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300004479|Ga0062595_100723414All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300005168|Ga0066809_10017727All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300005332|Ga0066388_102346000All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300005345|Ga0070692_10267746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1030Open in IMG/M
3300005434|Ga0070709_10058354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172447Open in IMG/M
3300005434|Ga0070709_10197290All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1423Open in IMG/M
3300005436|Ga0070713_100041465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3750Open in IMG/M
3300005436|Ga0070713_100324987All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1421Open in IMG/M
3300005439|Ga0070711_101472192Not Available594Open in IMG/M
3300005526|Ga0073909_10015082All Organisms → cellular organisms → Bacteria2423Open in IMG/M
3300005526|Ga0073909_10682072Not Available514Open in IMG/M
3300005529|Ga0070741_10006059All Organisms → cellular organisms → Bacteria26268Open in IMG/M
3300005533|Ga0070734_10002477All Organisms → cellular organisms → Bacteria22202Open in IMG/M
3300005533|Ga0070734_10073032Not Available2037Open in IMG/M
3300005537|Ga0070730_10034976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3753Open in IMG/M
3300005537|Ga0070730_10080060Not Available2290Open in IMG/M
3300005537|Ga0070730_10128013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1737Open in IMG/M
3300005542|Ga0070732_10072849All Organisms → cellular organisms → Bacteria2004Open in IMG/M
3300005542|Ga0070732_10201833All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300005542|Ga0070732_10514353Not Available725Open in IMG/M
3300005555|Ga0066692_10024319All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3125Open in IMG/M
3300005560|Ga0066670_10643707Not Available644Open in IMG/M
3300005563|Ga0068855_100404545All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1495Open in IMG/M
3300005575|Ga0066702_10435663Not Available803Open in IMG/M
3300005575|Ga0066702_10584498All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005616|Ga0068852_101679396Not Available658Open in IMG/M
3300005650|Ga0075038_10880862All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300005712|Ga0070764_10873161Not Available562Open in IMG/M
3300005764|Ga0066903_100233555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2809Open in IMG/M
3300005764|Ga0066903_100306269All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2520Open in IMG/M
3300005764|Ga0066903_100580118All Organisms → cellular organisms → Bacteria1935Open in IMG/M
3300005764|Ga0066903_100862128All Organisms → cellular organisms → Bacteria1632Open in IMG/M
3300005949|Ga0066791_10005606All Organisms → cellular organisms → Bacteria → Acidobacteria2965Open in IMG/M
3300005993|Ga0080027_10127825All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300006028|Ga0070717_10217197Not Available1679Open in IMG/M
3300006028|Ga0070717_10574754All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300006028|Ga0070717_10757409Not Available883Open in IMG/M
3300006028|Ga0070717_11414346Not Available632Open in IMG/M
3300006050|Ga0075028_100231162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1009Open in IMG/M
3300006163|Ga0070715_10394896All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300006173|Ga0070716_101356826Not Available576Open in IMG/M
3300006175|Ga0070712_100048559All Organisms → cellular organisms → Bacteria2942Open in IMG/M
3300006176|Ga0070765_101439426Not Available649Open in IMG/M
3300006800|Ga0066660_10418263All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300006800|Ga0066660_10815401All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300006854|Ga0075425_100471270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1446Open in IMG/M
3300006871|Ga0075434_101257133All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300006954|Ga0079219_10064799Not Available1643Open in IMG/M
3300009038|Ga0099829_10066870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2715Open in IMG/M
3300009088|Ga0099830_10136599All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300009090|Ga0099827_11361044Not Available618Open in IMG/M
3300009143|Ga0099792_10034659All Organisms → cellular organisms → Bacteria2365Open in IMG/M
3300009174|Ga0105241_10074565All Organisms → cellular organisms → Bacteria2642Open in IMG/M
3300009650|Ga0105857_1042457Not Available1195Open in IMG/M
3300010046|Ga0126384_10842052Not Available824Open in IMG/M
