| Basic Information | |
|---|---|
| Family ID | F018078 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 237 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MINKYKDKFMVWQLHNRTEIVIAVVAFVIGAILF |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 237 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 66.24 % |
| % of genes near scaffold ends (potentially truncated) | 31.22 % |
| % of genes from short scaffolds (< 2000 bps) | 88.61 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.823 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (45.570 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.169 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.700 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 237 Family Scaffolds |
|---|---|---|
| PF00476 | DNA_pol_A | 18.14 |
| PF01612 | DNA_pol_A_exo1 | 2.11 |
| PF13361 | UvrD_C | 0.84 |
| PF08291 | Peptidase_M15_3 | 0.42 |
| PF11753 | DUF3310 | 0.42 |
| PF00271 | Helicase_C | 0.42 |
| PF04545 | Sigma70_r4 | 0.42 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.42 |
| PF00892 | EamA | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 237 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 18.14 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.82 % |
| All Organisms | root | All Organisms | 34.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 45.57% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 8.02% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.91% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.91% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 4.64% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 4.22% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.80% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.53% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.11% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.11% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.69% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.69% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.27% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.27% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.84% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.84% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.84% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.84% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.84% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.42% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.42% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.42% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.42% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.42% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.42% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.42% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.42% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.42% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.42% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.42% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001853 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005914 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006480 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075m | Environmental | Open in IMG/M |
