| Basic Information | |
|---|---|
| Family ID | F018072 |
| Family Type | Metagenome |
| Number of Sequences | 237 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVTR |
| Number of Associated Samples | 155 |
| Number of Associated Scaffolds | 237 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.00 % |
| % of genes near scaffold ends (potentially truncated) | 53.16 % |
| % of genes from short scaffolds (< 2000 bps) | 89.45 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.671 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (8.439 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.789 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.713 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.14% Coil/Unstructured: 72.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 237 Family Scaffolds |
|---|---|---|
| PF12796 | Ank_2 | 2.53 |
| PF13637 | Ank_4 | 2.53 |
| PF13620 | CarboxypepD_reg | 1.27 |
| PF00550 | PP-binding | 0.84 |
| PF00072 | Response_reg | 0.84 |
| PF12867 | DinB_2 | 0.84 |
| PF00326 | Peptidase_S9 | 0.84 |
| PF13946 | DUF4214 | 0.42 |
| PF01182 | Glucosamine_iso | 0.42 |
| PF02781 | G6PD_C | 0.42 |
| PF07676 | PD40 | 0.42 |
| PF13304 | AAA_21 | 0.42 |
| PF00871 | Acetate_kinase | 0.42 |
| PF06580 | His_kinase | 0.42 |
| PF00144 | Beta-lactamase | 0.42 |
| PF00005 | ABC_tran | 0.42 |
| PF05496 | RuvB_N | 0.42 |
| PF04972 | BON | 0.42 |
| PF13180 | PDZ_2 | 0.42 |
| PF13412 | HTH_24 | 0.42 |
| PF13857 | Ank_5 | 0.42 |
| PF14294 | DUF4372 | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 237 Family Scaffolds |
|---|---|---|---|
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.42 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.42 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.42 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.42 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.42 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.42 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.42 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.42 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.67 % |
| Unclassified | root | N/A | 6.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105601624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1181 | Open in IMG/M |
| 3300000531|CNBas_1002557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
| 3300000953|JGI11615J12901_10692592 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300000953|JGI11615J12901_12907634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300000956|JGI10216J12902_106985255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300000956|JGI10216J12902_108614083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1902 | Open in IMG/M |
| 3300002568|C688J35102_118810605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300004114|Ga0062593_102508849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300004463|Ga0063356_102412487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300004643|Ga0062591_100850943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300004643|Ga0062591_101367157 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005288|Ga0065714_10218977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300005290|Ga0065712_10007481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3081 | Open in IMG/M |
| 3300005293|Ga0065715_10235423 | Not Available | 1213 | Open in IMG/M |
| 3300005293|Ga0065715_10411720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300005293|Ga0065715_10713377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300005294|Ga0065705_10202339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1421 | Open in IMG/M |
| 3300005295|Ga0065707_10835244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300005295|Ga0065707_11036354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 522 | Open in IMG/M |
| 3300005328|Ga0070676_10079182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1989 | Open in IMG/M |
| 3300005332|Ga0066388_107074905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300005332|Ga0066388_107805001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300005334|Ga0068869_100601704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300005345|Ga0070692_10221017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
| 3300005345|Ga0070692_10480719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300005364|Ga0070673_101626515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300005365|Ga0070688_101330201 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005366|Ga0070659_101704920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300005440|Ga0070705_100571278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300005441|Ga0070700_100358963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
| 3300005459|Ga0068867_101563767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300005535|Ga0070684_101462357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300005539|Ga0068853_100450240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300005539|Ga0068853_101489950 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005543|Ga0070672_101180447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300005543|Ga0070672_101899528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300005545|Ga0070695_100157376 | Not Available | 1591 | Open in IMG/M |
| 3300005545|Ga0070695_100194091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1447 | Open in IMG/M |
| 3300005545|Ga0070695_101604453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300005546|Ga0070696_100884492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300005548|Ga0070665_101914435 | Not Available | 599 | Open in IMG/M |
| 3300005578|Ga0068854_100396429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1141 | Open in IMG/M |
| 3300005616|Ga0068852_101159462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300005617|Ga0068859_101321964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300005617|Ga0068859_101608578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300005618|Ga0068864_100171987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1976 | Open in IMG/M |
| 3300005618|Ga0068864_100190520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1880 | Open in IMG/M |