3300010048|Ga0126373_10642720All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300010154|Ga0127503_10373922All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300010358|Ga0126370_11071233All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300010358|Ga0126370_11967704Not Available570Open in IMG/M
3300010359|Ga0126376_12861067Not Available532Open in IMG/M
3300010361|Ga0126378_10000107All Organisms → cellular organisms → Bacteria62100Open in IMG/M
3300010361|Ga0126378_10693231All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300010361|Ga0126378_12176573Not Available633Open in IMG/M
3300010371|Ga0134125_10082244Not Available3583Open in IMG/M
3300010371|Ga0134125_10092039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1173373Open in IMG/M
3300010371|Ga0134125_10102475All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1173187Open in IMG/M
3300010373|Ga0134128_10517147All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1330Open in IMG/M
3300010375|Ga0105239_13381235All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300011120|Ga0150983_10730695All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300011120|Ga0150983_14660609Not Available632Open in IMG/M
3300011120|Ga0150983_14904451All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300011120|Ga0150983_14986156Not Available1501Open in IMG/M
3300011269|Ga0137392_10035962All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1173635Open in IMG/M
3300011269|Ga0137392_10480190All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300011271|Ga0137393_10044531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3441Open in IMG/M
3300012189|Ga0137388_11466026All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300012202|Ga0137363_10000005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae128481Open in IMG/M
3300012202|Ga0137363_10009584All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6152Open in IMG/M
3300012210|Ga0137378_10027140All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5054Open in IMG/M
3300012210|Ga0137378_10061537All Organisms → cellular organisms → Bacteria3392Open in IMG/M
3300012212|Ga0150985_112747276All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1555Open in IMG/M
3300012349|Ga0137387_10601071All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300012351|Ga0137386_10401970All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300012357|Ga0137384_10000013All Organisms → cellular organisms → Bacteria135645Open in IMG/M
3300012359|Ga0137385_10787425All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300012582|Ga0137358_10230398Not Available1262Open in IMG/M
3300012683|Ga0137398_10703711Not Available702Open in IMG/M
3300012685|Ga0137397_10803797Not Available698Open in IMG/M
3300012930|Ga0137407_10135270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2160Open in IMG/M
3300012931|Ga0153915_11978412Not Available682Open in IMG/M
3300012931|Ga0153915_12504971Not Available603Open in IMG/M
3300012931|Ga0153915_12697139Not Available581Open in IMG/M
3300012944|Ga0137410_10449327All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300012951|Ga0164300_11065316All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300012955|Ga0164298_10003397All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5392Open in IMG/M
3300012957|Ga0164303_10225163All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300012957|Ga0164303_11549751Not Available503Open in IMG/M
3300012958|Ga0164299_10822659All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300012960|Ga0164301_10403964Not Available957Open in IMG/M
3300012987|Ga0164307_10098798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1821Open in IMG/M
3300013296|Ga0157374_12935873Not Available504Open in IMG/M
3300015241|Ga0137418_11239947Not Available523Open in IMG/M
3300015373|Ga0132257_104479280Not Available508Open in IMG/M
3300017994|Ga0187822_10180233All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300018468|Ga0066662_10105990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2007Open in IMG/M
3300018468|Ga0066662_10836796All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300018468|Ga0066662_11122900Not Available788Open in IMG/M
3300018468|Ga0066662_12806999Not Available517Open in IMG/M
3300019789|Ga0137408_1112275All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1915Open in IMG/M
3300020078|Ga0206352_10437333All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300020078|Ga0206352_11287862Not Available519Open in IMG/M
3300020140|Ga0179590_1073602Not Available903Open in IMG/M
