| Basic Information | |
|---|---|
| Family ID | F018028 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 237 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTNQNPHAFRIRPGMRRGLRSEIPLPTRLVSNEEFPPLPQTAAQR |
| Number of Associated Samples | 203 |
| Number of Associated Scaffolds | 237 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.89 % |
| % of genes near scaffold ends (potentially truncated) | 98.31 % |
| % of genes from short scaffolds (< 2000 bps) | 91.56 % |
| Associated GOLD sequencing projects | 189 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.561 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.283 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.848 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.865 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.22% β-sheet: 0.00% Coil/Unstructured: 91.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 237 Family Scaffolds |
|---|---|---|
| PF00575 | S1 | 13.50 |
| PF07690 | MFS_1 | 12.66 |
| PF00106 | adh_short | 5.49 |
| PF12867 | DinB_2 | 5.06 |
| PF02668 | TauD | 3.38 |
| PF00561 | Abhydrolase_1 | 2.95 |
| PF05977 | MFS_3 | 2.11 |
| PF02518 | HATPase_c | 2.11 |
| PF03061 | 4HBT | 1.69 |
| PF02746 | MR_MLE_N | 1.69 |
| PF00206 | Lyase_1 | 1.27 |
| PF07883 | Cupin_2 | 1.27 |
| PF13365 | Trypsin_2 | 0.84 |
| PF03591 | AzlC | 0.84 |
| PF01568 | Molydop_binding | 0.84 |
| PF12697 | Abhydrolase_6 | 0.84 |
| PF01208 | URO-D | 0.84 |
| PF00296 | Bac_luciferase | 0.84 |
| PF00563 | EAL | 0.84 |
| PF05153 | MIOX | 0.84 |
| PF01909 | NTP_transf_2 | 0.84 |
| PF01717 | Meth_synt_2 | 0.84 |
| PF00107 | ADH_zinc_N | 0.84 |
| PF00072 | Response_reg | 0.84 |
| PF00248 | Aldo_ket_red | 0.84 |
| PF04072 | LCM | 0.42 |
| PF07394 | DUF1501 | 0.42 |
| PF00005 | ABC_tran | 0.42 |
| PF04909 | Amidohydro_2 | 0.42 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.42 |
| PF13622 | 4HBT_3 | 0.42 |
| PF07726 | AAA_3 | 0.42 |
| PF00483 | NTP_transferase | 0.42 |
| PF03928 | HbpS-like | 0.42 |
| PF13378 | MR_MLE_C | 0.42 |
| PF00326 | Peptidase_S9 | 0.42 |
| PF13714 | PEP_mutase | 0.42 |
| PF01435 | Peptidase_M48 | 0.42 |
| PF02720 | DUF222 | 0.42 |
| PF13586 | DDE_Tnp_1_2 | 0.42 |
| PF01243 | Putative_PNPOx | 0.42 |
| PF03483 | B3_4 | 0.42 |
| PF12399 | BCA_ABC_TP_C | 0.42 |
| PF13462 | Thioredoxin_4 | 0.42 |
| PF13561 | adh_short_C2 | 0.42 |
| PF04392 | ABC_sub_bind | 0.42 |
| PF13458 | Peripla_BP_6 | 0.42 |
| PF00343 | Phosphorylase | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 237 Family Scaffolds |
|---|---|---|---|
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.38 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 3.38 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 2.11 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.84 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.84 |
| COG1296 | Predicted branched-chain amino acid permease (azaleucine resistance) | Amino acid transport and metabolism [E] | 0.84 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.84 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.84 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.84 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.84 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.84 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.42 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.42 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.41 % |
| Unclassified | root | N/A | 7.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100173558 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101355316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 568 | Open in IMG/M |
| 3300000550|F24TB_10015455 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
| 3300000953|JGI11615J12901_10882363 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300000955|JGI1027J12803_106019224 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300000956|JGI10216J12902_121942412 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108729171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3152 | Open in IMG/M |
| 3300002120|C687J26616_10188949 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300002886|JGI25612J43240_1043164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300004463|Ga0063356_103809585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300004480|Ga0062592_100573001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 952 | Open in IMG/M |
| 3300004643|Ga0062591_102950878 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300004782|Ga0062382_10643019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300005093|Ga0062594_101095367 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300005174|Ga0066680_10398635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300005186|Ga0066676_10846711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300005294|Ga0065705_10616002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300005332|Ga0066388_107821463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 535 | Open in IMG/M |
| 3300005336|Ga0070680_100220762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1600 | Open in IMG/M |
| 3300005340|Ga0070689_100373898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1200 | Open in IMG/M |
| 3300005345|Ga0070692_10194530 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300005354|Ga0070675_100798414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 863 | Open in IMG/M |
| 3300005363|Ga0008090_15237024 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300005365|Ga0070688_101753216 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005366|Ga0070659_100925552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 763 | Open in IMG/M |
| 3300005446|Ga0066686_10404328 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300005451|Ga0066681_10303357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300005459|Ga0068867_100583417 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300005471|Ga0070698_101653418 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005518|Ga0070699_101159030 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005546|Ga0070696_101432373 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005547|Ga0070693_100129087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1578 | Open in IMG/M |
