| Basic Information | |
|---|---|
| Family ID | F018019 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 237 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Number of Associated Samples | 170 |
| Number of Associated Scaffolds | 237 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.27 % |
| % of genes near scaffold ends (potentially truncated) | 97.05 % |
| % of genes from short scaffolds (< 2000 bps) | 92.41 % |
| Associated GOLD sequencing projects | 155 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.827 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.097 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.536 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.131 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.25% β-sheet: 2.90% Coil/Unstructured: 89.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 237 Family Scaffolds |
|---|---|---|
| PF09865 | DUF2092 | 4.64 |
| PF01758 | SBF | 1.69 |
| PF00691 | OmpA | 1.69 |
| PF13505 | OMP_b-brl | 0.84 |
| PF00004 | AAA | 0.84 |
| PF00528 | BPD_transp_1 | 0.84 |
| PF02630 | SCO1-SenC | 0.84 |
| PF16576 | HlyD_D23 | 0.84 |
| PF01042 | Ribonuc_L-PSP | 0.84 |
| PF13439 | Glyco_transf_4 | 0.84 |
| PF06186 | DUF992 | 0.84 |
| PF07728 | AAA_5 | 0.84 |
| PF07411 | DUF1508 | 0.84 |
| PF04392 | ABC_sub_bind | 0.84 |
| PF01061 | ABC2_membrane | 0.42 |
| PF01011 | PQQ | 0.42 |
| PF13546 | DDE_5 | 0.42 |
| PF00296 | Bac_luciferase | 0.42 |
| PF13751 | DDE_Tnp_1_6 | 0.42 |
| PF00082 | Peptidase_S8 | 0.42 |
| PF13683 | rve_3 | 0.42 |
| PF13441 | Gly-zipper_YMGG | 0.42 |
| PF13511 | DUF4124 | 0.42 |
| PF09363 | XFP_C | 0.42 |
| PF13340 | DUF4096 | 0.42 |
| PF12759 | HTH_Tnp_IS1 | 0.42 |
| PF00274 | Glycolytic | 0.42 |
| PF01408 | GFO_IDH_MocA | 0.42 |
| PF00005 | ABC_tran | 0.42 |
| PF00378 | ECH_1 | 0.42 |
| PF09364 | XFP_N | 0.42 |
| PF07681 | DoxX | 0.42 |
| PF01617 | Surface_Ag_2 | 0.42 |
| PF13011 | LZ_Tnp_IS481 | 0.42 |
| PF01163 | RIO1 | 0.42 |
| PF01734 | Patatin | 0.42 |
| PF00873 | ACR_tran | 0.42 |
| PF00497 | SBP_bac_3 | 0.42 |
| PF13091 | PLDc_2 | 0.42 |
| PF00120 | Gln-synt_C | 0.42 |
| PF03401 | TctC | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 237 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.84 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.84 |
| COG3422 | Uncharacterized conserved protein YegP, UPF0339 family | Function unknown [S] | 0.84 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.42 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.42 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.42 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.42 |
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 0.42 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.42 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.42 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.83 % |
| Unclassified | root | N/A | 7.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig63465 | Not Available | 771 | Open in IMG/M |
| 2170459011|GI3SL7401CTQQN | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 502 | Open in IMG/M |
| 3300000550|F24TB_11480263 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 521 | Open in IMG/M |
| 3300000559|F14TC_104402121 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 602 | Open in IMG/M |
| 3300000955|JGI1027J12803_101147657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300000956|JGI10216J12902_101645940 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
| 3300004104|Ga0058891_1579817 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 528 | Open in IMG/M |
| 3300004156|Ga0062589_101066854 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 761 | Open in IMG/M |
| 3300004801|Ga0058860_10217885 | All Organisms → cellular organisms → Bacteria | 2809 | Open in IMG/M |
| 3300005093|Ga0062594_101094556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 778 | Open in IMG/M |
| 3300005332|Ga0066388_104266610 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 729 | Open in IMG/M |
| 3300005354|Ga0070675_100965488 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300005354|Ga0070675_101069127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300005439|Ga0070711_100451233 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1053 | Open in IMG/M |
| 3300005467|Ga0070706_101540885 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 607 | Open in IMG/M |
| 3300005468|Ga0070707_100137283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisoma → Acidisoma cellulosilyticum | 2379 | Open in IMG/M |
| 3300005536|Ga0070697_100791641 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 839 | Open in IMG/M |
| 3300005617|Ga0068859_100780080 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300005618|Ga0068864_101031914 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300005718|Ga0068866_10758777 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 671 | Open in IMG/M |
| 3300005841|Ga0068863_100221825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1822 | Open in IMG/M |
| 3300005841|Ga0068863_102144469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. | 569 | Open in IMG/M |
| 3300005842|Ga0068858_100311295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1504 | Open in IMG/M |
| 3300005843|Ga0068860_101848904 | Not Available | 626 | Open in IMG/M |
| 3300005844|Ga0068862_100193017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales | 1833 | Open in IMG/M |
| 3300006028|Ga0070717_11787838 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 555 | Open in IMG/M |