| 3300005618|Ga0068864_101506171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300005713|Ga0066905_101513472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300005719|Ga0068861_101376422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300005719|Ga0068861_102500150 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005834|Ga0068851_10509015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300005834|Ga0068851_10562925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300005834|Ga0068851_11083635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300005841|Ga0068863_102338410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300005842|Ga0068858_100474076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
| 3300005843|Ga0068860_100695235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
| 3300005844|Ga0068862_100679458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
| 3300005888|Ga0075289_1049843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300005895|Ga0075277_1070711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300005937|Ga0081455_10118659 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
| 3300006169|Ga0082029_1318403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300006173|Ga0070716_100804140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300006755|Ga0079222_10284375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1067 | Open in IMG/M |
| 3300006755|Ga0079222_10849945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300006794|Ga0066658_10630002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300006806|Ga0079220_11757486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300006844|Ga0075428_102232607 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006846|Ga0075430_100104735 | Not Available | 2361 | Open in IMG/M |
| 3300006846|Ga0075430_101011860 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300006852|Ga0075433_11120872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300006854|Ga0075425_100070469 | All Organisms → cellular organisms → Bacteria | 3936 | Open in IMG/M |
| 3300006880|Ga0075429_100501672 | Not Available | 1063 | Open in IMG/M |
| 3300006894|Ga0079215_10495962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300006904|Ga0075424_102421109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300006904|Ga0075424_102725961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300006918|Ga0079216_11776375 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009011|Ga0105251_10298408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300009011|Ga0105251_10339357 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300009093|Ga0105240_10015950 | All Organisms → cellular organisms → Bacteria | 10190 | Open in IMG/M |
| 3300009094|Ga0111539_10000773 | All Organisms → cellular organisms → Bacteria | 41594 | Open in IMG/M |
| 3300009094|Ga0111539_12172597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300009098|Ga0105245_11798216 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009098|Ga0105245_11948301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300009098|Ga0105245_13186156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300009100|Ga0075418_10188060 | Not Available | 2199 | Open in IMG/M |
| 3300009100|Ga0075418_13024109 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009101|Ga0105247_10229311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1260 | Open in IMG/M |
| 3300009101|Ga0105247_10536576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300009101|Ga0105247_10865047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300009147|Ga0114129_10991135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1059 | Open in IMG/M |
| 3300009148|Ga0105243_10945094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300009148|Ga0105243_13101973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300009156|Ga0111538_11385191 | Not Available | 887 | Open in IMG/M |
| 3300009162|Ga0075423_11576206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300009162|Ga0075423_12167342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300009162|Ga0075423_12255688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300009162|Ga0075423_12369932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300009174|Ga0105241_10289901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1401 | Open in IMG/M |
| 3300009174|Ga0105241_11076780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300009174|Ga0105241_11661427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300009174|Ga0105241_12495856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300009176|Ga0105242_10387805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1300 | Open in IMG/M |
| 3300009176|Ga0105242_11989072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300009177|Ga0105248_10682954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1158 | Open in IMG/M |
| 3300009545|Ga0105237_12170888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300009551|Ga0105238_12890284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300009553|Ga0105249_10035977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4492 | Open in IMG/M |
| 3300009553|Ga0105249_10647037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300009553|Ga0105249_11202388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300009789|Ga0126307_10176716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1711 | Open in IMG/M |
| 3300009789|Ga0126307_11688096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300009840|Ga0126313_10758031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300009840|Ga0126313_11779665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300010036|Ga0126305_10035356 | All Organisms → cellular organisms → Bacteria | 2754 | Open in IMG/M |
| 3300010036|Ga0126305_10149428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1451 | Open in IMG/M |
| 3300010038|Ga0126315_10681100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300010040|Ga0126308_10155508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1447 | Open in IMG/M |
| 3300010042|Ga0126314_10040898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2962 | Open in IMG/M |