| 3300006611 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_Marker113_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300012419 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022842 | Saline water microbial communities from Ace Lake, Antarctica - #46 | Environmental | Open in IMG/M |
| 3300022851 | Saline water microbial communities from Ace Lake, Antarctica - #1237 | Environmental | Open in IMG/M |
| 3300022853 | Saline water microbial communities from Ace Lake, Antarctica - #371 | Environmental | Open in IMG/M |
| 3300022885 | Saline water microbial communities from Ace Lake, Antarctica - #600 | Environmental | Open in IMG/M |
| 3300023245 | Saline water microbial communities from Ace Lake, Antarctica - #423 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025026 | Marine viral communities from the Pacific Ocean - LP-24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031601 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133 | Environmental | Open in IMG/M |
| 3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_1000155718 | 3300000101 | Marine | MINKYKDKFMVWQLHNRKEIVIAIAAFVIGALIF* |
| DelMOSum2010_100278302 | 3300000101 | Marine | MINKYKDKFMVWQLHNRTEIVIAVVAFVIGAILF* |
| DelMOSum2010_100305273 | 3300000101 | Marine | MINKYKDKFMVWQLQNRKEIVIAVVAFAIGAILI* |
| DelMOSum2010_100447113 | 3300000101 | Marine | MINKYKEKFMVWQLHNRKEIVIAIAAFVIGAIIF* |
| DelMOSum2010_100515679 | 3300000101 | Marine | MINKYKDKFMVWQLHHRTEIVIAVVAFIAGALIF* |
| DelMOSum2010_100650134 | 3300000101 | Marine | MMINKYKDKFLVWQLHNRKEIVIAIVAFVIGAILF* |
| DelMOSum2010_100669733 | 3300000101 | Marine | MIEKYLDKLMVWQLHNRKEIVIAIVAFVIGAIIF* |
| DelMOSum2010_100783252 | 3300000101 | Marine | MINKYKDKFMVWQLQNRTEIVIAVVAFVLGAIIF* |
| DelMOSum2010_101212523 | 3300000101 | Marine | MINKYKDKFMVWQLHNRTEIIIAVVAFVIGAILF* |
| DelMOSum2010_101445923 | 3300000101 | Marine | MINKYKDKFLVWQLHNRTEIVIAVVAFVIGAILF* |
| DelMOSum2010_101475192 | 3300000101 | Marine | MINKYKDKFMVWQLHNRKEIIIAAVSFVIGAILF* |
| DelMOSum2010_101602622 | 3300000101 | Marine | MINKYKDKFMVWQLHYRTEIVIAVVAFVAGALIF* |
| DelMOSum2010_102376291 | 3300000101 | Marine | MINKYKEKFMIWQLHNRKEIVIAVVAFVVGAILF* |
| DelMOSum2011_100194213 | 3300000115 | Marine | MFKKYKDKFMLWQLHNRTEIIIAGVSFILGAIIF* |
| DelMOSum2011_100544992 | 3300000115 | Marine | MINKYKDKFMVWQLHNRTEIVIAVVSFVIGAIIF* |
| DelMOSum2011_100796591 | 3300000115 | Marine | YMFKKYQDKFMLWQLHNRTEIIIAGVSFILGAIIF* |
| DelMOSpr2010_101010133 | 3300000116 | Marine | MFKKYQDKFMLWQLHNRTEIIIAGVSFILGAIIF* |
| DelMOSpr2010_101047823 | 3300000116 | Marine | MINKIKDKVMVWQLHNRKEIVIAVVAFVVGAILF* |
| DelMOWin2010_101234963 | 3300000117 | Marine | MINKYKDKFMVWQLHHRTEIVIAVVAFVAGALIF* |
| BBAY94_100519382 | 3300000949 | Macroalgal Surface | MIINLENWRKKMIKQYKDKFMVWQLHNRREIVCAVVGFIVGAIIF* |
| JGI20151J14362_102175491 | 3300001346 | Pelagic Marine | KTWRKKMINKYKDKFMVWQLHNRTEIIIAVVAFVIGAILF* |
| JGI24006J15134_100235783 | 3300001450 | Marine | MINKYKEKFMIWQLHYRTEIIIAVAAFVLGAVIF* |
| JGI24006J15134_100661342 | 3300001450 | Marine | MINKYKDKFMVWQLHHRTEIVIAVVSFVAGSLIF* |