| 3300006050|Ga0075028_100901732 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 545 | Open in IMG/M |
| 3300006237|Ga0097621_100656099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 963 | Open in IMG/M |
| 3300006845|Ga0075421_100402807 | Not Available | 1643 | Open in IMG/M |
| 3300006845|Ga0075421_100901911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1009 | Open in IMG/M |
| 3300006854|Ga0075425_101734424 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 702 | Open in IMG/M |
| 3300006880|Ga0075429_100077041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2904 | Open in IMG/M |
| 3300006881|Ga0068865_101578387 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 589 | Open in IMG/M |
| 3300006881|Ga0068865_101967150 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 530 | Open in IMG/M |
| 3300006904|Ga0075424_100276061 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1787 | Open in IMG/M |
| 3300009094|Ga0111539_11830207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300009098|Ga0105245_12457913 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 574 | Open in IMG/M |
| 3300009100|Ga0075418_11587124 | Not Available | 711 | Open in IMG/M |
| 3300009101|Ga0105247_10319296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1083 | Open in IMG/M |
| 3300009162|Ga0075423_12169508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300009177|Ga0105248_10570643 | Not Available | 1277 | Open in IMG/M |
| 3300009553|Ga0105249_13452835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300010047|Ga0126382_12176685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300010147|Ga0126319_1650960 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 509 | Open in IMG/M |
| 3300010154|Ga0127503_10468155 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 574 | Open in IMG/M |
| 3300010373|Ga0134128_13052573 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010375|Ga0105239_10557016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1306 | Open in IMG/M |
| 3300010396|Ga0134126_11119517 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 878 | Open in IMG/M |
| 3300010397|Ga0134124_12193837 | Not Available | 592 | Open in IMG/M |
| 3300010398|Ga0126383_12929337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 557 | Open in IMG/M |
| 3300010399|Ga0134127_10990100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 900 | Open in IMG/M |
| 3300010399|Ga0134127_11582347 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 729 | Open in IMG/M |
| 3300012198|Ga0137364_10434939 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300012212|Ga0150985_113746486 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300012898|Ga0157293_10330542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300012914|Ga0157297_10044169 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300012943|Ga0164241_10509638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 867 | Open in IMG/M |
| 3300012960|Ga0164301_10420446 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 941 | Open in IMG/M |
| 3300012960|Ga0164301_11128443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300013104|Ga0157370_11261539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300013297|Ga0157378_12013232 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 627 | Open in IMG/M |
| 3300013308|Ga0157375_12910674 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300014325|Ga0163163_10387670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1455 | Open in IMG/M |
| 3300014325|Ga0163163_12076614 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300014325|Ga0163163_13137576 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 515 | Open in IMG/M |
| 3300014326|Ga0157380_10009769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6885 | Open in IMG/M |
| 3300014326|Ga0157380_10625650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
| 3300014968|Ga0157379_10151064 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300014969|Ga0157376_10106266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2462 | Open in IMG/M |
| 3300014969|Ga0157376_10254496 | Not Available | 1642 | Open in IMG/M |
| 3300014969|Ga0157376_11225048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA9 | 779 | Open in IMG/M |
| 3300015371|Ga0132258_10267938 | All Organisms → cellular organisms → Bacteria | 4185 | Open in IMG/M |
| 3300015371|Ga0132258_10941826 | All Organisms → cellular organisms → Bacteria | 2181 | Open in IMG/M |
| 3300015371|Ga0132258_11877821 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300015371|Ga0132258_13836655 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1023 | Open in IMG/M |
| 3300015372|Ga0132256_101011376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 947 | Open in IMG/M |
| 3300015372|Ga0132256_101364704 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300015373|Ga0132257_103944794 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 540 | Open in IMG/M |
| 3300015374|Ga0132255_103378734 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 680 | Open in IMG/M |
| 3300016270|Ga0182036_10909785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 722 | Open in IMG/M |
| 3300016294|Ga0182041_10274613 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1384 | Open in IMG/M |
| 3300016294|Ga0182041_11159153 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 704 | Open in IMG/M |
| 3300016294|Ga0182041_12246252 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 510 | Open in IMG/M |