3300020170|Ga0179594_10117640All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300020199|Ga0179592_10127429All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300020579|Ga0210407_10000921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae29836Open in IMG/M
3300020579|Ga0210407_10296195All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300021178|Ga0210408_10000272All Organisms → cellular organisms → Bacteria72745Open in IMG/M
3300021403|Ga0210397_10000008All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae309956Open in IMG/M
3300021403|Ga0210397_11135731Not Available607Open in IMG/M
3300021404|Ga0210389_11147933Not Available599Open in IMG/M
3300021404|Ga0210389_11273511Not Available564Open in IMG/M
3300021475|Ga0210392_10749421Not Available728Open in IMG/M
3300021560|Ga0126371_10023680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5687Open in IMG/M
3300021560|Ga0126371_13078901All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300022507|Ga0222729_1042055All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300022531|Ga0242660_1078580All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300022531|Ga0242660_1172220All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300022531|Ga0242660_1214927Not Available534Open in IMG/M
3300025544|Ga0208078_1006179All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172968Open in IMG/M
3300025898|Ga0207692_10957342All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300025913|Ga0207695_10103707All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2835Open in IMG/M
3300025913|Ga0207695_11046503Not Available696Open in IMG/M
3300025915|Ga0207693_10805271All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300025921|Ga0207652_10286446Not Available1486Open in IMG/M
3300025928|Ga0207700_10017736All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1174762Open in IMG/M
3300025929|Ga0207664_11905737Not Available517Open in IMG/M
3300026078|Ga0207702_10179510All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium ADurb.Bin1011949Open in IMG/M
3300026216|Ga0209903_1004801All Organisms → cellular organisms → Bacteria2809Open in IMG/M
3300026319|Ga0209647_1003892All Organisms → cellular organisms → Bacteria → Acidobacteria11433Open in IMG/M
3300026319|Ga0209647_1111429All Organisms → cellular organisms → Bacteria → Acidobacteria1280Open in IMG/M
3300026551|Ga0209648_10206636All Organisms → cellular organisms → Bacteria1493Open in IMG/M
3300026557|Ga0179587_10013586All Organisms → cellular organisms → Bacteria4272Open in IMG/M
3300027376|Ga0209004_1005336All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1748Open in IMG/M
3300027591|Ga0209733_1031733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1420Open in IMG/M
3300027616|Ga0209106_1017421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1545Open in IMG/M
3300027773|Ga0209810_1007187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9345Open in IMG/M
3300027826|Ga0209060_10000681All Organisms → cellular organisms → Bacteria51903Open in IMG/M
3300027826|Ga0209060_10049198Not Available2038Open in IMG/M
3300027846|Ga0209180_10531755Not Available656Open in IMG/M
3300027857|Ga0209166_10014380All Organisms → cellular organisms → Bacteria5048Open in IMG/M
3300027857|Ga0209166_10192656All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300027862|Ga0209701_10107893All Organisms → cellular organisms → Bacteria1734Open in IMG/M
3300027882|Ga0209590_10393749All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium894Open in IMG/M
3300028536|Ga0137415_11479932Not Available504Open in IMG/M
3300028800|Ga0265338_10079213All Organisms → cellular organisms → Bacteria2766Open in IMG/M
3300030842|Ga0075404_11180869Not Available868Open in IMG/M
3300031057|Ga0170834_108466107All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300031122|Ga0170822_13320736All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300031231|Ga0170824_101811027Not Available850Open in IMG/M
3300031231|Ga0170824_103582025All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300031469|Ga0170819_10322333Not Available675Open in IMG/M
3300031469|Ga0170819_14769843All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031469|Ga0170819_16618702All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300031740|Ga0307468_102355933Not Available518Open in IMG/M