| JGI24006J15134_100667732 | 3300001450 | Marine | MIEKYLDKFMVWQLHNRTEIVIAVVAFIFGAILF* |
| JGI24006J15134_100762193 | 3300001450 | Marine | MINKYKDKFMVWQLYNRKEIVIAIVAFVIGAILF* |
| JGI24006J15134_101048942 | 3300001450 | Marine | MINKYKDKFMVWQLHYRKEIIIAVIAFVAGSLIF* |
| JGI24006J15134_101515473 | 3300001450 | Marine | MINKYKEKFIVWQLHNRKEIVIAIAAFVIGAILF* |
| JGI24006J15134_101871122 | 3300001450 | Marine | MMIEKYLDKLMVWQLHNRTEIVIAVVAFVIGAILF* |
| JGI24006J15134_101890942 | 3300001450 | Marine | MINKYKDKFMVWQLQNRTEIVIAVVAFVIGAIIF* |
| JGI24006J15134_102080762 | 3300001450 | Marine | MINKYKDKFMVWQLHNRKEIIIAVVAFVVGAILF* |
| JGI24006J15134_102084292 | 3300001450 | Marine | MIEKYLDKLMVWQLHNRKEIVIAVISFLIGAILF* |
| JGI24006J15134_102167671 | 3300001450 | Marine | MIEKYLDKLMVWQLHNRKEIVIAIVAFVIGAILF* |
| JGI24003J15210_100605802 | 3300001460 | Marine | MIEKYLDKFMVWQLHNRAEIIIAVVAFLIGAILF* |
| JGI24003J15210_100746794 | 3300001460 | Marine | MIEKYLDKLMVWQLHNRTEIVIAVVAFVIGAILF* |
| JGI24003J15210_100826653 | 3300001460 | Marine | MINKYKEKFMVWQLHYRTEIICVVAGFIVGAIIF* |
| JGI24003J15210_101249142 | 3300001460 | Marine | MINKYKDKFMVWQLHNRKEIVIAIVAFVIGAILF* |
| JGI24003J15210_101370262 | 3300001460 | Marine | MINKYKEKFLVWQLHNRKEIVIAIIAFVIGAILF* |
| JGI24003J15210_101412012 | 3300001460 | Marine | MINKYKDKFMVWQLHNRKEIVIAVVAFVIGAIIF* |
| JGI24003J15210_101635141 | 3300001460 | Marine | MINKYKDKFMVWQLHNRKEIVIAVAAFVIGAILF* |
| JGI24003J15210_101653332 | 3300001460 | Marine | MINKYKEKFMIWQLHYRTEILIAVAAFVLGAVIF* |
| JGI24004J15324_100523572 | 3300001472 | Marine | MMINKYKDKFMVWQLXNRKEIXIAVVAFVVGAILF* |
| JGI24004J15324_100667814 | 3300001472 | Marine | MINKYKDKFMVWQLHXRTEIVIAVVAXXAGALIF* |
| JGI24004J15324_101252641 | 3300001472 | Marine | TMIEKYLDKLMVWQLHNRTEIIIAVVAFLIGAVLF* |
| JGI24005J15628_101571152 | 3300001589 | Marine | RKMMIEKYLDKLMVWQLHNRTEIVIAVIAFVIGAILF* |
| JGI24005J15628_101632222 | 3300001589 | Marine | MIEKYLDKLMVWQLHNRTEIIIAVVAFLIGAVLF* |
| JGI24005J15628_101936692 | 3300001589 | Marine | MINKYKDKFLVWQLHNRKEIVIAIVAFVIGAILF* |
| JGI24524J20080_10069303 | 3300001853 | Marine | MIEKYLDKFMVWQLHNRTEIXXAVVAFVIGAILF* |
| JGI24524J20080_10163561 | 3300001853 | Marine | MINKYKEKFMIWQLHNRKEIIIAVVAFVVGAILF* |
| JGI24524J20080_10266571 | 3300001853 | Marine | MMINKYKDKFMVWQLHHRTEIVIAVVSFVAGSLIF* |
| KVRMV2_1000246453 | 3300002231 | Marine Sediment | MIINLGNWRKKMIKQYKDKFMLWQLHNRREIVCAVAGFIIGALIF* |
| KVRMV2_1000816632 | 3300002231 | Marine Sediment | MISKIKDKXMVWQLHYRTEIICAVVGFVLGAIIF* |
| KVRMV2_10010523611 | 3300002231 | Marine Sediment | MIINLGNWRKKMIKQYKDKFMVWQLHNRREIICAAVGFVLGAIIF* |
| KVRMV2_1003180432 | 3300002231 | Marine Sediment | MINKYKEKFMIWQLHYRTEIIIASVAFVLGAIIF* |
| KVRMV2_1003208112 | 3300002231 | Marine Sediment | MINEIKDKVMIWQLHYRTEIIIAVAAFVLGAVIF* |
| KVRMV2_1004146282 | 3300002231 | Marine Sediment | MINKYKDKFMVWQLHNRTEIVCAVAGFILGAIIF* |
| KVRMV2_1005138743 | 3300002231 | Marine Sediment | MIINLENWRKKMIEQYKDKFMVWQLHNRKEIICAVVGFIVGALIF* |
| KVWGV2_101553802 | 3300002242 | Marine Sediment | MIINLENWRKKMIEQYKNKFMVWQLHNRREIICAVVGFIVGALIF* |
| KVWGV2_102947883 | 3300002242 | Marine Sediment | MGGNMIDKIKDKVMVWQLQYRTEIICVVVGFVLGSIIF* |