| 3300010042|Ga0126314_11228318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300010043|Ga0126380_10756011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300010044|Ga0126310_10062590 | Not Available | 2118 | Open in IMG/M |
| 3300010045|Ga0126311_10114495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1873 | Open in IMG/M |
| 3300010045|Ga0126311_10741155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300010045|Ga0126311_11090407 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300010045|Ga0126311_11342723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 595 | Open in IMG/M |
| 3300010045|Ga0126311_11848365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300010045|Ga0126311_11918197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300010166|Ga0126306_10743845 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300010166|Ga0126306_10793529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300010166|Ga0126306_11455677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 568 | Open in IMG/M |
| 3300010359|Ga0126376_10093802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2269 | Open in IMG/M |
| 3300010359|Ga0126376_11527244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300010359|Ga0126376_12662504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300010373|Ga0134128_10958821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
| 3300010373|Ga0134128_11068876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300010375|Ga0105239_10148440 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
| 3300010375|Ga0105239_11647906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300010397|Ga0134124_10067648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3039 | Open in IMG/M |
| 3300010397|Ga0134124_10733266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300010397|Ga0134124_11470319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300010399|Ga0134127_10046206 | All Organisms → cellular organisms → Bacteria | 3580 | Open in IMG/M |
| 3300010399|Ga0134127_11403805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300010399|Ga0134127_11800726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300010399|Ga0134127_11805619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300010399|Ga0134127_12802381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300010400|Ga0134122_13333942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300010401|Ga0134121_11091246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300010401|Ga0134121_11208164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 756 | Open in IMG/M |
| 3300010403|Ga0134123_10094472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2364 | Open in IMG/M |
| 3300010403|Ga0134123_11033161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300010403|Ga0134123_12638199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300011119|Ga0105246_11119065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300011119|Ga0105246_11429351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300012912|Ga0157306_10265438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300012958|Ga0164299_10090709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1561 | Open in IMG/M |
| 3300012989|Ga0164305_10088863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1948 | Open in IMG/M |
| 3300013100|Ga0157373_11088707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300013102|Ga0157371_11239773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300013296|Ga0157374_10253663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1731 | Open in IMG/M |
| 3300013308|Ga0157375_10190287 | Not Available | 2207 | Open in IMG/M |
| 3300013500|Ga0120195_1002945 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300014325|Ga0163163_10710765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
| 3300014326|Ga0157380_10783437 | Not Available | 969 | Open in IMG/M |
| 3300014326|Ga0157380_12595296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300014745|Ga0157377_10062165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2136 | Open in IMG/M |
| 3300014745|Ga0157377_10879646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300014745|Ga0157377_11653180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300014745|Ga0157377_11661592 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300014968|Ga0157379_10291744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1485 | Open in IMG/M |
| 3300014968|Ga0157379_11479406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300015371|Ga0132258_12307169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1349 | Open in IMG/M |
| 3300015373|Ga0132257_101633980 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300018073|Ga0184624_10027190 | All Organisms → cellular organisms → Bacteria | 2185 | Open in IMG/M |
| 3300018476|Ga0190274_11131674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300018482|Ga0066669_10787440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300021445|Ga0182009_10414556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300025321|Ga0207656_10545193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300025735|Ga0207713_1254168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300025885|Ga0207653_10318279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300025899|Ga0207642_10391676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300025900|Ga0207710_10460141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300025904|Ga0207647_10163176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1299 | Open in IMG/M |
| 3300025907|Ga0207645_10681198 | Not Available | 699 | Open in IMG/M |
| 3300025910|Ga0207684_10836091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300025911|Ga0207654_10491802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300025911|Ga0207654_10825475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300025911|Ga0207654_11362561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300025913|Ga0207695_10401376 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300025913|Ga0207695_10821123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300025918|Ga0207662_10203648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