3300032205|Ga0307472_101272028All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300033480|Ga0316620_10467810All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300033486|Ga0316624_10056186All Organisms → cellular organisms → Bacteria2547Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.46%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil7.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.17%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.06%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere4.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.80%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.38%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.95%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.11%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.27%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.84%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.84%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.42%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.42%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.42%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.42%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.42%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.42%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.42%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.42%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.42%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300004100Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004139Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005650Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005949Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009650Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025544Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026216Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027376Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300030842Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_084809302189573001Grass SoilMDAKWNDIVDNTMVRIGMVVIGFGAWLAIGYGLLAA
NODE_062052823300000156Sugar Cane Bagasse Incubating BioreactorMSAKWNNVVDNAMVRIAMVVAGFGAWLAIGYRLLAG*
C688J14111_1000142263300001305SoilMDAKWNNIVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
JGI12627J18819_1030225513300001867Forest SoilMSAKWNNVVDNAMVRIAMVAVVFGAWLAIGYRLLSV*
JGIcombinedJ26739_10053812723300002245Forest SoilMDAKWNNVVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
C688J35102_12096575753300002568SoilLEEIMDAKWNNIVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
JGI25617J43924_1019794113300002914Grasslands SoilVNSEEIMDAKWNNIIDNAMVRVTLVVLGFGAWLAISYGLLSL*
Ga0058904_131429223300004100Forest SoilQEAIMDAKWNKVIDNFAVRTGMLVFAFGVWLAIAYGVLAA*
Ga0058891_156018623300004104Forest SoilMENFGGDIMDAKWNNLIDNTLVRVLLIVVGFGVWLVVSYELLSL*
Ga0058897_1097977013300004139Forest SoilQKRNDRREIMDAKWNNVVDNFVVRVTLIALGFGAWLAIGYGLLSL*
Ga0062595_10072341423300004479SoilNHSEAVIMDAKWNNLVDNMAVRIGLVVVGFSAWLALGYSLLS*
Ga0058861_1004997723300004800Host-AssociatedMVQAEPVMDAKWNRIIDNGAVRIGMIVAVFGVWLAISYGLLAA*
Ga0066809_1001772723300005168SoilLEAVMDAKWNNIVDNTMVRIGMVVIGFGAWLAIGYGLLAA*
Ga0066680_1082671323300005174SoilSKARQKDLQHETNSLEAVMDAKWNDIVDNTMVRIGMVVIGFGAWLAIGYGLLAA*
Ga0066388_10234600023300005332Tropical Forest SoilMEAVMDAKWNAIVDNTAVRIAMVVVGFGAWLAIGYSLLLV*
Ga0070692_1026774623300005345Corn, Switchgrass And Miscanthus RhizosphereMQHNSLEDVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0070709_1005835433300005434Corn, Switchgrass And Miscanthus RhizosphereMEAVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0070709_1019729023300005434Corn, Switchgrass And Miscanthus RhizosphereMQHNSLEDVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLSA*
Ga0070713_10004146523300005436Corn, Switchgrass And Miscanthus RhizosphereVQHNSLEDVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0070713_10032498723300005436Corn, Switchgrass And Miscanthus RhizosphereLEDVMDAKWNNIVDNTMVRIAMVVVGFSAWLAIGYGLLAA*
Ga0070713_10235985423300005436Corn, Switchgrass And Miscanthus RhizosphereMEIGSDFMDAKWNNIVDNAAVRMGAVIVVFGAWLAISYSLMK*
Ga0070711_10147219223300005439Corn, Switchgrass And Miscanthus RhizosphereLEAFMDAKWNNIVDNTMVRIGMVVIGFGAWLALGYGLLAA*
Ga0073909_1001508233300005526Surface SoilMDAKWNNIVDNTMVRVGMVIVGFGAWLAIGYSLLAS*
Ga0073909_1068207213300005526Surface SoilMDAKWNNIVDNTMVRVGMVIVGFGAWLAIGYGLLAS*
Ga0070741_10006059183300005529Surface SoilMSAKWNNVIDNAMVRIAMVVVGFGTWLAIGYRLLAG*
Ga0070741_1004577123300005529Surface SoilMDAKWNKVVDNFAVRTGMLVLGFAVWLAVAYGVLAA*
Ga0070734_10002477203300005533Surface SoilMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYSLLAA*
Ga0070734_1007303243300005533Surface SoilMDAKWNNLVDNTMVRIAMVVVGFGAWLAIGYGLLAV*