| 3300005549|Ga0070704_100619253 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300005554|Ga0066661_10380100 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005558|Ga0066698_10079998 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
| 3300005560|Ga0066670_10625143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300005561|Ga0066699_10238295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1280 | Open in IMG/M |
| 3300005564|Ga0070664_100922259 | Not Available | 819 | Open in IMG/M |
| 3300005568|Ga0066703_10171693 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300005569|Ga0066705_10143538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1461 | Open in IMG/M |
| 3300005586|Ga0066691_10615927 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005615|Ga0070702_100468224 | Not Available | 918 | Open in IMG/M |
| 3300005617|Ga0068859_101786802 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005713|Ga0066905_100762175 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300005764|Ga0066903_100801145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1685 | Open in IMG/M |
| 3300005764|Ga0066903_104120614 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300005840|Ga0068870_10192824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1231 | Open in IMG/M |
| 3300005843|Ga0068860_102513226 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005844|Ga0068862_101483293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 683 | Open in IMG/M |
| 3300005875|Ga0075293_1000071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3989 | Open in IMG/M |
| 3300006031|Ga0066651_10702034 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006058|Ga0075432_10409812 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300006059|Ga0075017_100158372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1617 | Open in IMG/M |
| 3300006194|Ga0075427_10089228 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006196|Ga0075422_10022288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2162 | Open in IMG/M |
| 3300006800|Ga0066660_11122852 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300006844|Ga0075428_101177134 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300006844|Ga0075428_101243111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 784 | Open in IMG/M |
| 3300006846|Ga0075430_100308946 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300006847|Ga0075431_102118336 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300006847|Ga0075431_102243988 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300006852|Ga0075433_10454338 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300006871|Ga0075434_102646007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 502 | Open in IMG/M |
| 3300006880|Ga0075429_100411450 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300006954|Ga0079219_10378950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 925 | Open in IMG/M |
| 3300007255|Ga0099791_10119879 | Not Available | 1219 | Open in IMG/M |
| 3300009094|Ga0111539_11096484 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300009137|Ga0066709_102354939 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 727 | Open in IMG/M |
| 3300009156|Ga0111538_12433428 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300009162|Ga0075423_12702431 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009166|Ga0105100_10002194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 11418 | Open in IMG/M |
| 3300009174|Ga0105241_11342172 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300009176|Ga0105242_10601740 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300009176|Ga0105242_10758509 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300009545|Ga0105237_10607347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium JOSHI_001 | 1101 | Open in IMG/M |
| 3300009553|Ga0105249_10970527 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300009553|Ga0105249_12200179 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009553|Ga0105249_13283131 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009803|Ga0105065_1053110 | All Organisms → cellular organisms → Archaea | 582 | Open in IMG/M |
| 3300009808|Ga0105071_1108325 | Not Available | 511 | Open in IMG/M |
| 3300009815|Ga0105070_1090582 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300010043|Ga0126380_11845720 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300010043|Ga0126380_12283134 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010046|Ga0126384_10369994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → unclassified Roseomonas → Roseomonas sp. OT10 | 1201 | Open in IMG/M |
| 3300010046|Ga0126384_11653090 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300010047|Ga0126382_10411079 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300010047|Ga0126382_10602068 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300010047|Ga0126382_11445457 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300010048|Ga0126373_10748491 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300010048|Ga0126373_13083971 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010322|Ga0134084_10454606 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010326|Ga0134065_10403436 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300010336|Ga0134071_10649281 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010358|Ga0126370_10721295 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300010359|Ga0126376_10140481 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
| 3300010359|Ga0126376_11501291 | Not Available | 703 | Open in IMG/M |
| 3300010360|Ga0126372_11541449 | All Organisms → cellular organisms → Archaea | 702 | Open in IMG/M |
| 3300010362|Ga0126377_10120314 | All Organisms → cellular organisms → Bacteria | 2425 | Open in IMG/M |
| 3300010362|Ga0126377_10670273 | Not Available | 1088 | Open in IMG/M |
| 3300010362|Ga0126377_12959150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 548 | Open in IMG/M |
| 3300010366|Ga0126379_10620515 | Not Available | 1169 | Open in IMG/M |
| 3300010366|Ga0126379_12909401 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010398|Ga0126383_10901130 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 971 | Open in IMG/M |