| 3300016319|Ga0182033_10158012 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1759 | Open in IMG/M |
| 3300016341|Ga0182035_10439046 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1104 | Open in IMG/M |
| 3300016341|Ga0182035_10770268 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 842 | Open in IMG/M |
| 3300016341|Ga0182035_12039732 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 521 | Open in IMG/M |
| 3300016357|Ga0182032_11452399 | Not Available | 595 | Open in IMG/M |
| 3300016371|Ga0182034_10242741 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1417 | Open in IMG/M |
| 3300016371|Ga0182034_10254739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1386 | Open in IMG/M |
| 3300016371|Ga0182034_10851542 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 782 | Open in IMG/M |
| 3300016371|Ga0182034_11948078 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 519 | Open in IMG/M |
| 3300016387|Ga0182040_10174342 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300016387|Ga0182040_10487187 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 983 | Open in IMG/M |
| 3300016387|Ga0182040_11099959 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 666 | Open in IMG/M |
| 3300016387|Ga0182040_11120528 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 660 | Open in IMG/M |
| 3300016387|Ga0182040_11408692 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 590 | Open in IMG/M |
| 3300016404|Ga0182037_10957850 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 744 | Open in IMG/M |
| 3300016422|Ga0182039_10167256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1722 | Open in IMG/M |
| 3300016422|Ga0182039_10401060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
| 3300017792|Ga0163161_10229477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae | 1440 | Open in IMG/M |
| 3300017792|Ga0163161_10945733 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 733 | Open in IMG/M |
| 3300017792|Ga0163161_11169818 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 664 | Open in IMG/M |
| 3300017932|Ga0187814_10260224 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 659 | Open in IMG/M |
| 3300018469|Ga0190270_10844350 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300018469|Ga0190270_11445495 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300018476|Ga0190274_11365413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
| 3300019356|Ga0173481_10868196 | Not Available | 505 | Open in IMG/M |
| 3300020580|Ga0210403_10901310 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 697 | Open in IMG/M |
| 3300020583|Ga0210401_11538622 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 522 | Open in IMG/M |
| 3300021401|Ga0210393_10121973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2084 | Open in IMG/M |
| 3300021403|Ga0210397_10509528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 912 | Open in IMG/M |
| 3300021403|Ga0210397_10841317 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 709 | Open in IMG/M |
| 3300021405|Ga0210387_10486436 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1097 | Open in IMG/M |
| 3300021474|Ga0210390_11592231 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 514 | Open in IMG/M |
| 3300021475|Ga0210392_10792780 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 707 | Open in IMG/M |
| 3300022506|Ga0242648_1007411 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1158 | Open in IMG/M |
| 3300022525|Ga0242656_1070360 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 640 | Open in IMG/M |
| 3300022533|Ga0242662_10009507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1929 | Open in IMG/M |
| 3300022533|Ga0242662_10089780 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 861 | Open in IMG/M |
| 3300022533|Ga0242662_10091189 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 856 | Open in IMG/M |
| 3300022712|Ga0242653_1068905 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 605 | Open in IMG/M |
| 3300022726|Ga0242654_10348509 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 556 | Open in IMG/M |
| 3300022726|Ga0242654_10436554 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 509 | Open in IMG/M |
| 3300025315|Ga0207697_10200189 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300025899|Ga0207642_11111526 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 511 | Open in IMG/M |
| 3300025901|Ga0207688_10435997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
| 3300025903|Ga0207680_10143091 | Not Available | 1587 | Open in IMG/M |
| 3300025907|Ga0207645_10929276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. | 590 | Open in IMG/M |
| 3300025907|Ga0207645_10980061 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 573 | Open in IMG/M |
| 3300025908|Ga0207643_10685777 | Not Available | 662 | Open in IMG/M |
| 3300025908|Ga0207643_10734565 | Not Available | 639 | Open in IMG/M |
| 3300025910|Ga0207684_10460662 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1091 | Open in IMG/M |
| 3300025910|Ga0207684_10793680 | Not Available | 801 | Open in IMG/M |
| 3300025926|Ga0207659_10112883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter | 2069 | Open in IMG/M |
| 3300025930|Ga0207701_10612575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 926 | Open in IMG/M |
| 3300025933|Ga0207706_10865925 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300025933|Ga0207706_11255419 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 614 | Open in IMG/M |