Ga0070730_1003497623300005537Surface SoilMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0070730_1008006033300005537Surface SoilMDAKWNNIADNTMVRIGLVVVGFGAWLAIGYGLLAA*
Ga0070730_1012801323300005537Surface SoilMDAKWNNVVDNMAVRIGLVIVGFGAWLALGYGLLSI*
Ga0068853_10116446923300005539Corn RhizosphereMVQAESVMDAKWNRIIDNGAVRIGMIVAIFGVWLAISYGLLAA*
Ga0070732_1007284933300005542Surface SoilMDAKWNDIVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0070732_1020183323300005542Surface SoilSGGVMDAKWNNIVDNTMVRIGLVVVGFGAWLAIGYGLLAA*
Ga0070732_1051435323300005542Surface SoilMDAKWNNIVDNTMVRIGLVVVGFGAWLAIGYGLLA
Ga0066661_1021917433300005554SoilMDSKWNKVVDNFAVRTGMLVLGFGVWLAVAYGVLAA*
Ga0066692_1002431923300005555SoilMDAKWNNIVDNTMVRIAMVVVGFGAWLAVSYGLLSA*
Ga0066670_1064370723300005560SoilMDAKWNAVVDNLAVRTLLLAAGFGTWLAIGYGLLSLS*
Ga0068855_10040454523300005563Corn RhizosphereMDAKWNKIVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0066702_1043566323300005575SoilMDAKWNNLVDNTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0066702_1058449823300005575SoilMDAKWNNIVDNMAVRIAMVVVGFGAWLAIGYSLLAV*
Ga0068854_10079199023300005578Corn RhizosphereMVQAESVMDAKWNRIIDNGAVRIGMIVAVFGVWLAISYGLLAA*
Ga0068856_10016067123300005614Corn RhizosphereMDAKWNKVVDNAAVRIAAMLAFFGVWLAISYGLLAA*
Ga0068856_10272114123300005614Corn RhizosphereMDAKWNRIIDNGAVRIGMIVAIFGVWLAISYGLLAA*
Ga0068852_10167939623300005616Corn RhizosphereMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAG*
Ga0075038_1088086213300005650Permafrost SoilHLLEEVMDSKWNNIVDNTMVRIGMLVVGFGAWLAIGYRLLAV*
Ga0070764_1087316113300005712SoilMDAKWNNVIDNTMVRIAMVVVGFGAWLAIGYGLMSL*
Ga0066903_10023355523300005764Tropical Forest SoilMDAKWNNIVDNMAVRIGLVVVGFSAWLALGYSLLSA*
Ga0066903_10030626923300005764Tropical Forest SoilMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYSLLAG*
Ga0066903_10058011813300005764Tropical Forest SoilMDAKWNNVVDKAMVRIAMVVVVFSAWFAIGYRLLAG*
Ga0066903_10086212823300005764Tropical Forest SoilMDAKWNAIVDNTAVRIAMVVVGFSAWLAIGYSLLLV*
Ga0066791_1000560623300005949SoilMDAKWNNIIDSAAVRMGMLVAVFGAWLAISYSLLK*
Ga0080027_1012782523300005993Prmafrost SoilAHLLEEVMDSKWNNIVDNTMVRIGMLVVGFGAWLAIGYRLLAV*
Ga0070717_1021719713300006028Corn, Switchgrass And Miscanthus RhizosphereMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLSA*
Ga0070717_1057475423300006028Corn, Switchgrass And Miscanthus RhizosphereMDAKWNNIVDNTMVRVGMVIIGFGAWLAIGYGLLAS*
Ga0070717_1075740933300006028Corn, Switchgrass And Miscanthus RhizosphereMDAKWNNIVDNTMVRIAMVVVGFSAWLAIGYGLLAA*
Ga0070717_1141434613300006028Corn, Switchgrass And Miscanthus RhizosphereMDAKWNDIVDNTMVRIGMVVIGFGAWLAIGYGLLAA*
Ga0066652_10151309223300006046SoilMIMDAKWNNVADNLAVRALLLVAGFGTWLAVSYGLLSLA*
Ga0075024_100000230153300006047WatershedsMDPKWNNIVDNMAVRIVLIIAGFSVWLAVSYGLLSA*
Ga0075028_10001867933300006050WatershedsMEAVMDSKWNAIVDNIAVRIGMVIVGFSVWLAVSYGLLSA*
Ga0075028_10023116223300006050WatershedsMDAKWNNIADNTMVRIALVVVGFGAWLALGYGLLAA*
Ga0070715_1039489623300006163Corn, Switchgrass And Miscanthus RhizosphereRRVIMDAKWNNIVDNTIVRIGMVVAGFSAWLLVGYRLLSL*
Ga0075018_1004689423300006172WatershedsMDSKWNAIVDNIAVRIGMVIVGFSVWLAVSYGLLSA*
Ga0070716_10135682613300006173Corn, Switchgrass And Miscanthus RhizosphereMEAVMDAKWNNIVDNTVVRIAMVVVGFGAWLAIGYGLLAA*
Ga0070712_10004855943300006175Corn, Switchgrass And Miscanthus RhizosphereMDAKWNNIVDNTMVRIGMVVIGFGAWLAIGYGLLAA*
Ga0070765_10143942623300006176SoilMDAKWNNLVDNAMVRIAMVVVGFGAWFAIGNTLLAS*
Ga0075021_1099059213300006354WatershedsMDARWNKVVDNIVVRITLIAVGFGAWLAVSYSLLSL*
Ga0066653_1015872913300006791SoilRTIMDAKWNAVVDNLAVRTLLLAAGFGTWLAIGYGLLSLS*
Ga0066658_1021215233300006794SoilMDAKWNKVVDNFAVRAGMLVLAFGVWLAIAYGVLAGQ*
Ga0066660_1041826323300006800SoilMDAKWNNIVDNMAVRIAMVVVGFGAWSAIGYSLLAV*
Ga0066660_1067938523300006800SoilMDAKWNKVVDNLAVRTLMLAAGFGAWLAISYGLLSLS*
Ga0066660_1081540113300006800SoilWRTIMDAKWNNVVDHIAVRIGMVVIGFGAWFALGYSLLAG*
Ga0075425_10047127023300006854Populus RhizosphereMDAKWNAVADNLAVRALLVVAGFGAWLAISYGLLSLS*
Ga0075434_10125713323300006871Populus RhizosphereMDAKWNAIVDNTAVRIAMVVVGFGAWLAIGYSLLLV*
Ga0075426_1086835313300006903Populus RhizosphereMDAKWNRIIDNGAVRIVMIVAVFGVWLAISYGLLAA*
Ga0079219_1006479913300006954Agricultural SoilMDAKWNNIVDSAAVRIGTVVVGFSVWLAICYGLLSSY*
Ga0099795_1004788823300007788Vadose Zone SoilLQHENKQIFLEDVMDAKWNDIVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
Ga0099829_1006687023300009038Vadose Zone SoilMDAKWNNVIDNGAVRISMVVVAFSAWLAISYSLLAN*
Ga0099830_1013659923300009088Vadose Zone SoilMDAKWNNVIDNGAVRISMMVVAFSAWLAISYSLLAN*
Ga0099830_1084460423300009088Vadose Zone SoilMDAKWNKVVDNMAVRMVLLVAGFGAWFAIGYGLLSL*