| KVWGV2_105678702 | 3300002242 | Marine Sediment | MISKIKDKVMVWQLHYRTEIICAVVGFVLGAIIF* |
| JGI25127J35165_10375663 | 3300002482 | Marine | MIINLENWRKKMIKQYKDKFMIWQMHNRREIVCAVAGFIIGALIF* |
| JGI25132J35274_10154832 | 3300002483 | Marine | MIINLENWRKTMINKYKDKFMIWQLHYRTEIVCVAVGFVLGAIIF* |
| JGI25128J35275_10323482 | 3300002488 | Marine | MIINLENWRKKMIKQYKDKFMVWQMHNRREIVCAVAGFIVGALIF* |
| JGI25133J35611_101289953 | 3300002514 | Marine | MIITLENWRKKMIKQYVDRFMIWQLHNRREIVCGVVGFIIGALIF* |
| Ga0066222_10814932 | 3300004460 | Marine | TGETLMIEKYLDKFMIWQLHYRTEIVIAVAAFLIGAILF* |
| Ga0075117_11351181 | 3300005914 | Saline Lake | MSLEKTGEISMVEKYLDKFMVWQLHNRTEIVIAVIAFVIGAILF* |
| Ga0075119_10043756 | 3300005931 | Saline Lake | MSLEKTGEISMVEKYLDKFMVWQLHNRTEIVIAVISFLIGAILF* |
| Ga0075119_10804411 | 3300005931 | Saline Lake | MIEKYLDKLMMWQLHNRKEIIIAVISFLIGAILF* |
| Ga0075478_100602602 | 3300006026 | Aqueous | MINKYKDKFMVWQLQNRTEIVIAVVAFVIGAILF* |
| Ga0075478_101685632 | 3300006026 | Aqueous | MMIEKYLDKFMVWQLHNRTEIVIAVVAFVIGAILF* |
| Ga0075466_10156323 | 3300006029 | Aqueous | MINKYKDKFMVWQLQNRKEIVIAVVAFVVGAILF* |
| Ga0075466_11594822 | 3300006029 | Aqueous | MINKYKEKFMIWQLHNRKEIVIAIASFVIGAIIF* |
| Ga0075441_103199812 | 3300006164 | Marine | MINKYKDKFLVWQLHNRKEIVIAIAAFVIGAILF* |
| Ga0075441_103834642 | 3300006164 | Marine | MIEKYLDKFMVWQLHNRAEIIIAVAAFVMGAILF* |
| Ga0075446_101910352 | 3300006190 | Marine | MIEKYLEKFMVWQLYNRKEIVIAIAAFVIGAILF* |
| Ga0075446_102397552 | 3300006190 | Marine | MINKYKDKFLVWQLHYRTEIIIAVVAFVTGAILF* |
| Ga0075447_101838292 | 3300006191 | Marine | MIEKYLDKLMVWQLHNRKEIVIAVVAFLIGAILF* |
| Ga0075445_100562914 | 3300006193 | Marine | MIEKYLDKLMVWQLHNRTEIVIAVVAFLIGAILF* |
| Ga0068468_10803923 | 3300006305 | Marine | MINKYKEKFIIWQLHNRKEIIIAVVAFGIGAILL* |
| Ga0068500_11277432 | 3300006332 | Marine | MINKYKEKFMIWQLHNRKEIIIAVVAFGIGAILL* |
| Ga0099954_10784712 | 3300006350 | Marine | MINKYKEKFMVWQLHNRKEIIIAVVAFGIGAILL* |
| Ga0099972_123760172 | 3300006467 | Marine | MIEKYLDKFMVWQLHNRTEIVIAVVAFVIGAILF* |
| Ga0100226_10590341 | 3300006480 | Marine | IYATMINKYKEKFMIWQLHNRKEIIIAVVAFGIGAILL* |
| Ga0101553_11224503 | 3300006611 | Diffuse Hydrothermal Flow Volcanic Vent | QSILKFEKFLVWQLHNRTEIVIAIVAFVIGAILF* |
| Ga0098038_10150767 | 3300006735 | Marine | MINKYKEKFMVWQLHYRTEIICAAVGFVLGAVIF* |
| Ga0098038_10311845 | 3300006735 | Marine | MIDKYKEKFMVWQLHYRTEIVCVVAGFIAGAIIF* |
| Ga0098038_10789242 | 3300006735 | Marine | MINKYKDKFMVWQLHNRTEIICGVVGFILGAIIF* |
| Ga0098038_12097002 | 3300006735 | Marine | MINKIKDKVMVWQLHYRTEVIIAVVAFVLGAVIF* |
| Ga0098037_10765052 | 3300006737 | Marine | MIDKYKEKFMIWQLHYRTEIIIAVAAFVLGAVIF* |
| Ga0098040_10899405 | 3300006751 | Marine | NWRKTMINKYKDKFMVWQLHNRREIVCAVVGFIVGALIF* |
| Ga0098048_11179392 | 3300006752 | Marine | MLKQYKDKFMLWQLHNRTEIIIAGVSFILGAIIF* |
| Ga0098048_11886752 | 3300006752 | Marine | MINKYKDKFMIWQLHYRREIVCVAAGFILGAIIF* |
| Ga0098048_12192854 | 3300006752 | Marine | RKKMIKQYVDKFMIWQLHNRTEIVCAAVGFVLGAIIF* |
| Ga0098039_12155961 | 3300006753 | Marine | MINKYKDKFMVWQLHNRREIVCAVVGFIVGALIF* |
| Ga0098044_10145014 | 3300006754 | Marine | MIINLGNWRKIMINKYIEKFMVWQLHYRTEIVCVIAGFIVGAIIF* |