| 3300025936|Ga0207670_11253775 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 628 | Open in IMG/M |
| 3300025937|Ga0207669_10167066 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300025937|Ga0207669_11144987 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 658 | Open in IMG/M |
| 3300025941|Ga0207711_11212841 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 696 | Open in IMG/M |
| 3300025960|Ga0207651_10020032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4026 | Open in IMG/M |
| 3300025981|Ga0207640_11880716 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 541 | Open in IMG/M |
| 3300025986|Ga0207658_12173094 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300026023|Ga0207677_10283311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1361 | Open in IMG/M |
| 3300026067|Ga0207678_10853050 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300026075|Ga0207708_10257964 | Not Available | 1406 | Open in IMG/M |
| 3300026095|Ga0207676_11481027 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 675 | Open in IMG/M |
| 3300026118|Ga0207675_102638396 | Not Available | 512 | Open in IMG/M |
| 3300026121|Ga0207683_11042225 | Not Available | 759 | Open in IMG/M |
| 3300027701|Ga0209447_10091932 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 833 | Open in IMG/M |
| 3300027727|Ga0209328_10034720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisoma → Acidisoma cellulosilyticum | 1551 | Open in IMG/M |
| 3300027821|Ga0209811_10124022 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 943 | Open in IMG/M |
| 3300027907|Ga0207428_10454085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 934 | Open in IMG/M |
| 3300028047|Ga0209526_10691453 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 643 | Open in IMG/M |
| 3300028809|Ga0247824_10436990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 762 | Open in IMG/M |
| 3300029636|Ga0222749_10752948 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 533 | Open in IMG/M |
| 3300030590|Ga0247643_1194659 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300030740|Ga0265460_11192352 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 728 | Open in IMG/M |
| 3300030844|Ga0075377_11696701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 650 | Open in IMG/M |
| 3300030923|Ga0138296_1758719 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 930 | Open in IMG/M |
| 3300031057|Ga0170834_102885678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1308 | Open in IMG/M |
| 3300031057|Ga0170834_105310547 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 811 | Open in IMG/M |
| 3300031226|Ga0307497_10514464 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 593 | Open in IMG/M |
| 3300031231|Ga0170824_110376429 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 726 | Open in IMG/M |
| 3300031231|Ga0170824_115061258 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 990 | Open in IMG/M |
| 3300031231|Ga0170824_122742695 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 703 | Open in IMG/M |
| 3300031231|Ga0170824_123716799 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 504 | Open in IMG/M |
| 3300031231|Ga0170824_127935282 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 501 | Open in IMG/M |
| 3300031231|Ga0170824_128800869 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 705 | Open in IMG/M |
| 3300031446|Ga0170820_12868012 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 604 | Open in IMG/M |
| 3300031469|Ga0170819_11130037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300031474|Ga0170818_109507022 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1017 | Open in IMG/M |
| 3300031474|Ga0170818_112687504 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 505 | Open in IMG/M |
| 3300031474|Ga0170818_115380808 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1155 | Open in IMG/M |
| 3300031543|Ga0318516_10430587 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300031545|Ga0318541_10326734 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300031545|Ga0318541_10549798 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 646 | Open in IMG/M |
| 3300031546|Ga0318538_10626297 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031547|Ga0310887_10582666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300031572|Ga0318515_10083195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1661 | Open in IMG/M |
| 3300031681|Ga0318572_10354121 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 871 | Open in IMG/M |
| 3300031720|Ga0307469_10599167 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 984 | Open in IMG/M |
| 3300031720|Ga0307469_10606917 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300031724|Ga0318500_10295295 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300031740|Ga0307468_100303396 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300031740|Ga0307468_101987185 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 557 | Open in IMG/M |
| 3300031748|Ga0318492_10804108 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 506 | Open in IMG/M |
| 3300031768|Ga0318509_10215891 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1068 | Open in IMG/M |
| 3300031792|Ga0318529_10496260 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 568 | Open in IMG/M |
| 3300031796|Ga0318576_10625641 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 507 | Open in IMG/M |
| 3300031798|Ga0318523_10253242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 880 | Open in IMG/M |