Ga0099827_1136104413300009090Vadose Zone SoilMDAKWNNVMDNALVRVTLVIVGFGAWLAISYGLLSL*
Ga0105240_1262277823300009093Corn RhizosphereVQAESVMDAKWNRIIDNGAVRIGMIVAIFGVWLAISYGLLAA*
Ga0099792_1003465923300009143Vadose Zone SoilMDAKWNDIVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
Ga0105241_1007456543300009174Corn RhizosphereMDAKWNNIVDNTMVRIGMVVVGFSAWLAIGYGLLAS*
Ga0105237_1087412213300009545Corn RhizosphereMDAKWNRIIDNGAVRIGMIVAVFGVWLAISYGLLAA*
Ga0105857_104245723300009650Permafrost SoilMDSKWNNIVDNTMVRIGMLVVGFGAWLAIGYRLLAV*
Ga0126384_1084205223300010046Tropical Forest SoilMDAKWNNIVDNMAVRIAMVVVGFGAWLAIGYSLLAA*
Ga0126373_1064272023300010048Tropical Forest SoilMSAKWNNVIDNAMVRIAMVVVVFGAWLAIGYRLLAG*
Ga0127503_1037392223300010154SoilMDAKWNDLVDNTMVRIAMVVVGFGAWLAIGYSLLLV*
Ga0126370_1107123323300010358Tropical Forest SoilMDAKWNDIVDNTMVRIAMVVIGFGAWLAIGYGLLAA*
Ga0126370_1196770413300010358Tropical Forest SoilMDAKWNDIVDNTMVRIGMVVIGFGAWLAIGYGLLAG*
Ga0126376_1286106723300010359Tropical Forest SoilMDAKWNDTVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
Ga0126378_10000107333300010361Tropical Forest SoilMDAKWNNIVDNAAVRIAMVVVVFGAWFAIGYRLLAG*
Ga0126378_1069323113300010361Tropical Forest SoilMSAKWNNVVDNTLVRIGMVVVVFGAWFAIGYRLLSL*
Ga0126378_1217657323300010361Tropical Forest SoilMDAKWNNIVDHTMVRIAMVVVGFGAWLAIGYGLLAA*
Ga0134125_1008224423300010371Terrestrial SoilMDAKWNNIMDNAAVRIGAVVVVLGVWVAIAYGLLAA*
Ga0134125_1009203923300010371Terrestrial SoilMSAKWNNVIDNAMVRIAMVVVGFGAWLAIGYRLLAG*
Ga0134125_1010247523300010371Terrestrial SoilMDAKWNNVIDNAAVRIGMVVAVFGVWLAVTYGLLAS*
Ga0134128_1007894143300010373Terrestrial SoilMDAKWNKIVDNAAVRIAAMLAFFGVWLAISYGLLAA*
Ga0134128_1051714723300010373Terrestrial SoilMDFLEDVMDAKWNNIVDNTMVRIGLVVVGFGAWLAIGYGLLAA*
Ga0105239_1338123523300010375Corn RhizosphereAKWNRIIDNGAVRIGMIVAVFGVWLAVSYGLLAA*
Ga0134126_1268435213300010396Terrestrial SoilMVQAESVMDAKWNRIIDNGAVRIGMIVAVFGVWLAVSYGLLAA*
Ga0134127_1182180523300010399Terrestrial SoilMDAKWNKIVDNAAVRVAAMLAFFGVCLAISYGLLAA*
Ga0150983_1073069523300011120Forest SoilGILYLEITMDAKWNNIVDNAAVRIAMIVVGFGAWLAIGYGLLSI*
Ga0150983_1195432513300011120Forest SoilKSSKQLQHENTADFLEDVMDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
Ga0150983_1466060913300011120Forest SoilMDSKWNSIIDHTGVRIAMVVIGFGAWLAISYGLLAA*
Ga0150983_1490445123300011120Forest SoilMDAKWNRVVDNIAIRIGMVVVGFGLWLAISYGLLSL*
Ga0150983_1498615613300011120Forest SoilMDAKWNNVVDNFVVRVTLIALGFGAWLAIGYGLLSL*
Ga0137392_1003596233300011269Vadose Zone SoilMDAKWNNIIDNAMVRVTLVVLGFGAWLAISYGLLSL*
Ga0137392_1048019023300011269Vadose Zone SoilLEDVMDAKWNDIVDNTMVRIGMVVLGFGAWLVIGYGLLAA*
Ga0137393_1004453143300011271Vadose Zone SoilMDAKWNDIVDNTMVRIGMVVLGFGAWLVIGYGLLAA*
Ga0137388_1146602613300012189Vadose Zone SoilMDSKWNSVVDNPAVRIAMVVVGFGAWLAISYGLLAA*
Ga0137363_10000005233300012202Vadose Zone SoilMENFGGDIMDAKWNNLIDNTLVRVLLIVVGFGVWLAVSYELLSL*
Ga0137363_1000958443300012202Vadose Zone SoilLEGQIVDAKWNNIVDNTMVRIAMMVAGFGAWLVVSYGLLAA*
Ga0137378_1002714023300012210Vadose Zone SoilMDTKWNNIFDNTAVRIAMIVVGFGAWLAIGYGILAS*
Ga0137378_1006153723300012210Vadose Zone SoilMDAKWNNIVDNTAVRIVMIVVGFGTWLAIGYGILAA*
Ga0150985_11103539713300012212Avena Fatua RhizosphereVKECSNRSVTYLEEVMDAKWNSVVDNMAVRISMVVIGFGAWFALGYSLLAG*
Ga0150985_11274727613300012212Avena Fatua RhizosphereNGFFLEEIMDAKWNNIVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
Ga0137387_1060107123300012349Vadose Zone SoilMDAKWNNIFDNTAVRIAMIVVGFGAWLAIGYGILAS*
Ga0137386_1040197013300012351Vadose Zone SoilMDAKWNNIVDNTVVRIVMIVVGFGAWLAIGYGILAA*
Ga0137384_10000013473300012357Vadose Zone SoilMDAKWNAIVDNTAVRIAMVVVGFGAWLAISYGLLAA*
Ga0137385_1078742523300012359Vadose Zone SoilEIVEASVDTKWNNIFDNTAVRIAMIVVGFGAWLAIGYGILAS*
Ga0137358_1023039823300012582Vadose Zone SoilLEGQIVDAKWNNIVDNTMVRIAMMVAGFGAWLVVSYSLLAA*
Ga0137398_1070371123300012683Vadose Zone SoilMDAKWNNIVDNTAVRIAMIVVGFGAWLAIGYGILAS*
Ga0137397_1080379713300012685Vadose Zone SoilMETKWNNITDNTVVRIALIVVGFGAWLAIGYGILAA*
Ga0137416_1194585013300012927Vadose Zone SoilMGAKWNKVVDNFAVRAGMLVLAFGVWLAIAYGVLAGR*
Ga0137404_1182614913300012929Vadose Zone SoilLQHENKQIFLEDVMDAKWNDIVDNTMVRIGMVMVGFGAWLAIGYGLLAA*
Ga0137407_1013527013300012930Vadose Zone SoilNKQIFLEDVMDAKWNDIVDNTMVRIGMVVVGFGAWLAIGYGLLAA*
Ga0137407_1048996723300012930Vadose Zone SoilLQHENKQIFLEDVMDAKWNDIVDNTMVRIGMVVVGFGAWLAIGY
Ga0153915_1197841213300012931Freshwater WetlandsMDAKWNNIVDNLAVRIGALVVGFGIWLAVSYALLAA*
Ga0153915_1250497123300012931Freshwater WetlandsMDPKWNNLVDNMAVRIGMVVVGFALWLAVSYGLLSA*
Ga0153915_1269713913300012931Freshwater WetlandsMDAKWNNIVDNLAVGIGALVLGFIIWLAVSYALVAA*