| 3300025918|Ga0207662_10398876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
| 3300025920|Ga0207649_10935839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300025922|Ga0207646_10049564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3761 | Open in IMG/M |
| 3300025925|Ga0207650_11695202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300025932|Ga0207690_10846426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300025933|Ga0207706_10471511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300025940|Ga0207691_10838177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300025941|Ga0207711_11176837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300025941|Ga0207711_11551199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300025941|Ga0207711_12115324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300025942|Ga0207689_10134601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2035 | Open in IMG/M |
| 3300025945|Ga0207679_11118706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300025960|Ga0207651_11355820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300025961|Ga0207712_11580336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300025981|Ga0207640_10342253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300025988|Ga0208141_1025030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300026023|Ga0207677_10184472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300026035|Ga0207703_10280456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1513 | Open in IMG/M |
| 3300026035|Ga0207703_10316629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
| 3300026035|Ga0207703_10414328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1252 | Open in IMG/M |
| 3300026067|Ga0207678_10727794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300026075|Ga0207708_11149111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300026111|Ga0208291_1029119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1013 | Open in IMG/M |
| 3300026116|Ga0207674_11204839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300026118|Ga0207675_100887109 | Not Available | 908 | Open in IMG/M |
| 3300026142|Ga0207698_12315709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300027691|Ga0209485_1000016 | All Organisms → cellular organisms → Bacteria | 83419 | Open in IMG/M |
| 3300028381|Ga0268264_12564906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300030511|Ga0268241_10115057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300031548|Ga0307408_100534576 | Not Available | 1032 | Open in IMG/M |
| 3300031548|Ga0307408_100865683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300031548|Ga0307408_101769711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300031716|Ga0310813_10433755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300031716|Ga0310813_11184714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300031716|Ga0310813_11268448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300031852|Ga0307410_10584680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
| 3300031852|Ga0307410_11136182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300031858|Ga0310892_10732116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300031908|Ga0310900_10015012 | All Organisms → cellular organisms → Bacteria | 3928 | Open in IMG/M |
| 3300032075|Ga0310890_11840187 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300032157|Ga0315912_11135124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300032180|Ga0307471_101270491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300032205|Ga0307472_101572458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300033412|Ga0310810_10522720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 8.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.59% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 6.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 6.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.11% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.27% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.27% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.27% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.42% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.42% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.42% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.42% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.42% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.42% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013500 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025988 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026111 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1056016243 | 3300000364 | Soil | MLTSGGKIDADEVWRTKDGVWYRRNGIVTLLKRGQVKTIVTR* |
| CNBas_10025572 | 3300000531 | Quercus Rhizosphere | MGTRQGGKPVITLTSGGKIEADEVWRTKDGVWYRRDGIVTLLKRNQVKAIVTR* |
| JGI11615J12901_106925921 | 3300000953 | Soil | GLGTRGGGKPVIVLTSGGKIEADEVWRTRDGIWYRKNGIVTLLKTGRVKAIVNR* |
| JGI11615J12901_129076341 | 3300000953 | Soil | TRQGGKPVIMLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRGQVKTIITR* |
| JGI10216J12902_1069852552 | 3300000956 | Soil | VLASGGKIDADEVWRTKDGVWYRRNGIVTLLKRAQVKTIITR* |
| JGI10216J12902_1086140832 | 3300000956 | Soil | MGSRRGGKPVIILTSGAKIDADEVWRTRDGFWYRKNGVVTLLKHSQVKSIASR* |
| C688J35102_1188106051 | 3300002568 | Soil | MLASGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKSIVTR* |
| Ga0062593_1025088492 | 3300004114 | Soil | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIAAR* |
| Ga0063356_1024124872 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLTSGGKIDADEVWRTRDGVWYRRNGMVTLLKRGQVKTIVTR* |
| Ga0062591_1008509432 | 3300004643 | Soil | SKIKNGKAVILLTSGSRIAADEVWRTRDGVWYRRDGIVTLLKRGQVKAISNQ* |
| Ga0062591_1013671571 | 3300004643 | Soil | TKRKPVIYLKDGGKIEADEVWRTRDGIWFRRNGVVTLLKNARVKSIAN* |
| Ga0065714_102189771 | 3300005288 | Miscanthus Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVTR* |
| Ga0065712_100074814 | 3300005290 | Miscanthus Rhizosphere | MGNRQGGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0065715_102354231 | 3300005293 | Miscanthus Rhizosphere | GSKPVIILTSGGKIDADEVWRTRDGIWYRKNGMVTLLKAARVKAVVNK* |