| Ga0098044_11334825 | 3300006754 | Marine | NWRKKMIKQYVNKFMIWQLHNRTEIVCAAVGFVLGAIIF* |
| Ga0098044_11898171 | 3300006754 | Marine | HMIISLENWRKTMINKYKDKFMVWQLHYRTEIICAAVGFVLGAIIF* |
| Ga0098054_13227582 | 3300006789 | Marine | MINKYKDKFMVWQLHNRREIICAVVGFILGAIIL* |
| Ga0098055_12295311 | 3300006793 | Marine | VRMIINLENWRKKMIKQYVDKFMIWQLHNRTEIVCAAVGFVLGAIIF* |
| Ga0075467_104865561 | 3300006803 | Aqueous | KTMIEKYLDKFMVWQLHNRTEIVIAVVSFVIGAIIF* |
| Ga0070754_101109612 | 3300006810 | Aqueous | MINKYKDKFMVWQLHNRKEIVIAIAAFVIGAILF* |
| Ga0070746_104585162 | 3300006919 | Aqueous | MINKYKEKFMVWQLHNRREIVCAVAGFIVGAIIF* |
| Ga0070748_11560822 | 3300006920 | Aqueous | MIEKYLDKFMVWQLHNRTEIVIAVVAFVIGAIIF* |
| Ga0098060_11146141 | 3300006921 | Marine | ISFTKLRRKKMINKYKEKFMVWQLHYRTEIVCVVAGFIAGAIIF* |
| Ga0098060_11660571 | 3300006921 | Marine | MINKYKEKFMVWQLHYRTEIVCVVAGFIAGAIIF* |
| Ga0098053_10043372 | 3300006923 | Marine | MIISLENWRKTMINKYKDKFMVWQLHYRTEIICAAVGFVLGAIIF* |
| Ga0098053_11119561 | 3300006923 | Marine | NLENWRKKMIKQYVDKFMIWQLHNRTEIVCAAVGFVLGAIIF* |
| Ga0098051_10515135 | 3300006924 | Marine | ISLENWRKTMINKYKDKFMVWQLNYRTEIICAAVGFVLGAIIF* |
| Ga0098051_12058852 | 3300006924 | Marine | WRKKMIKQYYDKFMIWQLHNRTEILCVAVGFVIGAIVF* |
| Ga0098036_100315220 | 3300006929 | Marine | MIINLGNWRKKMIKQYKDKFMVWQLHNRREIVCAAVGFVIGAIIF* |
| Ga0098036_10355305 | 3300006929 | Marine | KIMIDKYKEKFMIWQLHYRTEIIIAVVAFVLGAVIF* |
| Ga0098036_10400122 | 3300006929 | Marine | MINKYKEKFMIWQLHNRKEIVIAVAAFVIGAIIF* |
| Ga0075468_102011501 | 3300007229 | Aqueous | RKTMIEKYLDKFMVWQLHNRTEIVIAVVAFVIGAIIF* |
| Ga0070747_10209542 | 3300007276 | Aqueous | MIKKYLDKFMVWQLHNRTEIVIAVVAFVIGAIIF* |
| Ga0070747_12368551 | 3300007276 | Aqueous | MFDYYKNKFMIWQLHNRKEIVIAVVAFAIGAILI* |
| Ga0070745_11657612 | 3300007344 | Aqueous | MINKYKDKFMVWQLHNRTEIIIAVVAFVIVAILF* |
| Ga0070753_10911442 | 3300007346 | Aqueous | MINKYKEKFMIWQLHNRKEIVIAIVSFVIGAIIF* |
| Ga0102852_10745232 | 3300007718 | Estuarine | MINKYKDKFMVWQLHNRADIIIAVVAFVIGAILF* |
| Ga0110931_11937842 | 3300007963 | Marine | MIDKYKEKFMIWQLHYRTEIIIAVVAFVLGAVIF* |
| Ga0105747_13093862 | 3300007974 | Estuary Water | MINKYKDKFMVWQLHNRKEIVIAIVAFVIGAIIF* |
| Ga0114898_11064552 | 3300008216 | Deep Ocean | MINKYKEKFMIWQLHYRTEILIAVAAFVLGAIIF* |
| Ga0114898_11204712 | 3300008216 | Deep Ocean | MINKYKDKFMAWQLQNRTEIIIAVVAFVIGAIVF* |
| Ga0114904_10539763 | 3300008218 | Deep Ocean | MINKYKEKFMIWQLHNRREIICAVAGFILGAIIF* |
| Ga0114904_11551171 | 3300008218 | Deep Ocean | MINKYKEKFMIWQLHYRTEIIIAVVAFVLGAVIF* |
| Ga0114916_11470112 | 3300008221 | Deep Ocean | MIEKYLDKLMVWQLHNRTEIIIAVIAFLIGAILF* |
| Ga0102810_11480712 | 3300009002 | Estuarine | MINKYKEKFMIWQLHNRKEIVIAIAAFVIGAIIF* |
| Ga0102829_10666731 | 3300009026 | Estuarine | MINKYKDKFMVWQLHNRKEIVIAIAAFVIGAIIF* |
| Ga0102829_11654152 | 3300009026 | Estuarine | MINKYKEKFMIWQLHYRTEILIAVAAFVIGAIIF* |
| Ga0114918_103191672 | 3300009149 | Deep Subsurface | MVDKYLDKLMVWQLQNRTEIIIAVIAFLIGAILF* |
| Ga0114996_103743773 | 3300009173 | Marine | MIEKYLDKLMVWQLHNRKEIVIAVVAFVIGAILF* |
| Ga0114996_105936672 | 3300009173 | Marine | MIEKYLDKFMVWQLNNRTEIVIAVVAFIFGAILF* |
| Ga0114996_109203302 | 3300009173 | Marine | MIEKYLDKFMVWQLDNRAEIIIAVAAFIIGAILF* |