| 3300010399|Ga0134127_12401911 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300010401|Ga0134121_11447170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 700 | Open in IMG/M |
| 3300011414|Ga0137442_1119746 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
| 3300011427|Ga0137448_1183128 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300012040|Ga0137461_1161084 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300012046|Ga0136634_10274058 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012189|Ga0137388_10311038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1446 | Open in IMG/M |
| 3300012189|Ga0137388_10610300 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1014 | Open in IMG/M |
| 3300012201|Ga0137365_10288952 | Not Available | 1216 | Open in IMG/M |
| 3300012358|Ga0137368_10383172 | Not Available | 927 | Open in IMG/M |
| 3300012362|Ga0137361_11507298 | Not Available | 594 | Open in IMG/M |
| 3300012918|Ga0137396_10046893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2947 | Open in IMG/M |
| 3300012918|Ga0137396_10995324 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012922|Ga0137394_10955320 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300012927|Ga0137416_10188842 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300012927|Ga0137416_11116795 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300012929|Ga0137404_10461200 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300012929|Ga0137404_10844817 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300012948|Ga0126375_10187402 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300012948|Ga0126375_11869119 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012971|Ga0126369_10590237 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300013102|Ga0157371_10202816 | Not Available | 1422 | Open in IMG/M |
| 3300013296|Ga0157374_10435561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1311 | Open in IMG/M |
| 3300013296|Ga0157374_10912256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium JOSHI_001 | 896 | Open in IMG/M |
| 3300013297|Ga0157378_11181592 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300014154|Ga0134075_10350803 | Not Available | 647 | Open in IMG/M |
| 3300014262|Ga0075301_1139570 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300014299|Ga0075303_1079943 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300014884|Ga0180104_1111230 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300014885|Ga0180063_1180203 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300014969|Ga0157376_12732504 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300015241|Ga0137418_10009764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8819 | Open in IMG/M |
| 3300015264|Ga0137403_10296547 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300015264|Ga0137403_10570191 | Not Available | 999 | Open in IMG/M |
| 3300015358|Ga0134089_10365189 | Not Available | 611 | Open in IMG/M |
| 3300015371|Ga0132258_10428350 | All Organisms → cellular organisms → Bacteria | 3294 | Open in IMG/M |
| 3300015371|Ga0132258_12822192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium JOSHI_001 | 1209 | Open in IMG/M |
| 3300015372|Ga0132256_100742066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
| 3300015372|Ga0132256_101156576 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300015373|Ga0132257_100110139 | All Organisms → cellular organisms → Bacteria | 3183 | Open in IMG/M |
| 3300015373|Ga0132257_101295252 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300016319|Ga0182033_11349561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 641 | Open in IMG/M |
| 3300017656|Ga0134112_10195515 | Not Available | 789 | Open in IMG/M |
| 3300017792|Ga0163161_11093789 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300017959|Ga0187779_11002703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 579 | Open in IMG/M |
| 3300017997|Ga0184610_1291926 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300018000|Ga0184604_10004885 | All Organisms → cellular organisms → Bacteria | 2433 | Open in IMG/M |
| 3300018031|Ga0184634_10272808 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300018056|Ga0184623_10188448 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300018060|Ga0187765_10302548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia tropica | 959 | Open in IMG/M |
| 3300018063|Ga0184637_10053277 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
| 3300018077|Ga0184633_10225925 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300018079|Ga0184627_10432109 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300019360|Ga0187894_10123916 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300019360|Ga0187894_10513446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 518 | Open in IMG/M |
| 3300019377|Ga0190264_10701313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 748 | Open in IMG/M |
| 3300020067|Ga0180109_1244907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1146 | Open in IMG/M |
| 3300021479|Ga0210410_10822092 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300025165|Ga0209108_10097986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1583 | Open in IMG/M |
| 3300025318|Ga0209519_10459174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 720 | Open in IMG/M |
| 3300025906|Ga0207699_10684239 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300025911|Ga0207654_10768002 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 695 | Open in IMG/M |
| 3300025918|Ga0207662_10325880 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300025922|Ga0207646_11762218 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300025935|Ga0207709_10583196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 883 | Open in IMG/M |
| 3300025938|Ga0207704_11368916 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 606 | Open in IMG/M |
| 3300025961|Ga0207712_10247473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1439 | Open in IMG/M |
| 3300026067|Ga0207678_10849288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 807 | Open in IMG/M |
| 3300026089|Ga0207648_11753424 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 582 | Open in IMG/M |
| 3300026095|Ga0207676_10143269 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