| Ga0065715_104117202 | 3300005293 | Miscanthus Rhizosphere | TGGRLEADQVWRTKDGVWYRRDGVVTLLKNNRVKAIVNQ* |
| Ga0065715_107133772 | 3300005293 | Miscanthus Rhizosphere | PVIMLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNISTR* |
| Ga0065705_102023392 | 3300005294 | Switchgrass Rhizosphere | MGNRQGGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTVVTR* |
| Ga0065707_108352442 | 3300005295 | Switchgrass Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTVVTR* |
| Ga0065707_110363541 | 3300005295 | Switchgrass Rhizosphere | GSRQGGKPVIVLSSGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKSIGTR* |
| Ga0070676_100791821 | 3300005328 | Miscanthus Rhizosphere | VILLTSGGKIDADEVWRTRDGVWYRKNGIVTLLKPGRVKAIVSR* |
| Ga0066388_1070749051 | 3300005332 | Tropical Forest Soil | TTESKSADSGGKPVVIRLASGGKVEADEVWRTKEGVWYRRDGVVTLLKSNRVKAIVNQ* |
| Ga0066388_1078050012 | 3300005332 | Tropical Forest Soil | GKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTH* |
| Ga0068869_1006017041 | 3300005334 | Miscanthus Rhizosphere | GGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0070692_102210171 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIITR* |
| Ga0070692_104807192 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | GASKIKNGKAVILLTSGSRIAADEVWRTRDGVWYRRDGIVTLLKRGQVKTISNQ* |
| Ga0070673_1016265151 | 3300005364 | Switchgrass Rhizosphere | GKPVIMLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNISTR* |
| Ga0070688_1013302012 | 3300005365 | Switchgrass Rhizosphere | RGSTPVILLTSGGKIDADEVWRTRDGVWYRKNGIVTLLKPGRVKAIVSR* |
| Ga0070659_1017049202 | 3300005366 | Corn Rhizosphere | MGNRQGGKPVIMLASGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0070705_1005712783 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GPGTMKNGKATILLTSGSKLSADEVWRTRDGVWYRRDGIVTLLKRGQVKAIINQ* |
| Ga0070700_1003589631 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLASGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIV |
| Ga0068867_1015637671 | 3300005459 | Miscanthus Rhizosphere | MGNRQGGKPVIMLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRAQVKTI |
| Ga0070684_1014623572 | 3300005535 | Corn Rhizosphere | MLASGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVTR* |
| Ga0068853_1004502401 | 3300005539 | Corn Rhizosphere | SGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0068853_1014899501 | 3300005539 | Corn Rhizosphere | GKPVIMLTSGGKIDADEVWRTRDGVWYRRNGMVTLLKRGQVKSIVTR* |
| Ga0070672_1011804472 | 3300005543 | Miscanthus Rhizosphere | MLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0070672_1018995281 | 3300005543 | Miscanthus Rhizosphere | QGGKPVIMLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNIVTR* |
| Ga0070695_1001573762 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LTSGGKIDADEVWRTRDGVWYRRNGMVTLLKRGQVKSIVTR* |
| Ga0070695_1001940911 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MGNRQGGKPVIVLVSGGKIEADEAWRTKDGVWYRRNGMVTLLKTHQVKAIVTR* |
| Ga0070695_1016044531 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSGGKIEADEVWRTRDGVWYRRNGMVTLLKPGQVKTIVTR* |
| Ga0070696_1008844922 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNIATR* |
| Ga0070665_1019144351 | 3300005548 | Switchgrass Rhizosphere | EADEVWRTKDGVWYRKNGVVTLLKKNKVKAIVSQ* |
| Ga0068854_1003964292 | 3300005578 | Corn Rhizosphere | LTSGGRLEADQVWRTKDGVWYRRDGVVTLLKNNRVKAIVNQ* |
| Ga0068852_1011594622 | 3300005616 | Corn Rhizosphere | MLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRGQVKTIITR* |
| Ga0068859_1013219642 | 3300005617 | Switchgrass Rhizosphere | PVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0068859_1016085781 | 3300005617 | Switchgrass Rhizosphere | GMGNRQGGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0068864_1001719873 | 3300005618 | Switchgrass Rhizosphere | MLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNIATR* |
| Ga0068864_1001905201 | 3300005618 | Switchgrass Rhizosphere | QGGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVTR* |
| Ga0068864_1015061712 | 3300005618 | Switchgrass Rhizosphere | GMGNRQGGKPVIVLVSGGKIEADEAWRTKDGVWYRRNGMVTLLKTRQVKAIVTR* |
| Ga0066905_1015134722 | 3300005713 | Tropical Forest Soil | GKVEADEVWRTKEGVWYRRDGVVTLLKPNRVKAIVNQ* |
| Ga0068861_1013764222 | 3300005719 | Switchgrass Rhizosphere | EADQVWRTKDGVWYRRDGVVTLLKNNRVKAIVNQ* |
| Ga0068861_1025001501 | 3300005719 | Switchgrass Rhizosphere | TSGGKIDADEVWRTRDGVWYRRNGIVTLLKHNRVKAIVNQ* |
| Ga0068851_105090152 | 3300005834 | Corn Rhizosphere | MGTRQGGKPVIVLASGGKIEADEAWRTKDGVWYRRNGIVTLLKTGQVKTIITK* |
| Ga0068851_105629252 | 3300005834 | Corn Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNISTR* |
| Ga0068851_110836351 | 3300005834 | Corn Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0068863_1023384101 | 3300005841 | Switchgrass Rhizosphere | LGKKLGGKPVILLTSGGKIEADEVWRTKDGVWYRRDGIVTLLKQGRVKAIVNQ* |
| Ga0068858_1004740762 | 3300005842 | Switchgrass Rhizosphere | LEADQVWRTKDGVWYRRDGVVTLLKNNRVKAIVNQ* |
| Ga0068860_1006952352 | 3300005843 | Switchgrass Rhizosphere | MLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNISTR* |
| Ga0068862_1006794582 | 3300005844 | Switchgrass Rhizosphere | ILLTSGGKVEADEVWRTKDGVWYRRDGVVTLLKKNRVKAIVKS* |
| Ga0075289_10498431 | 3300005888 | Rice Paddy Soil | EADEVWRTKDGVWYRRNGLVTLLKRGQVKTIVTR* |
| Ga0075277_10707112 | 3300005895 | Rice Paddy Soil | MLTSGGKIEADEVWRTKDGVWYRRNGLVTLLKRGQVKTIVTR* |
| Ga0081455_101186591 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLTSGARIDADEVWRTRDGVWYRRNGMVTLLKRGQVKAIVTR* |
| Ga0082029_13184032 | 3300006169 | Termite Nest | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKNIATR* |
| Ga0070716_1008041402 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GIGKRLGGKPSILLTSGGKIDADEVWRTRDGVWYRRDGIVTLLKHGRVKAIVNQ* |
| Ga0079222_102843751 | 3300006755 | Agricultural Soil | MLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRSQVKTITTR* |
| Ga0079222_108499452 | 3300006755 | Agricultural Soil | MGTRQGAKPVILLASGGKIEADEAWRTKDGVWYRRNGIVTLLKTGQVKAIVTK* |
| Ga0066658_106300023 | 3300006794 | Soil | MGTRQGGKPVILLASGGKIEADEAWRTKDGVWYRRNGMVTLLKRGQVKAIVTR* |
| Ga0079220_117574861 | 3300006806 | Agricultural Soil | KIEADEAWRTKDGVWYRRNGIVTLLKTGQVKAVITK* |