Ga0137410_1044932723300012944Vadose Zone SoilMDAKWNNVMDNTAVRIGMLVVGFGAWLAIGYGLLAG*
Ga0164300_1106531623300012951SoilWRRFMDAKWNNIVDNTMVRIGMVVIGFGAWLAIGYGLLAA*
Ga0164298_1000339753300012955SoilMDAKWNNIVDNTMVRIGMVVVGFGAWLAISYGLLAA*
Ga0164303_1022516323300012957SoilMDAKWNNIVDNTMVRIGLVVVGFGAWLAIGYSLLAA*
Ga0164303_1154975113300012957SoilMDAKWNDIVDNTMVRIGMMVIGFGAWLAIGYGLLAA*
Ga0164299_1082265913300012958SoilVMDAKWNNIVDKTMVRIGMVVIGFGAWLAIGYGLLAA*
Ga0164301_1022701823300012960SoilLQHEKTTDFFLEDVMDAKWNNIVDNTMVRIGLVVVGFGAWLAIGYSLLAA*
Ga0164301_1040396423300012960SoilMQHNSLEDVMDAKWNNIVDNTMVRIAMVVIGFGAWLAIGYGLLAA*
Ga0164307_1009879823300012987SoilMDARWNTVVDHVAVRIGMVVIGFGAWFALGYGLLSA*
Ga0157374_1293587313300013296Miscanthus RhizosphereDFLEDVMDAKWNNIVDNTMVRIGMVVVGFSAWLAIGYGLLAS*
Ga0137418_1041168323300015241Vadose Zone SoilMDAKWNKVVDNMAVRTVLLVAGFGAWFAIGYGLLSL*
Ga0137418_1123994723300015241Vadose Zone SoilMDAKWNNIVDNTAVRIVMIVVGFGAWLAIGYGILAA*
Ga0137412_1021849423300015242Vadose Zone SoilLQHDKQTDFLGGVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAG*
Ga0132257_10447928013300015373Arabidopsis RhizosphereMEAVMDAKWNAIVDNTAVRIAMVVVGFSAWLAIGYSLLLV*
Ga0187822_1018023323300017994Freshwater SedimentMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0066655_1044746813300018431Grasslands SoilMNAKWNKVVDNFAVRTGMLVLGFGVWLAVAYGVLAA
Ga0066662_1000249473300018468Grasslands SoilMDAKWNKVVDNLAVRTLMLAAGFGAWLAISYGLLSLS
Ga0066662_1010599023300018468Grasslands SoilMDAKWNKVVDNLAVRTVMLAVGFGTWLAIGYGLLSLS
Ga0066662_1011536233300018468Grasslands SoilMDSKWNKVVDNFAVRTGMLVLGFGVWLAVAYGVLAA
Ga0066662_1083679613300018468Grasslands SoilMDAKWNNVVDHIAVRIGMVVIGFGAWFALGYSLLAG
Ga0066662_1099124223300018468Grasslands SoilMDAKWNKVVDNFAVRAGMLVLAFGVWLAIAYGVLAGQ
Ga0066662_1112290023300018468Grasslands SoilMDAKWNNIVDNMAVRIAMVVVGFGAWLAIGYSLLAV
Ga0066662_1280699923300018468Grasslands SoilMDAKWNAVVDNLAVRTLLLAAGFGTWLAIGYGLLSLS
Ga0066669_1010166413300018482Grasslands SoilMDAKWNTIIDNLAVRTVLLVVGFGAWLAISYGFLAL
Ga0137408_111227523300019789Vadose Zone SoilMDAKWNDIVDNTMVRIGMVMVGFGAWLAIGYGLLAA
Ga0197907_1082621623300020069Corn, Switchgrass And Miscanthus RhizosphereMVQAEPVMDAKWNRIIDNGAVRIGMIVAVFGVWLAVSYGLLAA
Ga0206356_1175129413300020070Corn, Switchgrass And Miscanthus RhizosphereNAGFQEKVMDAKWNKVVDNAAVRIAAMLAFFGVWLAISYGLLAA
Ga0206355_116785323300020076Corn, Switchgrass And Miscanthus RhizosphereMVQAESVMDAKWNRIIDNGAVRIGMIVAIFGVWLAISYGLLAA
Ga0206351_1088292323300020077Corn, Switchgrass And Miscanthus RhizosphereMDAKWNRIIDNGAVRIGMIVAIFGVWLAISYGLLAA
Ga0206352_1027536913300020078Corn, Switchgrass And Miscanthus RhizosphereMVQAESVMDAKWNRIIDNGAVRIGMIVAVFGVWLAISYGLLAA
Ga0206352_1043733323300020078Corn, Switchgrass And Miscanthus RhizosphereDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0206352_1128786213300020078Corn, Switchgrass And Miscanthus RhizosphereMDAKWNNIVDNTMVRIGMVVVGFSAWLAIGYGLLAS
Ga0206352_1132598513300020078Corn, Switchgrass And Miscanthus RhizosphereRMVQAESVMDAKWNRIIDNGAVRIGMIVAVFGVWLAVSYGLLAA
Ga0206353_1112432213300020082Corn, Switchgrass And Miscanthus RhizosphereMDAKWNRIIDNGAVRIGMIVAVFGVWLAISYGLLAA
Ga0179590_107360223300020140Vadose Zone SoilMDAKWNNIVDNTMVRIGMVVVGFGAWLAIGYGLLAG
Ga0179594_1011190323300020170Vadose Zone SoilLQHENKQIFLEDVMDAKWNDIVDNTMVRIGMVVVGFGAWLAIGYGLLAA
Ga0179594_1011764023300020170Vadose Zone SoilMDAKWNTIVDNTAVRIAMVVVGFGAWLAISYGLLAA
Ga0179592_1012742923300020199Vadose Zone SoilLEGQIVDAKWNNIVDNTMVRIAMMIAGFGAWLVVSYSLLAA
Ga0210407_1000092153300020579SoilMDAKWNNVVDNFVVRVTLIALGFGAWLAIGYGLLSL
Ga0210407_1029619523300020579SoilMDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLAA
Ga0154015_106946413300020610Corn, Switchgrass And Miscanthus RhizosphereMDAKWNRIIDNGAVRIGMIVAVFGVWLAVSYGLLAA
Ga0210400_1000865833300021170SoilMDAKWNKYIDNFAVRTGMLVLGFGMWLLISYGVLAA
Ga0210400_1033038233300021170SoilMDAKWNKVIDNFAVRTGMLVFAFGVWLAIAYGVLAA
Ga0210408_1000027293300021178SoilMDAKWNRVVDNIAIRIGMVVVGFGLWLAISYGLLSL
Ga0210397_100000082663300021403SoilMSAKWNNIIDNAMVRIAMVAVVFSTWLAIGYKLLSV
Ga0210397_1084229713300021403SoilKAALTNRNYLEGCMDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLAV
Ga0210397_1113573113300021403SoilMDAKWNNVIDNSMVRIAMVVVGFGAWLAIGYGLMSL
Ga0210389_1114793313300021404SoilMDAKWNNLADNTMVRIAMVVVGFGAWLAIGYGLLAV
Ga0210389_1127351113300021404SoilMDAKWNSIVDNSMVRIAMVVVGFGTWLAIGYGLLSI
Ga0210392_1074942123300021475SoilMDAKWNNVIDNSMVRIAMVVVGFGAWLAIGYGLLAV
Ga0126371_1002368033300021560Tropical Forest SoilMEIMMDAKWNNLVDNMAVRIGMMAVIFGAWLVISYGLLSA
Ga0126371_1307890113300021560Tropical Forest SoilMSAKWNNVIDNAMVRIAMVVVVFGAWLAIGYRLLAG