| 3300026111|Ga0208291_1026304 | Not Available | 1068 | Open in IMG/M |
| 3300026295|Ga0209234_1186995 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300026333|Ga0209158_1024386 | All Organisms → cellular organisms → Bacteria | 2686 | Open in IMG/M |
| 3300026335|Ga0209804_1138884 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300026514|Ga0257168_1096607 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 657 | Open in IMG/M |
| 3300026537|Ga0209157_1139945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1100 | Open in IMG/M |
| 3300026944|Ga0207570_1000120 | Not Available | 3251 | Open in IMG/M |
| 3300027032|Ga0209877_1016794 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300027273|Ga0209886_1041085 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 717 | Open in IMG/M |
| 3300027654|Ga0209799_1060530 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300027655|Ga0209388_1183767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 583 | Open in IMG/M |
| 3300027663|Ga0208990_1153770 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 607 | Open in IMG/M |
| 3300027682|Ga0209971_1171779 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300027874|Ga0209465_10049853 | All Organisms → cellular organisms → Bacteria | 2001 | Open in IMG/M |
| 3300027900|Ga0209253_11148331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 525 | Open in IMG/M |
| 3300027907|Ga0207428_10521987 | Not Available | 861 | Open in IMG/M |
| 3300027910|Ga0209583_10134087 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10011398 | All Organisms → cellular organisms → Bacteria | 3304 | Open in IMG/M |
| 3300028047|Ga0209526_10761455 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 604 | Open in IMG/M |
| 3300028072|Ga0247675_1067367 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300028381|Ga0268264_11394240 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300028381|Ga0268264_11579662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 667 | Open in IMG/M |
| 3300028596|Ga0247821_10141138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1389 | Open in IMG/M |
| 3300028889|Ga0247827_11051336 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
| 3300030620|Ga0302046_10590547 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300031184|Ga0307499_10224606 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031538|Ga0310888_10345539 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300031543|Ga0318516_10660454 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031549|Ga0318571_10384427 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031723|Ga0318493_10263019 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300031740|Ga0307468_100090790 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300031740|Ga0307468_100602537 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300031740|Ga0307468_100713215 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 841 | Open in IMG/M |
| 3300031740|Ga0307468_101380948 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300031748|Ga0318492_10142409 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300031782|Ga0318552_10024377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2719 | Open in IMG/M |
| 3300031795|Ga0318557_10407390 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031796|Ga0318576_10069516 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300031797|Ga0318550_10583344 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031835|Ga0318517_10450240 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031854|Ga0310904_11315725 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031893|Ga0318536_10381827 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300031896|Ga0318551_10186549 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300031943|Ga0310885_10668958 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300031945|Ga0310913_10346579 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300031962|Ga0307479_10861658 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300031965|Ga0326597_10800063 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300031965|Ga0326597_11744931 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300032013|Ga0310906_10069007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1826 | Open in IMG/M |
| 3300032025|Ga0318507_10232129 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300032054|Ga0318570_10192438 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300032055|Ga0318575_10665658 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300032059|Ga0318533_11199566 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300032144|Ga0315910_10639747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 825 | Open in IMG/M |
| 3300032174|Ga0307470_11602395 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300032205|Ga0307472_100021684 | All Organisms → cellular organisms → Bacteria | 3535 | Open in IMG/M |
| 3300032205|Ga0307472_101103480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300032955|Ga0335076_10979235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 728 | Open in IMG/M |
| 3300033432|Ga0326729_1019976 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300033433|Ga0326726_12023851 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300034090|Ga0326723_0241496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 804 | Open in IMG/M |
| 3300034090|Ga0326723_0537522 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300034177|Ga0364932_0326354 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300034820|Ga0373959_0200047 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.02% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.38% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.53% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.11% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.69% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.27% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.27% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.84% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.42% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.42% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.42% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.42% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.42% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.42% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.42% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.42% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026111 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026944 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1001735581 | 3300000364 | Soil | MTTGNRYAFRRLPGMRQGLSSETPLPTRLVSNEEFP |