| Ga0075428_1022326071 | 3300006844 | Populus Rhizosphere | AGKPIILLTDGGKIEADEVWRTRDGIWYRRNGMVTLLKHGRVRSIVNR* |
| Ga0075430_1001047351 | 3300006846 | Populus Rhizosphere | GRPATGTQRAGKPIILLTDGGKIEADEVWRTRDGIWYRRNGMVTLLKHGRVRSIVNR* |
| Ga0075430_1010118602 | 3300006846 | Populus Rhizosphere | MLTSGARIEADEVWRTRDGVWYRRNGMVTLLKRGQVKAILTR* |
| Ga0075433_111208722 | 3300006852 | Populus Rhizosphere | MLASGGKIDADEVWRTKDGVWYRRNGIVTLLKRGQVKTIVTR* |
| Ga0075425_1000704693 | 3300006854 | Populus Rhizosphere | MGTRQGGKPVIVLTSGGKIEADEAWRTKDGVWYRRNGMVTLLKRAQVKAIVTR* |
| Ga0075429_1005016721 | 3300006880 | Populus Rhizosphere | EADEVWRTRDGIWYRRNGMVTLLKHGRVRSIVNR* |
| Ga0079215_104959622 | 3300006894 | Agricultural Soil | VLTTGAKIEADEVWRTKDGVWYRRNGMVTLLKRHQVKAIVTR* |
| Ga0075424_1024211092 | 3300006904 | Populus Rhizosphere | SGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKTIVTR* |
| Ga0075424_1027259611 | 3300006904 | Populus Rhizosphere | MGNRQGGKPVILLTSGGKIEADEAWRTKDGVWYRRNGMVTLLKRAQVKAIVTR* |
| Ga0079216_117763751 | 3300006918 | Agricultural Soil | KIEADEVWRTRDGVWYRRNGLVTLLKHGRVRSIVNR* |
| Ga0105251_102984082 | 3300009011 | Switchgrass Rhizosphere | MLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKTIATR* |
| Ga0105251_103393572 | 3300009011 | Switchgrass Rhizosphere | SSGARIEADEVWRTKDGVWYRRNGIVTLLKRAQIKSISTR* |
| Ga0105240_100159506 | 3300009093 | Corn Rhizosphere | MLTSGGRIDADEVWRTRDGVWYRRNGMVTLLKRGQVKAIVTR* |
| Ga0111539_1000077324 | 3300009094 | Populus Rhizosphere | MLASGGKIDADEVWRTKDGVWYRRNGIVTLLKRGQVKNISTR* |
| Ga0111539_121725971 | 3300009094 | Populus Rhizosphere | IMLTSGGKIDADEVWRTKDGVWYRRNGIVTLLKRGQVKTIVTR* |
| Ga0105245_117982161 | 3300009098 | Miscanthus Rhizosphere | GKIDADEVWRTRDGVWYRRNGMVTLLKRGQVKSIMTR* |
| Ga0105245_119483012 | 3300009098 | Miscanthus Rhizosphere | MGNRQGGKPVIVLVSGGKIEADEAWRTKDGVWYRRNGMVTLLKTRQVKAIVTR* |
| Ga0105245_131861561 | 3300009098 | Miscanthus Rhizosphere | MLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVAR* |
| Ga0075418_101880603 | 3300009100 | Populus Rhizosphere | EADEVWRTRDGVWYRRNGMVTLLKRGQVKSIVTR* |
| Ga0075418_130241092 | 3300009100 | Populus Rhizosphere | SKPTIILTTGGKIEADEVWRTRDGFWYRKNGIVTLLKPGRVKAIVNK* |
| Ga0105247_102293111 | 3300009101 | Switchgrass Rhizosphere | KPVIMLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0105247_105365762 | 3300009101 | Switchgrass Rhizosphere | MLTSGGKIDADEVWRTRDGIWYRRNGMVTLLKRQQVKSIK* |
| Ga0105247_108650471 | 3300009101 | Switchgrass Rhizosphere | MGTRQGGKPVIMLASGGKIEADEAWRTKDGVWYRRNGIVTLLKTNQVKAIVTNK* |
| Ga0114129_109911352 | 3300009147 | Populus Rhizosphere | MLTSGGKIDADEVWRTKDGVWYRRNGIVTLLKRGQVKNIVTR* |
| Ga0105243_109450941 | 3300009148 | Miscanthus Rhizosphere | KIDADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0105243_131019732 | 3300009148 | Miscanthus Rhizosphere | EADEAWRTKDGVWYRRNGIVTLLKTGQVKAIVTK* |
| Ga0111538_113851911 | 3300009156 | Populus Rhizosphere | PVILLTSGGKIDADEVWRTRDGVWYRKNGIVTLLKPGRVKAIVSR* |
| Ga0075423_115762062 | 3300009162 | Populus Rhizosphere | MIKNGKPTILLTSGGKIDADEVWRTRDGVWYRRDGIVTLLKRGRVKAIVNQ* |
| Ga0075423_121673421 | 3300009162 | Populus Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVSR* |
| Ga0075423_122556882 | 3300009162 | Populus Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKTIVTR* |
| Ga0075423_123699322 | 3300009162 | Populus Rhizosphere | MLSSGGKIDADEVWRTKDGVWYRRNGIVTLLKRAQVKAIVTR* |
| Ga0105241_102899012 | 3300009174 | Corn Rhizosphere | MLASGGKIDADEVWRTKDGVWYRRNGIVTLLRRGQVKNIVTR* |
| Ga0105241_110767801 | 3300009174 | Corn Rhizosphere | DADEVWRTKDGVWYRRNGMVTLLKRGQVKTIITR* |
| Ga0105241_116614271 | 3300009174 | Corn Rhizosphere | GGQIEADEEWRTKDGVWYRRNGIVTLLKTGQVKAIVTK* |
| Ga0105241_124958561 | 3300009174 | Corn Rhizosphere | LLNGGSKLEADEVWRTRDGVWYRRDGIVTLLKRDRVKAIVNQ* |
| Ga0105242_103878051 | 3300009176 | Miscanthus Rhizosphere | IDADEVWRTKDGVWYRRNGIVTLLKRAQVKNIVTR* |
| Ga0105242_119890721 | 3300009176 | Miscanthus Rhizosphere | LTSGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNIATR* |
| Ga0105248_106829542 | 3300009177 | Switchgrass Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRNQVKTIVTR* |
| Ga0105237_121708881 | 3300009545 | Corn Rhizosphere | KLEADEVWKTKDGVWYRRDGVVTLLKKNRVKAVVNR* |
| Ga0105238_128902841 | 3300009551 | Corn Rhizosphere | MLASGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTISTR* |
| Ga0105249_100359776 | 3300009553 | Switchgrass Rhizosphere | MLASGGKIDADEVWRTKDGVWYRRNGIVTLLKRGQVKNIVTR* |
| Ga0105249_106470372 | 3300009553 | Switchgrass Rhizosphere | MGTRRGGNPVIVLTSGGKIEADEVWRTRDGYWYRKNGIVTLLKPGRVKAIVNK* |
| Ga0105249_112023883 | 3300009553 | Switchgrass Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRSQVKTITTR* |
| Ga0126307_101767162 | 3300009789 | Serpentine Soil | MLTSGGKIEADEVWRTKDGVWYRRNGMVSLLKRGQVKTIVTR* |
| Ga0126307_116880961 | 3300009789 | Serpentine Soil | MLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRNQVKAIVTK* |
| Ga0126313_107580311 | 3300009840 | Serpentine Soil | GGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIITR* |
| Ga0126313_117796651 | 3300009840 | Serpentine Soil | KPVIVLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKSISTATDKR* |
| Ga0126305_100353562 | 3300010036 | Serpentine Soil | MLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRSQVKAIVTK* |
| Ga0126305_101494283 | 3300010036 | Serpentine Soil | MATRQGGKPVITLTSGGKIEADEVWRTKDGVWYRRNGIITLLKRNQVKAIVTR* |
| Ga0126315_106811002 | 3300010038 | Serpentine Soil | MLTSGGKIDADEVWRTKDGIWYRRNGMVTLLKRNQVKAIVTK* |
| Ga0126308_101555081 | 3300010040 | Serpentine Soil | MLTSGGKIDADEVWRTRDGVWYRRNGMVTLLKRNQVKAIVTK* |
| Ga0126314_100408985 | 3300010042 | Serpentine Soil | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTH* |
| Ga0126314_112283182 | 3300010042 | Serpentine Soil | MLTSGGKIEADEVWRTRDGVWYRRNGMVTLLKRNQVKAIVTK* |
| Ga0126380_107560112 | 3300010043 | Tropical Forest Soil | MLASGGKIDADEVWRTKDGVWYRRNGIVTLLKARQVRTIVTK* |
| Ga0126310_100625901 | 3300010044 | Serpentine Soil | LTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRSQVKAIATR* |
| Ga0126311_101144952 | 3300010045 | Serpentine Soil | MLSSGGKIEADEVWRTKDGVWYRRNGMVSLLKRGQVKTIVTR* |
| Ga0126311_107411553 | 3300010045 | Serpentine Soil | MLTSGGKIEADEVWRTKDGVWYRRNGMVSLLKRGQ |