| Ga0115551_13176322 | 3300009193 | Pelagic Marine | MINKYKEKFMVWQLHNRKEIVIAIAAFVIGAILF* |
| Ga0114994_105340792 | 3300009420 | Marine | MIEKYLDKFMVWQLHNRAEIIIAVVAFVIGAILF* |
| Ga0114997_103259132 | 3300009425 | Marine | MINKYKDKFMVWQLIYRTEIVIAVVAFVIGAILF* |
| Ga0114997_105801602 | 3300009425 | Marine | MVDKYLDKLMMWQLHNRTEIIIAVVAFVIGAILF* |
| Ga0114915_11199092 | 3300009428 | Deep Ocean | MINKYKDKFLVWQLHYRAEIIIAVAAFVMGAILF* |
| Ga0115545_12050181 | 3300009433 | Pelagic Marine | KKMINKYKDKFMVWQLHNRTEIIIAVVAFVIGAILF* |
| Ga0115546_13065602 | 3300009435 | Pelagic Marine | MINKYKEKFMVWQLHYRTEIVCVVAGFIVGAIIF* |
| Ga0115008_110349592 | 3300009436 | Marine | MINKYKDKFLVWKLHNRKEIVIAIAAFVIGAIIF* |
| Ga0115553_14272202 | 3300009445 | Pelagic Marine | MINKYKEKFMIWQLHNRKEIVIAIAAFVIGAILF* |
| Ga0114932_105949903 | 3300009481 | Deep Subsurface | NLENWRKKMIKQYKDKFMVWQLHNRREIVCAVVGFIVGAIIF* |
| Ga0114932_108906012 | 3300009481 | Deep Subsurface | MINKYKDKFMVWQLHNRREIVCAVAGFILGAIIF* |
| Ga0115003_101587482 | 3300009512 | Marine | MFEEYKNKFMVWQLHNRTEIIIAGVSFILGAIIF* |
| Ga0115013_103955872 | 3300009550 | Marine | MINKYKDKFLVWQLHNRREIVCAVAGFILGAIIF* |
| Ga0114900_11345592 | 3300009602 | Deep Ocean | MINKYKDKFMVWQLQNRTEIIIAVVAFVMGAIIF* |
| Ga0114911_11003562 | 3300009603 | Deep Ocean | MINKYKDKFMVWQLHHRTEIVIAVVAFVIGAILF* |
| Ga0114901_10585722 | 3300009604 | Deep Ocean | MINEIKDKIMVWQLHYRREIIIAVVAFAIGAILI* |
| Ga0114906_10834313 | 3300009605 | Deep Ocean | MINKYKEKFMIWQLHNRKEILIAIAAFVIGAIIF* |
| Ga0114933_104054552 | 3300009703 | Deep Subsurface | MINKIKDKVMVWQLHYRTEIIIAVAAFVLGAVIF* |
| Ga0115000_107699471 | 3300009705 | Marine | GETLMIEKYLDKFMVWQLHNRAEIIIAVAAFVIGAILF* |
| Ga0115001_103818502 | 3300009785 | Marine | MIEKYLDKLMVWQLHNRTEIVIAVVAFLIGAILFSTLTGDK* |
| Ga0114999_107602722 | 3300009786 | Marine | MIEKYLDKFMVWQLHNRTEIVIAVAAFVIGAILF* |
| Ga0115012_104560362 | 3300009790 | Marine | MINKYKDKFMVWQLHYRTEIICAVAGFVVGAIIF* |
| Ga0098043_12190932 | 3300010148 | Marine | MINKYKDKFMVWQLHYRTEIICAAVGFVLGAIIF* |
| Ga0098049_11931131 | 3300010149 | Marine | KTWRKTMINKYKDKFMVWQLHYRTEIICAAVGFVLGAIIF* |
| Ga0098059_14014302 | 3300010153 | Marine | NLENWRKKMINKYKDKFMVWQLHNRREIICAVAGFIIGAIIF* |
| Ga0118731_1025629972 | 3300010392 | Marine | MIEKYLDKFMVWQLHNRTEIVIAVVAFLIGAILF* |
| Ga0118731_1105464291 | 3300010392 | Marine | MINKYKDKFMVWQLQNRAEIVIAVVAFVIGAILF* |
| Ga0114934_101336621 | 3300011013 | Deep Subsurface | ETWRKTMINKYKEKFMIWQLHYRTEILIAVAAFVLGAVIF* |
| Ga0114934_102323883 | 3300011013 | Deep Subsurface | MIDKYKEKFMIWQLHYRTEILIAIAAFVLGAVIF* |
| Ga0151669_1013462 | 3300011128 | Marine | MINKYKDKFMVWQLHYRTEIICAAVGFVFGAIIF* |
| Ga0138260_102174671 | 3300012419 | Polar Marine | MIEKYLDKLMVWQLHNRTEIIIAVVAFLIGAILF* |
| Ga0160423_103222672 | 3300012920 | Surface Seawater | MIKKYYDKFMVWQLHNRREIVFAIAGFVVGIFIML* |
| Ga0163179_104375121 | 3300012953 | Seawater | INLGNWRKKMIKQYKDKFMVWQLHNRREIVCAAVGFVLGAIIF* |
| Ga0163179_110886762 | 3300012953 | Seawater | MINKYKEKFMIWQLHYRTEILIASVAFVLGAVIF* |
| Ga0181369_10653911 | 3300017708 | Marine | KTWRKTMINKYKDKFMVWQLHYRTEIICAAVGFVLGSIIF |
| Ga0181412_11422553 | 3300017714 | Seawater | WRKMMINKYKEKFMIWQLHYRTEILIASVAFVLGAIIF |