| INPhiseqgaiiFebDRAFT_1013553161 | 3300000364 | Soil | MIVQNRYAFRIRPQMRRGLCTEVPLPTRLVSNEEFPPH |
| F24TB_100154554 | 3300000550 | Soil | MATGNRYAFRVCPGMRQGLATETPIPTRLVSNEEFP |
| JGI11615J12901_108823632 | 3300000953 | Soil | MPKNREDPTGNPFAFRVRPGMRQGLSTEAPLPTRLVSNEEFPPLPQTPEQAQV |
| JGI1027J12803_1060192242 | 3300000955 | Soil | MATGNRYGFQVRPGMRQGLRGAVPLPTRLVSNEEFPPIPQTLAQRRVES |
| JGI10216J12902_1219424121 | 3300000956 | Soil | MTVPNRHAFRIRPNMRRGLCTEVPLPTRLVSNEEFPPHPQTAAQQ |
| JGIcombinedJ13530_1087291715 | 3300001213 | Wetland | MKLNPLAFRVGPGMRRGHQSEVPIPTRLVSNEEFQPLPQTAAQREVEQRI |
| C687J26616_101889491 | 3300002120 | Soil | MTNRNPHAFRVGPGMRRGLRSEIPLPTRLVSNEEFPP |
| JGI25612J43240_10431641 | 3300002886 | Grasslands Soil | MTASNRYGFQVRPGMRQGLRGAVPLPTRLVSNEEFPPIPQTP |
| Ga0063356_1038095851 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTIPNRHAFRIHPRMRRGLCTEVPLPTRLVSNEEFPPQPQTAAQRAVEERILAEAG |
| Ga0062592_1005730011 | 3300004480 | Soil | MKLNRHAFRVKPGMSQGMQSEVPLPTQLVSNEEFPPLPQTLAQREVEQRI |
| Ga0062591_1029508781 | 3300004643 | Soil | MPVDNRHAFRIRPGMRRGFRSEVPLPTRLVSNEEFPPLPQTA |
| Ga0062382_106430191 | 3300004782 | Wetland Sediment | MKSNRYRFQVRSGMRQGYQAETPIPTRLVSNEEFQPIPQTREQREVE |
| Ga0062594_1010953671 | 3300005093 | Soil | MTTSNPLEFRPHPGLRRGYSSEVPLPTRLVSNEEFTPLPQTAAQRRVEARILAEAG |
| Ga0066680_103986351 | 3300005174 | Soil | MTAGNRHAFELRAGMRRGITSAVPLPMRLVSNEEFPPIPQTAAQRRVEQRIL |
| Ga0066676_108467111 | 3300005186 | Soil | MTAQNHYGFRVGPGMRRGLRSAVPIPTRLVSNEEFPPIPQTAEQR |
| Ga0065705_106160022 | 3300005294 | Switchgrass Rhizosphere | MTTQNPHAFRPLRGMCRGLRTEVPLPTRLVSNEEFPPLPQTPAQRHVEERILADAGR |
| Ga0066388_1078214631 | 3300005332 | Tropical Forest Soil | MTVQNLHAFRLRPGMRRGLCTAVPLPTRLVSNEEFPPLPQTAAQRQVE |
| Ga0070680_1002207621 | 3300005336 | Corn Rhizosphere | MPVDNRHAFRIRPGMRRGFRSEVPLPTRLVSNEEFPPLPQTAAQRA |
| Ga0070689_1003738982 | 3300005340 | Switchgrass Rhizosphere | MKLNRRAFRVKPGMSQGMQSEVPLPTQLVSNEEFPPLPQTLAQREVEQR |
| Ga0070692_101945301 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MPADNRHAFRIRPGMRRGFRSEVPLPTRLVSNEEFPPLPQT |
| Ga0070675_1007984141 | 3300005354 | Miscanthus Rhizosphere | MKLNRRAFRVRPGMRKGLQSEVPVPTQLVSNEEFQPLPQTAAQREVEQRILAAAG |
| Ga0008090_152370241 | 3300005363 | Tropical Rainforest Soil | MTSQNRYRFRVGPGMRRGLSGLVPLPTRLISNEEFPPIPQTPEQRQVERR |
| Ga0070688_1017532161 | 3300005365 | Switchgrass Rhizosphere | MKLNRRAFRVRPGMRKGLQSEVPVPTQLVSNEEFQPLPQTA |
| Ga0070659_1009255521 | 3300005366 | Corn Rhizosphere | MKINRNPFRVLPGMRRGLTSEVPLPTRLVSNEEFPPMPQT |
| Ga0066686_104043282 | 3300005446 | Soil | MTDTNPHAFHLRPGMRRGYRSEIPLPTRLVSNEEFPPLPQTAAQRAVEERILAE |
| Ga0066681_103033572 | 3300005451 | Soil | MTAQNHYGFRVGPGMRRGLRSAVPIPTRLVSNEEFPPIPQTAEQRRVEDRILA |
| Ga0068867_1005834171 | 3300005459 | Miscanthus Rhizosphere | MTPRNPYAFHVRPDMRQGLASELPLPTRLVSNEEFPPLPQ |
| Ga0070698_1016534181 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTPNPLEFRPHPGLRRGYSSEVPLPTRLVSNEEFTPLPQTAAQRRVEARILAEAG |
| Ga0070699_1011590302 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNSNRHSFRFGPGMRRGLCTEIPLPMRLVSNEEFPPLPQTAAQREVEQRILADAARVAPKL |
| Ga0070696_1014323732 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVDNRHAFRIRPGMLRGFRSEVPLPTRLVSNEEFPPLPQTA |
| Ga0070693_1001290872 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEWQMKLNRRAFRVKPGMSQGMQSEVPLPTQLVSNEEFPPLP |
| Ga0070704_1006192531 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPRNPYAFHVRPDMRQGLASELPLPTRLVSNEEFPPLPQTATQRR |
| Ga0066661_103801001 | 3300005554 | Soil | MTDGNRHAFELRPGMRRGITSAVPLPMRLVSNEEFPPIPQ |
| Ga0066698_100799981 | 3300005558 | Soil | MTVEDPQSFHIRPGMRRGLRTEVPLPTRLVSNEEFPP |
| Ga0066670_106251431 | 3300005560 | Soil | MTAQNHYGFRVGPGMRRGLRSAVPIPTRLVSNEEFPPIPQTAEQRRVEDRILAEA |
| Ga0066699_102382952 | 3300005561 | Soil | MTHENSRAFRIRPDMHRGLRSEVPLPTRLVSNEEFPP |
| Ga0070664_1009222591 | 3300005564 | Corn Rhizosphere | MTVPNRHAFHIRPQMRRGLCTEVPLPTRLVSNEEFPPHP |
| Ga0066703_101716931 | 3300005568 | Soil | MTAQNRHAFQLRPGMRRGLRTLAPLPTRLVSNEEFP |
| Ga0066705_101435381 | 3300005569 | Soil | MTHENSRAFRIRPDMRRGLRTEVPLPTRLVSNEEFPPLPQTAAQRAVE |
| Ga0066691_106159271 | 3300005586 | Soil | MTVENPQSFHIRPGMRRGLRTEVPLPTRLVSNEEFPPLPQTAAQRRVEDRILAEAGRLA |
| Ga0070702_1004682241 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVPNRHAFHIRPQMRRGLCTEVPLPTRLVSNEEFPPHPQTAAQQQVEHRILTEAGRL |
| Ga0068859_1017868022 | 3300005617 | Switchgrass Rhizosphere | MTDGNPHAFRLRPGMRRGYRSEIPLPTRLVSNEEFPSLPQTAAQ |
| Ga0066905_1007621751 | 3300005713 | Tropical Forest Soil | MTTRNPHAFRHRPGMRRGLSTELPLPTRLVSNEEFP |
| Ga0066903_1008011451 | 3300005764 | Tropical Forest Soil | MTMQNRYSFRIRPSMRRGLCTEVPLPTRLVSNEEFP |
| Ga0066903_1041206141 | 3300005764 | Tropical Forest Soil | MATENRYGFQVRPGMRQGLRSAVPLPTRLVSNEEFPPIPQ |
| Ga0068870_101928242 | 3300005840 | Miscanthus Rhizosphere | MKLNRRAFRVKPGMSQGMQSEVPLPTQLVSNEEFPPLPQTLAQREV |
| Ga0068860_1025132261 | 3300005843 | Switchgrass Rhizosphere | MPADNRHAFRIHPGMRRGFRSEVPLPTRLVSNEEFPP |
| Ga0068862_1014832932 | 3300005844 | Switchgrass Rhizosphere | VRSQPEHGFQVDAGMRQGLRSEIPLPTRLVSNEEFAPLPQTA |
| Ga0075293_10000716 | 3300005875 | Rice Paddy Soil | MTTGNRYAFRLLPGMRRGLRAETPLPTRLVSNEEFP |
| Ga0066651_107020341 | 3300006031 | Soil | MTNGNRHAFRLRPGMHRGLRTEIPLPTRLVSNEEFPP |
| Ga0075432_104098121 | 3300006058 | Populus Rhizosphere | MMPGNPHEFRVRPDMRRGLSTATPIPTRLVSNEEFPP |
| Ga0075017_1001583724 | 3300006059 | Watersheds | MKLNRRAFRIRPGMSQGLQTEVPLPTQLVSNEEFPPLPQTAAQR |
| Ga0075427_100892282 | 3300006194 | Populus Rhizosphere | MTVPNRHAFRIRPQMRRGLCTEVPLPTRLVSNEEFPPHPQTAAQQEVEQRILT |
| Ga0075422_100222881 | 3300006196 | Populus Rhizosphere | MTVQNYHAFRLRPGMRQGLRTEVPLPTRLISNEEFPPLPQTAAQREVEERILT |
| Ga0066660_111228521 | 3300006800 | Soil | MTNENSRAFRIGPDMRRGLRTEVPLPTRLVSNEEFPP |
| Ga0075428_1011771342 | 3300006844 | Populus Rhizosphere | MMPGNPHEFQVRSGMRRGLSTATPIPTLLVSNEEFPPMPQT |