| Ga0126311_110904071 | 3300010045 | Serpentine Soil | RPVIVLTSGGKIDADEVWRTRDGVWYRRDGMVTLLKAGHVKAIVNR* |
| Ga0126311_113427231 | 3300010045 | Serpentine Soil | VILLTDGGKIEADEVWRTRDGIWYRRNGMVTLLKHGRVKSIVNR* |
| Ga0126311_118483652 | 3300010045 | Serpentine Soil | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKSIGTR* |
| Ga0126311_119181972 | 3300010045 | Serpentine Soil | LTDGGKIEADEVWRTRDGIWYRRNGIVSLLKHGRVKSIVNG* |
| Ga0126306_107438451 | 3300010166 | Serpentine Soil | QGGKPVIMLTSGGKIDADEAWRTKDGVWYRRNGMVTLLKRNQVRTIVRR* |
| Ga0126306_107935291 | 3300010166 | Serpentine Soil | MLTSGGKIDADEVWRTKDGVWYRRNGLVTLLKRGQVKAIVTR* |
| Ga0126306_114556771 | 3300010166 | Serpentine Soil | PVIMLTSGGKIDADEVWRTRDGIWYRRNGMVTLLKRGQVKTIVTR* |
| Ga0126376_100938022 | 3300010359 | Tropical Forest Soil | MLTSGGKIEADEVWQTKDGVWYRRNGLVTLLKRGQVKTIVTR* |
| Ga0126376_115272442 | 3300010359 | Tropical Forest Soil | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTISTR* |
| Ga0126376_126625041 | 3300010359 | Tropical Forest Soil | RAATAGKPMIIRLASGGKVEADEVWRTKEGVWYRRDGIVTLVKPNRVKAIVTQ* |
| Ga0134128_109588211 | 3300010373 | Terrestrial Soil | MLTSGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKN |
| Ga0134128_110688761 | 3300010373 | Terrestrial Soil | KPVIMLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNIATR* |
| Ga0105239_101484401 | 3300010375 | Corn Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIATR* |
| Ga0105239_116479062 | 3300010375 | Corn Rhizosphere | MLASGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0134124_100676485 | 3300010397 | Terrestrial Soil | MLATGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNISTR* |
| Ga0134124_107332661 | 3300010397 | Terrestrial Soil | GKIEADEAWRTKDGVWYRRNGMVTLLKTRQVKAIVTR* |
| Ga0134124_114703192 | 3300010397 | Terrestrial Soil | MLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNIVTR* |
| Ga0134127_100462062 | 3300010399 | Terrestrial Soil | LTSGGKIEADEVWRTRDGYWYRKNGIVTLLKPGRVKAIVNK* |
| Ga0134127_114038051 | 3300010399 | Terrestrial Soil | SGGKIEADEVWRTKDGVWYRRNGIVTLLRRGQVKNIVTR* |
| Ga0134127_118007262 | 3300010399 | Terrestrial Soil | LTSGGKIDADEVWRTRDGYWYRKNGIVTLLKPGRVKAIVNN* |
| Ga0134127_118056191 | 3300010399 | Terrestrial Soil | MGKKLGGKPVIVLTTGARIDADEVWRTRDGVWYRRNGIVTLLKHNRVKAISN* |
| Ga0134127_128023811 | 3300010399 | Terrestrial Soil | IEADEVWRTKDCVWYRRNGMVTLLKRGQVKTIVTR* |
| Ga0134122_133339422 | 3300010400 | Terrestrial Soil | VEADEVWRTKDGVWYRRDGVVTLLKKNRVKAIVSQ* |
| Ga0134121_110912462 | 3300010401 | Terrestrial Soil | GNRQGGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0134121_112081641 | 3300010401 | Terrestrial Soil | ARIEADAAWRTKDGVWYRRNGIVTLLKSNRVRAIVAQ* |
| Ga0134123_100944723 | 3300010403 | Terrestrial Soil | MLTSGGKIDADEVWRTRDGVWYRRNGMVTLLKRGQVKAIVTR* |
| Ga0134123_110331613 | 3300010403 | Terrestrial Soil | MLASGGKIEADEVWRTKDGVWYRRNGIVTLLKPGQVKNIATR* |
| Ga0134123_126381991 | 3300010403 | Terrestrial Soil | EADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVTR* |
| Ga0105246_111190651 | 3300011119 | Miscanthus Rhizosphere | RQGGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIATR* |
| Ga0105246_114293512 | 3300011119 | Miscanthus Rhizosphere | VLTSGGKIEADEVWRTKDGVWYRRSGIVTLLKRGQVKTITTR* |
| Ga0157306_102654382 | 3300012912 | Soil | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTILTR* |
| Ga0137394_110270881 | 3300012922 | Vadose Zone Soil | EVWRTKEGFWYRRNGIVTLIKANQVKAIEKTTSR* |
| Ga0164299_100907092 | 3300012958 | Soil | MIKNGKATILLTSGRKLSADEVWRTRDGVWYRRDGIVTLLKRGRVKAIVNQ* |
| Ga0164305_100888631 | 3300012989 | Soil | MLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNI |
| Ga0157373_110887072 | 3300013100 | Corn Rhizosphere | TSGGKIDADEVWRTRDGVWYRKNGIVTLLKPGRVKAIVSR* |
| Ga0157371_112397731 | 3300013102 | Corn Rhizosphere | GMGNRQGGKPVIMLASGGKIEADEVWRTKDGVWYRRNGMVTLLKRSQVKTITTR* |
| Ga0157374_102536633 | 3300013296 | Miscanthus Rhizosphere | GKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVTR* |
| Ga0157375_101902871 | 3300013308 | Miscanthus Rhizosphere | STPVILLTSGGKIDADEVWRTRDGVWYRKNGIVTLLKPGRVKAIVSR* |
| Ga0120195_10029451 | 3300013500 | Terrestrial | NRQGGKPIIMLTTGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKQIVTR* |
| Ga0163163_107107653 | 3300014325 | Switchgrass Rhizosphere | SGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVTR* |
| Ga0157380_107834371 | 3300014326 | Switchgrass Rhizosphere | QRQGGKPVIMLTSGGKIDADEVWRTRDGVWYRRNGMVTLLKRGQVKSIMTR* |
| Ga0157380_125952962 | 3300014326 | Switchgrass Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQV |
| Ga0157377_100621654 | 3300014745 | Miscanthus Rhizosphere | MLTSGGKIEAEEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR* |
| Ga0157377_108796462 | 3300014745 | Miscanthus Rhizosphere | MGNRQGAKPVILLTSGGKIEADEAWRTKDGVWYRRNGMVTLLKRGQVKAIVTR* |
| Ga0157377_116531802 | 3300014745 | Miscanthus Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVRTIATR* |
| Ga0157377_116615921 | 3300014745 | Miscanthus Rhizosphere | GGKIEADEVWRTRDGIWFRRNGVVTLLKNARVKSIAN* |
| Ga0157379_102917441 | 3300014968 | Switchgrass Rhizosphere | ILLTSGGKVEADEVWRTKDGIWYRRDGIVTLLNKARVKAIVRQ* |
| Ga0157379_114794061 | 3300014968 | Switchgrass Rhizosphere | IGTRQGGKPVIMLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNISTR* |
| Ga0132258_123071691 | 3300015371 | Arabidopsis Rhizosphere | SGGKIDADEVWRTRDGVWYRRAGIVTLLKPGRVKAIVNH* |
| Ga0132257_1001471683 | 3300015373 | Arabidopsis Rhizosphere | TTGGKIEADEVWRAKEGVWYRREGVVTLLKKERVRAIVGR* |
| Ga0132257_1016339801 | 3300015373 | Arabidopsis Rhizosphere | AKPVITLSSGGRIEADEVWRTKDGVWYRRNGIVTLVKRAQVKSISTR* |
| Ga0184624_100271901 | 3300018073 | Groundwater Sediment | TAAKKTGQVILLTSGGRVEADEVWKTKDGVWYRRDGLVTLLKKNRVKAIVSQ |
| Ga0190274_111316742 | 3300018476 | Soil | MLTSGGKIDADEVWRTKDGVWYRRNGIVTLLKRGQVKNIVTR |
| Ga0066669_107874402 | 3300018482 | Grasslands Soil | MGTRQGGKPVILLASGGKIEADEAWRTKDGVWYRRNGMVTLLKRAQVKTIVTR |
| Ga0182009_104145562 | 3300021445 | Soil | KPIIVLASGGKIEADEAWRTKDGVWYRRNGIVTLLKSGQVKAIVTK |
| Ga0207656_105451932 | 3300025321 | Corn Rhizosphere | MGTRQGGKPVIVLASGGKIEADEAWRTKDGVWYRRNGIVTLLKTGQVKTIITK |
| Ga0207713_12541682 | 3300025735 | Switchgrass Rhizosphere | PGIGTRQGGKPVIMLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKTIATR |
| Ga0207653_103182792 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNISTR |
| Ga0207642_103916762 | 3300025899 | Miscanthus Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR |
| Ga0207710_104601412 | 3300025900 | Switchgrass Rhizosphere | KPVIMLASGGKIEADEAWRTKDGVWYRRNGIVTLLKTNQVKAIVTNK |
| Ga0207647_101631763 | 3300025904 | Corn Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVTR |
| Ga0207645_106811982 | 3300025907 | Miscanthus Rhizosphere | MRTRQGGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQTIATR |
| Ga0207684_108360912 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGTRQGGKPVIVLVSGGKIEADEAWRTKDGVWYRRNGIVTLLKTGQVKAIVTR |
| Ga0207654_104918022 | 3300025911 | Corn Rhizosphere | MLASGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTISTR |
| Ga0207654_108254752 | 3300025911 | Corn Rhizosphere | RQGGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNIATR |
| Ga0207654_113625612 | 3300025911 | Corn Rhizosphere | MLASGGKIDADEVWRTKDGVWYRRNGIVTLLRRGQVKNIVTR |
| Ga0207695_104013762 | 3300025913 | Corn Rhizosphere | MLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRSQVKTITTR |
| Ga0207695_108211231 | 3300025913 | Corn Rhizosphere | MGNRQGGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR |
| Ga0207662_102036482 | 3300025918 | Switchgrass Rhizosphere | MLASGGKIEADEVWRTKDGVWYRRNGSVTLLKRGQVKNIVTR |
| Ga0207662_103988763 | 3300025918 | Switchgrass Rhizosphere | MGNRQGGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVTR |
| Ga0207649_109358392 | 3300025920 | Corn Rhizosphere | MLASGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR |
| Ga0207646_100495641 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PVILLASGGKIDADEVWRTKDGVWYRRNGIVTLLKRGQVKNIVTR |
| Ga0207650_116952022 | 3300025925 | Switchgrass Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRSQVKTIVTR |
| Ga0207690_108464261 | 3300025932 | Corn Rhizosphere | GKIDADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVTR |
| Ga0207706_104715113 | 3300025933 | Corn Rhizosphere | PVIMLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR |
| Ga0207691_108381771 | 3300025940 | Miscanthus Rhizosphere | MGNRQGGKPVIMLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR |
| Ga0207711_111768371 | 3300025941 | Switchgrass Rhizosphere | GGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIATR |
| Ga0207711_115511992 | 3300025941 | Switchgrass Rhizosphere | IEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR |
| Ga0207711_121153241 | 3300025941 | Switchgrass Rhizosphere | IVLVSGAKIEADEAWRTKDGVWYRRNGMVTLLKGAQVKAIITR |
| Ga0207689_101346011 | 3300025942 | Miscanthus Rhizosphere | IEADEVWRTKDGVWYRRSGIVTLLKRGQVKTISTR |
| Ga0207679_111187062 | 3300025945 | Corn Rhizosphere | KPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIATR |
| Ga0207651_113558201 | 3300025960 | Switchgrass Rhizosphere | GTRQGGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIATR |
| Ga0207712_115803362 | 3300025961 | Switchgrass Rhizosphere | MGTRRGGNPVIVLTSGGKIEADEVWRTRDGYWYRKNGIVTLLKPGRVKAIVNK |
| Ga0207640_103422531 | 3300025981 | Corn Rhizosphere | MLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRSQVKTITTR |
| Ga0208141_10250302 | 3300025988 | Rice Paddy Soil | MLTSGGKIEADEVWRTKDGVWYRRNGLVTLLKRGQVKTIVTR |
| Ga0207677_101844722 | 3300026023 | Miscanthus Rhizosphere | GKSILLTSGGKVEADEVWRTKDGIWYRRDGIVTLLNKARVKAIVRQ |
| Ga0207703_102804561 | 3300026035 | Switchgrass Rhizosphere | PGMGNRQGGKPVIMLTSGGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR |
| Ga0207703_103166291 | 3300026035 | Switchgrass Rhizosphere | SGGKIEADEVWRTKDGVWYRRSGIVTLLKRGQVKTISTR |
| Ga0207703_104143282 | 3300026035 | Switchgrass Rhizosphere | LTTGGRLEADQVWRTKDGVWYRRDGVVTLLKNNRVKAIVNQ |
| Ga0207678_107277942 | 3300026067 | Corn Rhizosphere | MLASGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVTR |
| Ga0207708_111491112 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | IMLTTGVKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNIATR |
| Ga0208291_10291191 | 3300026111 | Natural And Restored Wetlands | ARIEADEVWRTRDGVWYRRSGMVTLLKRNQIKAVITK |
| Ga0207674_112048392 | 3300026116 | Corn Rhizosphere | MGTRQGSKPVIVLVSGGKIEADEAWRTKDGVWYRRNGIVTLLKTSQVKAIIAK |
| Ga0207675_1008871092 | 3300026118 | Switchgrass Rhizosphere | MLTSGGKIDADEVWRTRDGVWYRRNGIVTLLKHNRVKAIVNQ |
| Ga0207698_123157091 | 3300026142 | Corn Rhizosphere | SGGKIEADEVWRTKDGVWYRRNGMVTLLKRGQVKTIVTR |
| Ga0209485_10000161 | 3300027691 | Agricultural Soil | GIGTRRGSQPTILLTSGAKIDAEEVWRTRDGVWYRKNGIVTLLKSNRVKAIVSR |
| Ga0268264_125649062 | 3300028381 | Switchgrass Rhizosphere | GGKIEADEVWRTKDGVWYRRNGMVTLLKRAQVKTIVTR |
| Ga0268241_101150572 | 3300030511 | Soil | LGGKPTILLSSGGKIDADEVWHTRDGVWYRRDGIVTLLKRGRVKAIVNQ |
| Ga0307408_1005345762 | 3300031548 | Rhizosphere | MLTSGGRIDADEVWRTRDGVWYRRNGMVTLLKRGQVKAIVTR |
| Ga0307408_1008656832 | 3300031548 | Rhizosphere | ILLTTGGRIEADEVWRTRDGIWYRRAGIVTLLKRNTVKAIVER |
| Ga0307408_1017697112 | 3300031548 | Rhizosphere | MLTSGGKIDADEVWRTKDGVWYRRNGMVTLLKRGQVRTIVTR |
| Ga0310813_104337553 | 3300031716 | Soil | IMLASGGKIEADEVWRTKDGVWYRRNGIVTLLKRGQVKNIVTR |
| Ga0310813_111847142 | 3300031716 | Soil | MGTRQGGKPVIVLASGGKIEADEAWRTKDGVWYRRNGIVTLLKSGQVKAIVTK |
| Ga0310813_112684481 | 3300031716 | Soil | PGMGNRQGGKSVIVLVSGGKIEADEAWRTKDGVWYRRNGMVTLLKTRQVKAIVTR |
| Ga0307410_105846802 | 3300031852 | Rhizosphere | MGTRQGAKPVIVLVSGGKIEADEAWRTKDGVWYRRNGMVTLLKGAQVKAIITR |
| Ga0307410_111361821 | 3300031852 | Rhizosphere | LTTGGRIDADEVWRTRDGIWYRRAGIVTLLKRNKVKTIIER |
| Ga0310892_107321162 | 3300031858 | Soil | IDADEVWRTRDGVWYRKNGIVTLLKPGRVKAIVSR |
| Ga0310900_100150121 | 3300031908 | Soil | VILLTSGGKIDADEVWRTRDGVWYRKNGIVTLLKPGRVKAIVSR |
| Ga0310890_118401871 | 3300032075 | Soil | SGGKIDADEVWRTRDGVWYRKNGIVTLLKPGRVKAIVSR |
| Ga0315912_111351242 | 3300032157 | Soil | SGGKIEADEVWRTKDGVWYRRNGMVTLLKRVQVKTIVTR |
| Ga0307471_1012704911 | 3300032180 | Hardwood Forest Soil | TTESKRAESGDKPVIIRLASGGKVEADEVWRTKEGVWYRRDGVVTLLKSNRVKAIVNQ |
| Ga0307472_1015724582 | 3300032205 | Hardwood Forest Soil | ASGGKVEADEVWRTKEGVWYRRDGVVTLLKSNRVKAIVNQ |
| Ga0310810_105227203 | 3300033412 | Soil | KPVILLTSGGKIDADEVWRTRDGVWYRRDGIVTLLKRGRVKAIVNQ |
| ⦗Top⦘ |