| Ga0181404_11528411 | 3300017717 | Seawater | TMINKYKDKFMAWQLQNRTEIVIAVVAFVIGAIIF |
| Ga0181373_10476591 | 3300017721 | Marine | RKTMINKYKDKFMVWQLHYRTEIICAAVGFVLGAIIF |
| Ga0181419_10700531 | 3300017728 | Seawater | ETWRKMMINKYKEKFMIWQLHYRTEIIIAVAAFVLGAVIF |
| Ga0187218_10138014 | 3300017737 | Seawater | MRMFDYYKNKFMIWQLNNRKEIVIAVVAFAIGAILI |
| Ga0187218_11682541 | 3300017737 | Seawater | RKKMINKYKDKFMVWQLHYRTEIVCVVVGFILGAIIF |
| Ga0181433_11000521 | 3300017739 | Seawater | KTMINKYKDKFMVWQLHYRTEIICAAVGFVLGAIIF |
| Ga0181418_10789783 | 3300017740 | Seawater | WRKKMINKYKDKFMVWQLHYRTEIICFVAGFIVGAIII |
| Ga0181397_10656143 | 3300017744 | Seawater | RKMMINKYKEKFMVWQLHYRTEIICVVAGFIVGAIIF |
| Ga0181389_11570961 | 3300017746 | Seawater | TWRKMMINKYKEKFMIWQLHYRTEIIIASVAFVLGAIIF |
| Ga0181400_10800851 | 3300017752 | Seawater | KNWKKKMINKYQDKFKVWQLHHRTEIVIGVGAFVAGALIF |
| Ga0181382_11212421 | 3300017756 | Seawater | TWRKMMINKYKEKFMIWQLHYRTEILIAVAAFVLGAIIF |
| Ga0181413_10270451 | 3300017765 | Seawater | RKMMINKYKEKFMIWQLHYRTEILIASVAFVLGAIIF |
| Ga0187220_12248771 | 3300017768 | Seawater | TWRKMMINKYKEKFMIWQLHNRKEIVIAVAAFVIGAIIF |
| Ga0211523_103934592 | 3300020414 | Marine | MIKKYYDKFMVWQLHNRREIVFAIAGFVVGIFIML |
| Ga0196887_10841751 | 3300022178 | Aqueous | TMILKTWRKTMINKYKDKFMVWQLHNRKEIVIAVVAFVVGAILF |
| Ga0222632_10035302 | 3300022842 | Saline Water | MSLEKTGEISMIDKYLDKLMMWQLHNRKEIIIAVISFLIGAILF |
| Ga0222691_10112526 | 3300022851 | Saline Water | MSLEKTGEISMVEKYLDKFMVWQLHNRTEIVIAVISFLIGAILF |
| Ga0222652_10257662 | 3300022853 | Saline Water | MSLEKTGEISMVEKYLDKFMVWQLHNRTEIVIAVIAFVIGAILF |
| Ga0222662_10409023 | 3300022885 | Saline Water | MSLEKTGEISMVDKYLDKLMMWQLHNRKEIIIAVISFLIGAILF |
| Ga0222655_100311415 | 3300023245 | Saline Water | LMVDKYLDKFMVWQLHNRTEIVIAVISFLIGAILF |
| Ga0210003_11105943 | 3300024262 | Deep Subsurface | MSLEKTGEISMVDKYLDKLMVWQLQNRTEIIIAVIAFLIGAILF |
| (restricted) Ga0255042_103298082 | 3300024340 | Seawater | MLLKTWRKRMINKYKDKFMVWQLNYRTEIICAAVGFVLGSIIF |
| Ga0209992_100040966 | 3300024344 | Deep Subsurface | MIINLGNWRKKMIKQYKDKFMLWQLHNRREIVCAVAGFIIGALIF |
| Ga0207879_1035722 | 3300025026 | Marine | MMIEKYLDKFMVWQLHNRTEIVIAVVAFVIGAILF |
| Ga0208012_10050435 | 3300025066 | Marine | MIINLENWRKTMINKYKDKFMVWQLHNRREIVCAVVGFIVGALIF |
| Ga0208667_10382541 | 3300025070 | Marine | ENWRKTMINKYKDKFMVWQLHYRTEIICAAVGFVLGAIIF |
| Ga0207896_10720962 | 3300025071 | Marine | MMINKYKEKFMIWQLHNRKEIVIAIASFVIGAIIF |
| Ga0208791_10719823 | 3300025083 | Marine | NWRKTMINKYKDKFMVWQLHYRTEIICAAVGFVLGAIIF |
| Ga0208011_10993803 | 3300025096 | Marine | KTMINKYKDKFMVWQLHNRREIVCAVVGFIVGALIF |
| Ga0208669_10811221 | 3300025099 | Marine | IISFTKLRRKKMINKYKEKFMVWQLHYRTEIVCVVAGFIAGAIIF |
| Ga0208013_10003898 | 3300025103 | Marine | MIISLENWRKTMINKYKDKFMVWQLHYRTEIICAAVGFVLGAIIF |
| Ga0208013_10232243 | 3300025103 | Marine | MKKVRMIINLGNWRKKMIKQYVDKFMIWQLHNRTEIVCAAVGFVLGAIIF |
| Ga0208013_11444221 | 3300025103 | Marine | KKVRMIINLENWRKKMIKQYVNKFMIWQLHNRTEIVCAAVGFVLGAIIF |
| Ga0208013_11543313 | 3300025103 | Marine | WRKIMINKYIEKFMVWQLHYRTEIVCVIAGFIVGAIIF |
| Ga0208793_10686691 | 3300025108 | Marine | VRMIINLENWRKKMIKQYVDKFMIWQLHNRTEIVCAAVGFVLGAIIF |