| Ga0075428_1012431111 | 3300006844 | Populus Rhizosphere | MKLNRRAFRVRPGMRKGLQSEVPVPTQLVSNEEFQPLPQTAAQREVEQRILAAA |
| Ga0075430_1003089463 | 3300006846 | Populus Rhizosphere | MTVQNHYAFRLRPGMRQGLRTEVPLPTRLVSNEEFPPLPQTAAQREVEERIRT |
| Ga0075431_1021183362 | 3300006847 | Populus Rhizosphere | MTTGNPYAFHVRPDMRRGLSSELPLPTRLVSNEEFPPLP |
| Ga0075431_1022439882 | 3300006847 | Populus Rhizosphere | MTPGNRHAFRLRPGMSMGLSTELPLPTRLVSNEEFPPLPQTTAQQVVEHRIFADAARLA |
| Ga0075433_104543381 | 3300006852 | Populus Rhizosphere | MTAHNPHAFRLHGGLRRDLVTEVPLPTRLVSNEEFPPLAQTPAQQEVEARILA |
| Ga0075434_1026460071 | 3300006871 | Populus Rhizosphere | MKLNRHAFRVLPGMRQGLKSEIPLPMRLVSNEEFPPL |
| Ga0075429_1004114501 | 3300006880 | Populus Rhizosphere | MHNRYAFRIRPRMRRGLRTEVPLPTRLVSNEEFPPQPQTAAQREVEHRILAAAGRL |
| Ga0079219_103789501 | 3300006954 | Agricultural Soil | MTAQNRYGFRVGPGMRRGLSSAVPIPTRLVSNEEFPPIPQTLAQRR |
| Ga0099791_101198792 | 3300007255 | Vadose Zone Soil | MTVQNRYSFRIRPGMRRGLCTEVPLPTRLVSNEEFSPQPQTAAHREAEDR |
| Ga0111539_110964842 | 3300009094 | Populus Rhizosphere | MSLEHPHGFQVDHGMQRGLRSEIPLPTRLVSNEEFAPLPQTPAQREVEHRILADAARLA |
| Ga0066709_1023549392 | 3300009137 | Grasslands Soil | MIAGNRHAFELRAGMRRGITSAVPLPMRLVSNEEFPPIPQTAA |
| Ga0111538_124334282 | 3300009156 | Populus Rhizosphere | MATGNRYGFQVRPGMRQGLRGAVPLPTRLVSNEEF |
| Ga0075423_127024312 | 3300009162 | Populus Rhizosphere | MTAHNPHAFRLHGGLRRDLVTEVPLPTRLVSNEEFPPLAQTPAQQEVEARILAAA |
| Ga0105100_1000219411 | 3300009166 | Freshwater Sediment | MEESSMRPNRHAFRIRPGMRRGLQTEVQLPTRLVSTEQVAHLPTTAAQREEEA |
| Ga0105241_113421721 | 3300009174 | Corn Rhizosphere | MEEWQMKLNRRAFRVKPGMSQGMQSEVPLPTQLVSNEEFPPLPQTLAQREVEQRILS |
| Ga0105242_106017402 | 3300009176 | Miscanthus Rhizosphere | MPADNRHAFRIRPGMRRGFRSEVPLPTRLVSNEEF |
| Ga0105242_107585093 | 3300009176 | Miscanthus Rhizosphere | MTPRNPYAFHVRPDMRQGLASELPLPTRLVSNEEFP |
| Ga0105237_106073472 | 3300009545 | Corn Rhizosphere | MEESMKLNRHAFRVLPGMRRGLRTEVPLLTRLVSNEEFPPLPQTAQQREVEERILAAAGRLAPRL |
| Ga0105249_109705271 | 3300009553 | Switchgrass Rhizosphere | MTDGNPHAFRLRPGMRRGYRSEIPLPTRLVSNEEFPPLPQTAAQRAVEERILAEAGRLAP |
| Ga0105249_122001792 | 3300009553 | Switchgrass Rhizosphere | MPADNRHAFRIRPGMRRGFRSEVPLPTRLVSNEEFPPLPQTAAQRAVEDRIL |
| Ga0105249_132831312 | 3300009553 | Switchgrass Rhizosphere | MKRQPEHGFRVDASMRQGLRSEVPLPTRLVSNEEF |
| Ga0105065_10531101 | 3300009803 | Groundwater Sand | MTADNRYAFRFRPGMRRALSTEVPLPTRLVSNEEFPPLPQTSAQRA |
| Ga0105071_11083252 | 3300009808 | Groundwater Sand | MKPNRHAFRVRPDMRRGLQTEVPLPTRLVSNEEFPPL |
| Ga0105070_10905822 | 3300009815 | Groundwater Sand | MTAHNRHVFRVRPGMHRGFQSDVPLPTRLVSNEEFP |
| Ga0126380_118457201 | 3300010043 | Tropical Forest Soil | MTMQNRYAFRIRPRMRRGLCTEVPLPTRLVSNEEFPPQPQTAAQQEVEHRILAEAGR |
| Ga0126380_122831342 | 3300010043 | Tropical Forest Soil | MTVRNRYGFRVTPGMRRGLRSAVPIPTQLVSNEEFPPIPQTAAQRRVED |
| Ga0126384_103699942 | 3300010046 | Tropical Forest Soil | MTADNPYAFRFQPGMRQGLRTEIPLPTRLVSNEEFPALPQTPAQRAVENRILAE |
| Ga0126384_116530902 | 3300010046 | Tropical Forest Soil | MLKPNRLAFRVREGMRQGLRTEVPLPTRLVSNEEFPPLPQTAAQREVEHRILAAAG |
| Ga0126382_104110792 | 3300010047 | Tropical Forest Soil | MTAENRYGFRIRSGMRQGLQSAVPIPTRLVSNEEFP |
| Ga0126382_106020681 | 3300010047 | Tropical Forest Soil | MPDLNPHAFRIRPGMRRGFQSEIPLPTRLVSNEEFPALPQTPAQRAV |
| Ga0126382_114454571 | 3300010047 | Tropical Forest Soil | MEESIMTVQNRYPFRIRPRMRRGLCTEVPLPTRLVSNEEFPPQPQPAAQQEVEHRILAE |
| Ga0126373_107484911 | 3300010048 | Tropical Forest Soil | MPDLNPHAFRIRPSMRRGYRSEIPLPTRLVSNEEF |
| Ga0126373_130839711 | 3300010048 | Tropical Forest Soil | MPDLNPHAFRIRPGMRRGYRSEIPLPTRLVSNEEFPALPQTAAQQAVENRILAEASRLA |
| Ga0134084_104546061 | 3300010322 | Grasslands Soil | MTHENSRAFRIRPDMHRGLRTEVPLPTRLVSNEEFPPLPQTAAQRAVEDR |
| Ga0134065_104034362 | 3300010326 | Grasslands Soil | MTHENSRAFRIRPDMHRGLRTEVPLPTRLVSNEEFPPLPQTAA |
| Ga0134071_106492812 | 3300010336 | Grasslands Soil | MTVQNRYSFRIHPGMRRGLCTEVPLPTRLVSNEEFPPQSQMAAQREVEDRILAEAGRLAP |
| Ga0126370_107212951 | 3300010358 | Tropical Forest Soil | VPDLYPHAFRIRPGMRRGYRSEIPLPTRLVSNEEFPALPQTAAQR |
| Ga0126376_101404811 | 3300010359 | Tropical Forest Soil | MPDLNPHAFRIRPGMRRGYRSEIPLPTRLVSNEEFPALPQTAAQQAVENRILAEASRLAP |
| Ga0126376_115012912 | 3300010359 | Tropical Forest Soil | MTVPNRRAFRIRPQMRRGLCTEVPLPTRLVSNEEFPPH |
| Ga0126372_115414493 | 3300010360 | Tropical Forest Soil | MTTGNRYAFHVRPGMRRGLSSEVPLPTRLVSNEEFPPLPQTREQRAVE |
| Ga0126377_101203141 | 3300010362 | Tropical Forest Soil | MPDLNPHAFRIRPGMRRGYRSELPLPTRLVSNEEFPALPQTAAQQAVENRILA |
| Ga0126377_106702731 | 3300010362 | Tropical Forest Soil | MTMQNRYAFRIRPRMRRGLCTEVPLPTRLVSNEEFPPQPQTAAQQEVEHRT |
| Ga0126377_129591501 | 3300010362 | Tropical Forest Soil | MTMHNRYAFRIRPSMRRGLRTEVPLPTRLVSNEEFPPQPQTAAQREVEHRIL |
| Ga0126379_106205151 | 3300010366 | Tropical Forest Soil | MTVQNRYAFRLRPQMRRGLCTEVSLPTRLVSNEEFPPHP* |
| Ga0126379_129094012 | 3300010366 | Tropical Forest Soil | MPDLNPHAFRIRPGMRRGYRSEIPLPTRLVSNEEFPALPQTA |
| Ga0126383_109011301 | 3300010398 | Tropical Forest Soil | MTIQNPHAFRLHPGMRQGLCTEVPLPTRLVSNEEFPPLPQTAAQRQVE |
| Ga0134127_124019111 | 3300010399 | Terrestrial Soil | MTTQNPHAFRPLRGMCRGLRTEVPLPTRLVSNEEFPPLPQTPAQRHVEERILAD |
| Ga0134121_114471701 | 3300010401 | Terrestrial Soil | MEEWQMKLNRHAFRVKPGMSQGMQSEVPLPTQLVSNEE |
| Ga0137442_11197462 | 3300011414 | Soil | MTNGNPYAFHVRPDMRQGLASELPLPTRLVSNEEFPPLPQTAAQRR |
| Ga0137448_11831281 | 3300011427 | Soil | MTNGNPYAFHVRPDMRQGLASELPLPTRLVSNEEFPPLPQTA |
| Ga0137461_11610842 | 3300012040 | Soil | MTDDNPHAFRIRPGMRRGLRSEIPLPTRLVSNEEFPP |
| Ga0136634_102740581 | 3300012046 | Polar Desert Sand | MKLNRHAFSIRPGMRRGQQTETPLPTRLVSNEEFPPMPQTI |
| Ga0137388_103110381 | 3300012189 | Vadose Zone Soil | MTTQNRHAFQIRPGMLRGLRTELPLPTRLVSNEEFPPLPQTPAQREVEDRILAEA |
| Ga0137388_106103002 | 3300012189 | Vadose Zone Soil | MRLDNPHAFRVHSGIRQGLRAETPLPTRLVSNEEFPPLPQTQ |
| Ga0137365_102889521 | 3300012201 | Vadose Zone Soil | MTIQNRYSFRIRPSMRRGLRTEVPLPTRLVSNEEFPPQPQTAAQREVEDR |
| Ga0137368_103831722 | 3300012358 | Vadose Zone Soil | MTVENPQSFHIRPGMRRGLRTEVPLPTRLVSNEEFPPLPQTAA |
| Ga0137361_115072982 | 3300012362 | Vadose Zone Soil | MTVENPQSFHIRPGMRRGLRTEVPLPTRLVSNEEFPPLPQTAAQRRVEDRILAEAG |
| Ga0137396_100468934 | 3300012918 | Vadose Zone Soil | MTNANSRAFSIRPGMRRGLRTEVPLPTRLVSNEEFPPLPQTAA |