Ga0224712_1021874013300022467Corn, Switchgrass And Miscanthus RhizosphereGFQEKVMDAKWNKVVDNAAVRIAAMLAFFGVWLAISYGLLAA
Ga0222729_104205523300022507SoilQKRNDRREIMDAKWNNVVDNFVVRVTLIALGFGAWLAIGYGLLSL
Ga0242660_107858013300022531SoilMENFGGDIMDAKWNNLIDNTLVRVLLIVVGFGVWLVVSYELLSL
Ga0242660_117222023300022531SoilMDAKWNNIVDNALVRTTLIVLGFGAWLAISYGLLSLF
Ga0242660_121492713300022531SoilIMDAKWNNIVDKTSVRLLLLAVGFGVWLAIGYGILAAA
Ga0242665_1002455623300022724SoilNRQTVNNQEAVMDAKWNKVVDNFVVRTGMLVLGFGVWLAISYGVLAALG
Ga0208078_100617933300025544Arctic Peat SoilMDAKWNNIVHNTMVRIGMVVVGFGAWLAIGYGLLAA
Ga0207692_1095734213300025898Corn, Switchgrass And Miscanthus RhizosphereRFMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0207707_1140272023300025912Corn RhizosphereAESVMDAKWNRIIDNGAVRIGMIVAIFGVWLAISYGLLAA
Ga0207695_1010370723300025913Corn RhizosphereMDAKWNKIVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0207695_1104650323300025913Corn RhizosphereMDAKWNNVVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0207693_1080527113300025915Corn, Switchgrass And Miscanthus RhizosphereEDVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYSLLAA
Ga0207652_1028644623300025921Corn RhizosphereGGVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0207700_1001773673300025928Corn, Switchgrass And Miscanthus RhizosphereNEGVQHNSLEDVMDAKWNNIVDNTMVRIAMVVVGFGAWLAIGYGLLSA
Ga0207664_1190573723300025929Agricultural SoilMDAKWNNIVDNTMVRIAMVVVGFSAWLAIGYGLLAA
Ga0207667_1113661913300025949Corn RhizosphereRERAAGFQEKVMDAKWNKVVDNAAVRIAAMLAFFGVWLAISYGLLAA
Ga0207702_1017951023300026078Corn RhizosphereMDAKWNDIVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0207702_1028084923300026078Corn RhizosphereMDAKWNKVVDNAAVRIAAMLAFFGVWLAISYGLLAA
Ga0209903_100480133300026216SoilMDAKWNNIIDSAAVRMGMLVAVFGAWLAISYSLLK
Ga0209647_1003892113300026319Grasslands SoilMDAKWNNIVDNTAVRIAMLVVGFGAWLAIGYSLLAS
Ga0209647_111142923300026319Grasslands SoilMDAKWNTIVDNTAVRIAMVVVGFGAWLAISYGLLAAA
Ga0209648_1020663623300026551Grasslands SoilMDAKWNNIIDNAMVRVTLVVLGFGAWLAISYGLLSL
Ga0179587_1001358623300026557Vadose Zone SoilVDAKWNNIVDNTMVRIAMMIAGFGAWLVVSYSLLAA
Ga0209004_100533623300027376Forest SoilMDAKWNNIVDNTMVRIAMVVIGFGAWLAIGYGLLAA
Ga0209220_102363623300027587Forest SoilMDAKWNKVVDNFAVRTGMLVLGFGVWLAITYGVLAA
Ga0209733_103173333300027591Forest SoilMDSKWNNIVDNTMVRIGMLVVGFGAWLAIGYRLLAV
Ga0209106_101742123300027616Forest SoilMDAKWNNVMDNTAVRIGMLVVGFGAWLAIGYGLLAG
Ga0209810_100718763300027773Surface SoilMSAKWNNVVDNTMVRIGMVVVGFGTWFAIGYRLMSL
Ga0209060_10000681343300027826Surface SoilMDAKWNKVIDNMAIRTAMVAVGFGAWLALSYGLLAL
Ga0209060_1004919823300027826Surface SoilMDAKWNNLVDNTMVRIAMVVVGFGAWLAIGYGLLAV
Ga0209180_1053175513300027846Vadose Zone SoilMDAKWNNVIDNGAVRISMVVVAFSAWLAISYSLLAN
Ga0209166_1000571763300027857Surface SoilMDAKWNKVVDNFVVRTGMLVIGFGVWLAITYGVLAA
Ga0209166_1001438033300027857Surface SoilMDAKWNNVVDNMAVRIGLVIVGFGAWLALGYGLLSI
Ga0209166_1019265623300027857Surface SoilMDAKWNNIADNTMVRIGLVVVGFGAWLAIGYGLLAA
Ga0209701_1010789323300027862Vadose Zone SoilMDAKWNNVIDNGAVRISMMVVAFSAWLAISYSLLAN
Ga0209590_1039374933300027882Vadose Zone SoilMDAKWNNVMDNALVRVTLVIVGFGAWLAISYGLLSL
Ga0209069_1002788113300027915WatershedsMDPKWNNIVDNMAVRIVLIIAGFSVWLAVSYGLLSA
Ga0137415_1147993213300028536Vadose Zone SoilMDAKWNNIVDNTAVRIAMIVVGFGAWLAIGYGILAS
Ga0265338_1007921343300028800RhizosphereMDAKWNNVIDNTMVRIAMVAVGFGAWLAIGYGLMSL
Ga0075404_1118086933300030842SoilMDAKWNNLADNTMVRIGMVVVGFGAWLAIGYGLLAA
Ga0170834_10846610723300031057Forest SoilMDAKWNDIVDNTMVRIGMVVIGFGAWLAIGYGLLAG
Ga0170822_1332073633300031122Forest SoilMDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLAS
Ga0170824_10181102733300031231Forest SoilMDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLA
Ga0170824_10358202513300031231Forest SoilDSPEDVMDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLAA
Ga0170819_1032233323300031469Forest SoilMDAKWNNLVDNTMVRIAMVVVGFGAWLAIGYGLLAA
Ga0170819_1476984313300031469Forest SoilPEDVMDAKWNNLVDNTMVRIGMVVVGFGAWLAIGYGLLAA
Ga0170819_1661870223300031469Forest SoilGRDFMDAKWNNVIDRASVRISMVVLAFGAWLAISYSLLK
Ga0170818_11523312523300031474Forest SoilFTEIGRDFMDAKWNNVIDRASVRISMVVLAFGAWLAISYSLLK
Ga0307468_10235593313300031740Hardwood Forest SoilMDAKWNNIVDNTIVRIGMVVAGFSAWLLVGYRLLSL
Ga0307472_10127202813300032205Hardwood Forest SoilMDAKWNAIVDNAAVRIAMVVVGFSAWLAIGYSLLLV
Ga0310811_1078140923300033475SoilMDAKWNKIVDNAAVRIAAMLAFFGVWLAISYGLLAA
Ga0316620_1046781013300033480SoilEVMDAKWNNIVDNLAVRIGALVVGFGIWLAVSYALLAA
Ga0316624_1005618613300033486SoilMDAKWNNIVDNLAVRIGALVVGFGIWLAVSYALLAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.