| Ga0208793_11870283 | 3300025108 | Marine | MKKVRMIINLENWRKKMIKQYKDRFMVWQLHNRREIICAVVGFIVGALIF |
| Ga0208158_100492711 | 3300025110 | Marine | MIINLENWRKKMINKYKDKFMVWQLHNRREIICAVAGFIIGAIIF |
| Ga0208158_10100642 | 3300025110 | Marine | MKKVHMIINLGNWRKIMINKYIEKFMVWQLHYRTEIVCVIAGFIVGAIIF |
| Ga0208158_11560111 | 3300025110 | Marine | TWRKTMINKYKEKFLIWQLHYRREIVCVAAGFILGAIIF |
| Ga0208790_10390691 | 3300025118 | Marine | MKKAHMIISLENWRKTMINKYKDKFMVWQLHYRTEIICAAVGFVLGAIIF |
| Ga0208790_11338964 | 3300025118 | Marine | ISLGNWRKTMINKYKDKFMVWQLHNRREIVCAVVGFIVGALIF |
| Ga0209535_10557143 | 3300025120 | Marine | MMIEKYLDRFMVWQLHNRTEIVIAVVAFVIGAILF |
| Ga0209348_10149383 | 3300025127 | Marine | MIINLENWRKKMIKQYKDKFMIWQMHNRREIVCAVAGFIIGALIF |
| Ga0209348_11810641 | 3300025127 | Marine | KAMINKYKDKLMVWQLHYRTEIICAVVGFVLGSIIF |
| Ga0208919_101456310 | 3300025128 | Marine | MIINLGNWRKKMIKQYKDKFMVWQLHNRREIVCAAVGFVIGAIIF |
| Ga0209128_11292601 | 3300025131 | Marine | KKVRMIINLENWRKKMIKQYKDKFMIWQLHNRREIVCAVVGFIVGALIF |
| Ga0208299_10462365 | 3300025133 | Marine | MIINLENWRKTMINKYKDKFMIWQLHYRREIVCVAAGFILGAIIF |
| Ga0208299_11854704 | 3300025133 | Marine | SMKKVRMIINLENWRKKMIKQYVDKFMIWQLHNRTEIVCAAVGFVLGAIIF |
| Ga0209634_11405401 | 3300025138 | Marine | MMINKYKDKFMVWQLHNRKEIVIAIVAFVIGAILF |
| Ga0209756_10117492 | 3300025141 | Marine | MIINLGNWRKIMINKYIEKFMVWQLHYRTEIVCVIAGFIVGAIIF |
| Ga0209756_10260952 | 3300025141 | Marine | MKKVRMIINLENWRKKMINKYKDKFMVWQLHNRREIVCAVVGFVIGAIIF |
| Ga0209756_11395841 | 3300025141 | Marine | GNWRKKMIKQYVDKFMIWQLHNRTEIVCAAIGFVLGAIIF |
| Ga0209337_13047683 | 3300025168 | Marine | TMIKKYLDKFMVWQLHNRTEIVIAVVAFVIGAILF |
| Ga0208814_10245703 | 3300025276 | Deep Ocean | MMIEKYLDKLMVWQLHNRTEIIIAVVAFLIGAILF |
| Ga0209306_11114251 | 3300025680 | Pelagic Marine | WRKTMINKYIEKFMIWQLHYRTEILIAVAAFVLGAIIF |
| Ga0209710_12918853 | 3300027687 | Marine | LMIEKYLDKFMVWQLHNRAEIIIAVAAFVMGAILF |
| Ga0209711_101673741 | 3300027788 | Marine | MSLEKTGETLMIEKYLDKFMVWQLHNRAEIIIAVAAFVMGAILF |
| Ga0209830_102599063 | 3300027791 | Marine | TLMIEKYLDKFMVWQLHNRAEIIIAVVAFVIGAILF |
| (restricted) Ga0233415_105606681 | 3300027861 | Seawater | QQSILKLEKFMLWQLHNRTEIVIAVVSFVLGAVIF |
| Ga0256382_11228841 | 3300028022 | Seawater | MGGNMISKYKDKFMIWQLHYRTEIIIAVAAFVLGAVIF |
| Ga0183755_10746153 | 3300029448 | Marine | MMINKYKEKFMIWQLHYRTEIVCAIAGFILGAIIF |
| Ga0183757_10542761 | 3300029787 | Marine | RKTMINEIKDKVMVWQLHYRTEIIIAVAAFVLGAVIF |
| Ga0307489_103122095 | 3300031569 | Sackhole Brine | ISMVDKYLDKLMVWQLHNRKEIVIAVVAFVIGAILF |
| Ga0307992_13039791 | 3300031601 | Marine | LMIEKYLDKFMVWQLHNRAEIIIAVAAFVIGAILF |
| Ga0307993_10470523 | 3300031602 | Marine | SLEKTGETLMIEKYLDKFMVWQLHNRAEIIIAVAAFVMGAILF |
| Ga0315316_110146821 | 3300032011 | Seawater | EIWRKMMINKYKDKFMVWQLQNRTEIVIAVVAFVIGAIIF |
| Ga0315315_110738501 | 3300032073 | Seawater | ETWRKMMINKYKEKFMIWQLHYRTEILIASVAFVLGAVIF |
| Ga0316203_10458423 | 3300032274 | Microbial Mat | MKMFDYYKNKFMIWQLHNRKEIVIAVVAFAIGAILI |
| Ga0314858_063844_346_453 | 3300033742 | Sea-Ice Brine | MMIEKYLDKFMIWQLHNRTEIVIAVVAFVIGAILF |
| Ga0314858_187854_367_474 | 3300033742 | Sea-Ice Brine | MMINKYKDKFMVWQLHNRKEIVIAIAAFVIGAIIF |
| ⦗Top⦘ |