| Ga0137396_109953242 | 3300012918 | Vadose Zone Soil | MTNSNPHAFRIRPGMRRGLRSEIPLPTRLVSNEEFPPLPQ |
| Ga0137394_109553202 | 3300012922 | Vadose Zone Soil | MTDSNRHSFRFRPGMRRGLRTEIPLPMRLVSNEEFPPLPQT |
| Ga0137416_101888425 | 3300012927 | Vadose Zone Soil | VQEATIMTTGNRYAFRLHPGMRRGLRAETPLPTRLVSNEEFPP |
| Ga0137416_111167952 | 3300012927 | Vadose Zone Soil | MTNSNPHAFRIRPGMRRGLRSEIPLPTRLVSNEEFPPLPQTASQRTVEDRILAEAGRLAPRL |
| Ga0137404_104612001 | 3300012929 | Vadose Zone Soil | MTPRNPYAFHVRPGMRRGLASEVPLPTRLVSNEEFPP |
| Ga0137404_108448173 | 3300012929 | Vadose Zone Soil | MTTGNRYAFRLLPGMRRGLRAETPLPTRLVSNEEFPPLPQT |
| Ga0126375_101874022 | 3300012948 | Tropical Forest Soil | MPDLNPHAFRIRPGMRRGYRSEIPLPTRLVSNEEFPALPQTAAQQAVENRILDEASRLAP |
| Ga0126375_118691192 | 3300012948 | Tropical Forest Soil | MLKPNRLAFRVREGMRQGLRTEVPLPTRLVSNEEFPPLP |
| Ga0126369_105902372 | 3300012971 | Tropical Forest Soil | MTIQNPHAFRLHPGMHQGLCTEVPLPTRLVSNEEFPPLPQTAAQRQVEDRILTAAGHLAPRL |
| Ga0157371_102028163 | 3300013102 | Corn Rhizosphere | MKLNRHAFRILPGMRQGLKSEIPLPMRLVSNEEFPPLPQTAEQ |
| Ga0157374_104355613 | 3300013296 | Miscanthus Rhizosphere | MKLNRRAFRVRPGMRKGLQSEVPVPTQLVSNEEFQPLPQTAAQREVEER |
| Ga0157374_109122562 | 3300013296 | Miscanthus Rhizosphere | MEESMKLNRHAFRVLPGMRRGLRTEVPLPTRLVSNEEFPPLPQTAQ |
| Ga0157378_111815922 | 3300013297 | Miscanthus Rhizosphere | MKLNRRAFRVRAGMSQGLQTEVPLPTRLVSNEEFPPLPQTPAQREVEQRILS |
| Ga0134075_103508031 | 3300014154 | Grasslands Soil | MTVENPQSFHIRPGMRRGLRTEVPLPTRLVSNEEFPPLPQTAAQRAVEDRILAEAGRLAP |
| Ga0075301_11395701 | 3300014262 | Natural And Restored Wetlands | MADGNPHAFRIRPGMRRGLRSEIPLPTRLVSNEEFPPLPQTAAQRAVEDRILAEAGRLAP |
| Ga0075303_10799432 | 3300014299 | Natural And Restored Wetlands | MADGNPHAFRIRPGMRRGLRSEIPLPTRLVSNEEFPPLPQTAAQRAVEDR |
| Ga0180104_11112301 | 3300014884 | Soil | MTAHNPHAFRPQRGLRRGVRTEVPLPTRLVSNEEFPPLPQTPAQRQVEERILAEAGR |
| Ga0180063_11802031 | 3300014885 | Soil | MTNHNPHAFRIRPGMRRGLRSEIPLPTRLVSNEEFP |
| Ga0157376_127325042 | 3300014969 | Miscanthus Rhizosphere | MMKLNRRAFRVRPGMRKGLQSEVPVPTQLVSNEEFQPLPQTAAQREVEQRILAA |
| Ga0137418_100097649 | 3300015241 | Vadose Zone Soil | MTNANSRAFSIRPGMRRGLRTEVPLPTRLVSNEEFPPLPQTTAQRAVEDRILAAA* |
| Ga0137403_102965472 | 3300015264 | Vadose Zone Soil | MTDGNRHAFELRPGMRRGITSAVPLPMRIVSNEEFPPIPQTAAQRRVEHQILA |
| Ga0137403_105701911 | 3300015264 | Vadose Zone Soil | MTVQNRYSFRIRPSMRRGLCTEVPLPTRLVSNEEFPPKPQTAA |
| Ga0134089_103651891 | 3300015358 | Grasslands Soil | MALPNRNAFALRPGMRRGLRTDIPIPTRLVSNEEFPPL |
| Ga0132258_104283505 | 3300015371 | Arabidopsis Rhizosphere | MRNDNPHAFRIRPGMRQGYRTEVPLPLRLVSNEEFPP |
| Ga0132258_128221922 | 3300015371 | Arabidopsis Rhizosphere | MEESMKLNRHAFRVLPGMRRGLRTEVPLPTRLVSNEEFPPLPQTAQQREVE |
| Ga0132256_1007420662 | 3300015372 | Arabidopsis Rhizosphere | MTDENPHAFRIRPGMRQGYRTEVPLPLRLVSNEEFPPLPQTAAQREVGH |
| Ga0132256_1011565762 | 3300015372 | Arabidopsis Rhizosphere | MKLNRHAFRVRPGMRQGVRTKVPLPTRLVSNEEFPP |
| Ga0132257_1001101393 | 3300015373 | Arabidopsis Rhizosphere | MTVQNHHAFRIRPHMRRGLCTEVPLPTRLVSHEEFP |
| Ga0132257_1012952521 | 3300015373 | Arabidopsis Rhizosphere | MTAQNRYGFRVGPRMRRGLSTAVPIPTRLVSNEEFPPIPQIPAQRR |
| Ga0182033_113495612 | 3300016319 | Soil | MTVPNRYAFRLRPQMRRGLCTEVPLPTRLVSNEEFPPYPQ |
| Ga0134112_101955151 | 3300017656 | Grasslands Soil | MTVENPQSFHIRPGMRRGLRTEVPLPTRLVSNEEFPPLP |
| Ga0163161_110937891 | 3300017792 | Switchgrass Rhizosphere | MTVPNRHAFHIRPQMRRGLCTEVPLPTRLVSNEEFPPHPQTAAQQQVEHRILTE |
| Ga0187779_110027031 | 3300017959 | Tropical Peatland | MLKPNRLAFRVREGMRQGLRTEVPLPTRLVSNEEFP |
| Ga0184610_12919262 | 3300017997 | Groundwater Sediment | MTTRNPYAFHVRPDMRQGLASEVPLPTRLVSNEEFPPLPQTAAQRRVED |
| Ga0184604_100048851 | 3300018000 | Groundwater Sediment | MTPRNPYAFHVRPGMRRGLASEVPLPTRLVSNEEFPPLPQTA |
| Ga0184634_102728082 | 3300018031 | Groundwater Sediment | MTNQNPHAFRIRPGMRHGLRSDIPLPTRLVSNEEFPPLPQ |
| Ga0184623_101884481 | 3300018056 | Groundwater Sediment | MTAQNRQGFRIRSGMRRGLRTEVPLPTRLVSNEEFPPLPQTAAQRA |
| Ga0187765_103025481 | 3300018060 | Tropical Peatland | MKPNRHAFRIRPDMRRGMQTEIPLPTRLVSNEEFPPLPQTPQ |
| Ga0184637_100532773 | 3300018063 | Groundwater Sediment | MTDQNPHAFRIRPGMRRGLRSEIPLPTRLVSNEEFPPLPQTAAQRAVEERIL |
| Ga0184633_102259251 | 3300018077 | Groundwater Sediment | MSSENRHAFRVLRGMRRGLRSQVPLPTRLVSNEEFPPLPQTAAQRQVEHRILEEA |
| Ga0184627_104321092 | 3300018079 | Groundwater Sediment | MTTRNPYAFHVRPDMRRGLRTELPLPTRLVSNEEFPPLPQTAAQRRVEDR |
| Ga0187894_101239164 | 3300019360 | Microbial Mat On Rocks | MTTGNPYAFHVRPDMRRGLASELPLPTRLVSNEEFPPLPQT |
| Ga0187894_105134461 | 3300019360 | Microbial Mat On Rocks | MNPNRHAFRVRPGMRRGVRTEVPLPTRLVSNEEFPPLPQTATQRQVEDR |
| Ga0190264_107013131 | 3300019377 | Soil | MTIPNRHAFRIHPRMRRGLSTEIPLPTWLVSNEEFPPQPQTASQRTVEERILAEAGR |
| Ga0180109_12449071 | 3300020067 | Groundwater Sediment | MAENRHAFRLHRGMRRGLRTEIPLPTRLVSNEEFPPLPPTA |
| Ga0210410_108220922 | 3300021479 | Soil | MKLNRRAFRIRPGMSQGLQTEVPLPTRLVSNEEFPPLPQTAAQREVEQR |
| Ga0209108_100979863 | 3300025165 | Soil | MTNQNPHAFRIRPGMRRGLRSEIPLPARLVSNEEFPPLPQTAPQRAVEDRILAEAGR |
| Ga0209519_104591741 | 3300025318 | Soil | MTNQNPHAFRIRPGMRRGLRSEIPLPTRLVSNEEFPPLPQTAAQR |
| Ga0207699_106842391 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYGNPHDFRLRPGMRRGYRSEIPLPTRLVSNEEFPPLPQTAAQRAVEER |
| Ga0207654_107680021 | 3300025911 | Corn Rhizosphere | MKRQPEHGFRVDASMRQGLRSEVPLPTRLVSNEEFPPLPQTNAQRRVEGRILAERLG |
| Ga0207662_103258803 | 3300025918 | Switchgrass Rhizosphere | MPADNRHAFRIRPGMRRGFRSEVPLPTRLVSNEEFPPLPQTAAQRAVEDR |
| Ga0207646_117622182 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDGNPHAFRLRPGMRRGYRSEIPLPTRLVSNEEFPSL |
| Ga0207709_105831962 | 3300025935 | Miscanthus Rhizosphere | MKLNRRAFRVRPGMRKGLQSEVPVPTQLVSNEEFQPLPQTAAQREVEQRILAAAGRL |
| Ga0207704_113689162 | 3300025938 | Miscanthus Rhizosphere | MKRQPEHGFRVDASMRQGLRSEVPLPTRLVSNEEFAP |
| Ga0207712_102474731 | 3300025961 | Switchgrass Rhizosphere | MTTGNRYEFQVRPGMRQGLRTETPIPTRLVSNEEFPPLPQTAEQKRVEHHILD |
| Ga0207678_108492882 | 3300026067 | Corn Rhizosphere | MKLNRHAFRVRPGMRQGLQSEIPVPTQLVSNEEFPPLPQTVQQREVEQRILAAA |
| Ga0207648_117534241 | 3300026089 | Miscanthus Rhizosphere | MTTGNRYAFRVRPGMRQGLRTETPIPTRLVSNEEFPPLPQTAEQKRVEHHILDA |
| Ga0207676_101432691 | 3300026095 | Switchgrass Rhizosphere | MTKDMTTGNRFAFQLFPGMRQGLTGEIPLPTRLVSNEEFPPLPQT |
| Ga0208291_10263041 | 3300026111 | Natural And Restored Wetlands | MTIPNRHAFRIHPRMRRGLCTEVPLPTRLVSNEEFPPQPQTAAQRAVEERILAEAGRLAP |
| Ga0209234_11869951 | 3300026295 | Grasslands Soil | MTNENSRAFRIGPDMRRGLRTEVPLPTRLVSNEEFPPLPQTAAQRAVEDRILAVA |
| Ga0209158_10243863 | 3300026333 | Soil | MIAGNRHAFELRAGMRRGITSAVPLPMRLVSNEELPPI |
| Ga0209804_11388842 | 3300026335 | Soil | MTNENSRAFRIGPDMRRGLRTEVPLPTRLVSNEEFPPLPQTAAQRAVEDRILAVAGRLAPTL |
| Ga0257168_10966071 | 3300026514 | Soil | MTTGNRYAFRLRPGMRRGLRAETPLPTRLVSNEEFPPLPQTPA |
| Ga0209157_11399451 | 3300026537 | Soil | MATRNRHAFEIRPGMRRGLHTEVPLPTRLVSNEEFPPLPQT |
| Ga0207570_10001206 | 3300026944 | Soil | MKRQPEHGFRVDASMRQGLRSEVPLPTRLVSNEEFAPLPQTAAQREIEQRILAD |
| Ga0209877_10167941 | 3300027032 | Groundwater Sand | MTTNPHAFRLHPGMRRGFQSDVPLPTRLVSNEEFPPLPQTAAQRRVEARILAEAGR |
| Ga0209886_10410852 | 3300027273 | Groundwater Sand | MTTNPHAFRLHPGMRRGFQSDVPLPTRLVSNEEFPPLPQTAAQRRVEERIL |
| Ga0209799_10605301 | 3300027654 | Tropical Forest Soil | VPDLNPHAFRIHPGMRRGYRSEIPLPTRLVSNEEFPALPQTAAQRAVEHRILAEASRLAPRL |
| Ga0209388_11837672 | 3300027655 | Vadose Zone Soil | MTVQNRYSFRIRPGMRRGLCTEVPLPTRLVSNEEFSPQPQTAA |
| Ga0208990_11537703 | 3300027663 | Forest Soil | MTPRNPYAFHVRPGMRRGLASEVPLPTRLVSNEEFPPLPQTAAQRQ |
| Ga0209971_11717792 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MMAGNPDAFRPHPRLRRGLRTEVPLPTRLVSNEEFAPIPQTPAQQAVE |
| Ga0209465_100498533 | 3300027874 | Tropical Forest Soil | MTSPNRYRFRVRPGMRRGLSGLVPIPTRLVSNEEFPPIPQTPE |
| Ga0209253_111483311 | 3300027900 | Freshwater Lake Sediment | MKLNRRAFRVRPGMQQGLRTEVPIPTRLVSNEEFQPLPQTA |
| Ga0207428_105219871 | 3300027907 | Populus Rhizosphere | MTVPNRHAFRIRPQMRRGLCTEVPLPTRLVSNEEFPPHPQTAAQQE |
| Ga0209583_101340873 | 3300027910 | Watersheds | MATRNPHAFRLRPGMRRGFQAETPLPTRLVSNEEFPPLPQTPAQRQVEERILVE |
| (restricted) Ga0233417_100113984 | 3300028043 | Sediment | MTNGNPYAFRVHPGLRRGLRSEIPLPTRLVSNEEFPPLPQTADQRRVEARVLAEAARLA |
| Ga0209526_107614551 | 3300028047 | Forest Soil | MAATRNRYAFRLSPGMRRGFEAETPIPTRLVSNEEFPPLPQTPAQRQ |
| Ga0247675_10673672 | 3300028072 | Soil | MADQNPHSFRIHAGMRQGYRTETPLPLRLVSNGEFPPLPQT |
| Ga0268264_113942401 | 3300028381 | Switchgrass Rhizosphere | MAHENPHAFHVRPGMRRGLVSELPLPTQLVSNEEF |
| Ga0268264_115796622 | 3300028381 | Switchgrass Rhizosphere | MKLNRRAFRVRPGMRKGLQSEVPVPTQLVSNEEFQPLPQTAAQRE |
| Ga0247821_101411383 | 3300028596 | Soil | MATGNRYAFRVCPGMRQGLATETPIPTRLISNEEFPPLP |
| Ga0247827_110513362 | 3300028889 | Soil | MATGNRYAFRVRPGMRQGLATETPIPTRLISNEEFPPLP |
| Ga0302046_105905471 | 3300030620 | Soil | MTNGNPYAFHVRPDMRRGLASELPLPTRLVSNEEFP |
| Ga0307499_102246061 | 3300031184 | Soil | MTAQNRYGFRVGPRMRRGLSTAVPIPTRLVSNEEFPPIPQTPAQR |
| Ga0310888_103455392 | 3300031538 | Soil | MTAQNRYGFRVGPRMRRGLSTAVPIPTRLVSNEEFPPI |
| Ga0318516_106604541 | 3300031543 | Soil | MTVLNRHAFRIRPQMRRGLCTEVPLPTRLVSNEEFPPHPQTAAQQE |
| Ga0318571_103844271 | 3300031549 | Soil | MPDLNPHAFRICPGMRRGYRSEIPLPTRLVSNEEFP |
| Ga0318493_102630192 | 3300031723 | Soil | MTNQNRYRFRVGPGMRRGHSGLAPIPTRLVSNEEFPPIPQT |
| Ga0307468_1000907901 | 3300031740 | Hardwood Forest Soil | MTAGNRHAFRIRPGMRQGLSTETPIPTRLVSNEEFPPLPQTAEQQRVEHEILRTAGR |
| Ga0307468_1006025371 | 3300031740 | Hardwood Forest Soil | MTAWTRYTFRVRPGMRQGLRSAVPLPMRLVSNEEFPPIPQTPAQRQVEDRIL |
| Ga0307468_1007132152 | 3300031740 | Hardwood Forest Soil | MSQDNPYAFHVHSGIRQGLRSETPLPTRLVSNEESPP |
| Ga0307468_1013809482 | 3300031740 | Hardwood Forest Soil | LTDTNPHAFHLRPGMRRGYRSEIPLPTRLVSNEEFPPLPQTAAQRAVEERILAEAGR |
| Ga0318492_101424092 | 3300031748 | Soil | MPDLNPHAFRICPGMRRGYRSEIPLPTRLVSNEEFPALPQTPAQRAVEDRIL |
| Ga0318552_100243771 | 3300031782 | Soil | MSFRITPGMRRGLRSAVPIPTRLVSNEEFPPIPQTA |
| Ga0318557_104073902 | 3300031795 | Soil | MPDLNPHAFRICPGMRRGYRSEIPLPTRLVSNEEFPALPQTPAQRAVEDRLLAAAGRLAPQLG |
| Ga0318576_100695162 | 3300031796 | Soil | MPDLNPHAFRICPGMRRGYRSEIPLPTRLVSNEEFPALPQTPAQRAVEDRILAEAGRLAP |
| Ga0318550_105833442 | 3300031797 | Soil | MTVLNRHAFRIRPQMRRGLCTEVPLPTRLVSNEEFPPHPQTAAQQEVEYRILADAE |
| Ga0318517_104502402 | 3300031835 | Soil | MTNQNRYRFRVGPGMRRGHSGLAPIPTRLVSNEEFP |
| Ga0310904_113157252 | 3300031854 | Soil | MKRQPEHGFQVDAGMRQGLRSEVPLPTRLVSNEEFA |
| Ga0318536_103818271 | 3300031893 | Soil | MTVLNRHAFRIRPQMRRGLCTEVPLPTRLVSNEEFPPHPQTAAQQAVEHRI |
| Ga0318551_101865491 | 3300031896 | Soil | MSFRITPGMRRGLRSAVPIPTRLVSNEEFPPIPQTAAQRRV |
| Ga0310885_106689582 | 3300031943 | Soil | MTSGNRHAFRIRPGMRQGLSTETPIPTRLISNEEFPPLPQTGEQQRVEHHILSAA |
| Ga0310913_103465791 | 3300031945 | Soil | MSFRITPGMRRGLRSAVPIPTRLVSNEEFPPIPQTAAQRR |
| Ga0307479_108616582 | 3300031962 | Hardwood Forest Soil | MTVQNRHAFQIRPGMRRGVRTLAPLPTQLVSNEEF |
| Ga0326597_108000632 | 3300031965 | Soil | MTERALTRSNLNPHAFRVRQGMRRGLRSEIPLPTRLVSNEEFPPLPQTAAQ |
| Ga0326597_117449311 | 3300031965 | Soil | MTNRNPHAFRVRPGMRRGLRSEIPLPTRLVSNEEFPPLPQTAAQRAVEDRILAEAGRLAP |
| Ga0310906_100690074 | 3300032013 | Soil | MATGNRYAFRVCPGMRQGLATETPIPTRLISNEEFPPLPQTPEQQRVEH |
| Ga0318507_102321291 | 3300032025 | Soil | MPDLNPHAFRICPGMRRGYRSEIPLPTRLVSNEEFPALPQTPAQRAV |
| Ga0318570_101924381 | 3300032054 | Soil | MTNQNRYRFRVGPGMRRGHSGLAPIPTRLVSNEEFPPIPQ |
| Ga0318575_106656581 | 3300032055 | Soil | MTVLNRHAFRIRPQMRRGLCTEVPLPTRLVSNEEFPPHPQTAAQQ |
| Ga0318533_111995661 | 3300032059 | Soil | MTVLNRHAFRIRPQMRRGLCTEVPLPTRLVSNEEFPPHPQ |
| Ga0315910_106397472 | 3300032144 | Soil | MKPNRRAFRILPGMQRGLRSEVPIPTRLVSNEEFAPLPQ |
| Ga0307470_116023951 | 3300032174 | Hardwood Forest Soil | MKLNRRAFRVRPGMRKGLQSEVPVPTQLVSNEEFQP |
| Ga0307472_1000216845 | 3300032205 | Hardwood Forest Soil | MTDGNPHAFRLRPGMRRGYRSEIPLPTRLVSNEEFPP |
| Ga0307472_1011034802 | 3300032205 | Hardwood Forest Soil | MKLNRHAFRVLPGMCRGLSTEVPLPTRLVSNEEFPPLPQT |
| Ga0335076_109792352 | 3300032955 | Soil | MKPNRHAFRIRPGMRQGLRTEVPLPTRLVSNEEFPPLPQT |
| Ga0326729_10199761 | 3300033432 | Peat Soil | MMDDNPHVFRIHPGMRRGLRSEIPLPTRLVSNEEFPPLPQTSAQRAVED |
| Ga0326726_120238512 | 3300033433 | Peat Soil | MTTGNRYAFRLLPGMRHGLRTETPLPTRLVSNEEFPP |
| Ga0326723_0241496_673_804 | 3300034090 | Peat Soil | MKLNRHAFRIRPDMRRGLRTEVPLPTRLVSNEEFPPLPQTAAQR |
| Ga0326723_0537522_1_108 | 3300034090 | Peat Soil | MTTDHRHPFRLRPGMRRGLSTEVPLPTRLVSNEEFP |
| Ga0364932_0326354_446_577 | 3300034177 | Sediment | MTNRNPHAFRIRPGMRRGLRSEIPLPTRLVSNEEFPPLPQTAAQ |
| Ga0373959_0200047_422_526 | 3300034820 | Rhizosphere Soil | MMPGNPHEFQVRPGMRRGLSTATPIPTRLVSNEEF |
| ⦗Top⦘ |