| 3300031823|Ga0307478_11140601 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 650 | Open in IMG/M |
| 3300031823|Ga0307478_11487557 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 561 | Open in IMG/M |
| 3300031832|Ga0318499_10325394 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 592 | Open in IMG/M |
| 3300031833|Ga0310917_10666488 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 705 | Open in IMG/M |
| 3300031879|Ga0306919_10084836 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 2192 | Open in IMG/M |
| 3300031879|Ga0306919_10132879 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1795 | Open in IMG/M |
| 3300031879|Ga0306919_11215929 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 572 | Open in IMG/M |
| 3300031880|Ga0318544_10006463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3554 | Open in IMG/M |
| 3300031890|Ga0306925_10262906 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300031890|Ga0306925_10486673 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1315 | Open in IMG/M |
| 3300031890|Ga0306925_10492356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium waimense | 1306 | Open in IMG/M |
| 3300031890|Ga0306925_11577600 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 639 | Open in IMG/M |
| 3300031894|Ga0318522_10212555 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 733 | Open in IMG/M |
| 3300031910|Ga0306923_10076783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3738 | Open in IMG/M |
| 3300031910|Ga0306923_10827314 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 1020 | Open in IMG/M |
| 3300031912|Ga0306921_10515022 | Not Available | 1390 | Open in IMG/M |
| 3300031912|Ga0306921_11492836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
| 3300031912|Ga0306921_12012018 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 615 | Open in IMG/M |
| 3300031912|Ga0306921_12383830 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 552 | Open in IMG/M |
| 3300031942|Ga0310916_11461228 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 558 | Open in IMG/M |
| 3300031945|Ga0310913_10680182 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 728 | Open in IMG/M |
| 3300031945|Ga0310913_10825277 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 653 | Open in IMG/M |
| 3300031945|Ga0310913_11244447 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 517 | Open in IMG/M |
| 3300031946|Ga0310910_10128386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1917 | Open in IMG/M |
| 3300031946|Ga0310910_11208095 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 586 | Open in IMG/M |
| 3300031947|Ga0310909_10873219 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 740 | Open in IMG/M |
| 3300032001|Ga0306922_10222394 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
| 3300032035|Ga0310911_10057744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2039 | Open in IMG/M |
| 3300032044|Ga0318558_10338498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300032055|Ga0318575_10644652 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 536 | Open in IMG/M |
| 3300032064|Ga0318510_10170541 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 867 | Open in IMG/M |
| 3300032065|Ga0318513_10559724 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 560 | Open in IMG/M |
| 3300032076|Ga0306924_10159196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2587 | Open in IMG/M |
| 3300032076|Ga0306924_11532642 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 705 | Open in IMG/M |
| 3300032076|Ga0306924_11756482 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 648 | Open in IMG/M |
| 3300032091|Ga0318577_10445507 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 618 | Open in IMG/M |
| 3300032180|Ga0307471_103147365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300032261|Ga0306920_100697329 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300032261|Ga0306920_101522207 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 954 | Open in IMG/M |
| 3300032261|Ga0306920_102410283 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 726 | Open in IMG/M |
| 3300033475|Ga0310811_10702335 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 977 | Open in IMG/M |
| 3300033551|Ga0247830_11167576 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 615 | Open in IMG/M |
| 3300034149|Ga0364929_0121323 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 835 | Open in IMG/M |
| 3300034668|Ga0314793_131603 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSL12 | 550 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.30% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.53% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.27% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.42% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.42% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.42% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.42% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.42% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030590 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0465.00004330 | 2166559005 | Simulated | MEIQPTVVDPAVFDKVKVGDKVDITWNTDVTVTVQ |
| F64_05274900 | 2170459011 | Grass Soil | PNGWNYSRSVVDPTVFDKVKVGDKVDITWNTDVTVAMQ |
| F24TB_114802632 | 3300000550 | Soil | ITFTGPNGWKYSRVVTDPNVLDMLKVGDKIDILWNTDVTVSVE* |
| F14TC_1044021212 | 3300000559 | Soil | NGWQYSRRVVDPTVFDQVKVGDRIDITWNTDLVVSKE* |
| JGI1027J12803_1011476571 | 3300000955 | Soil | KYSRHVVDPAVLDTLKVGDRVDITWSTDLKVSVE* |
| JGI10216J12902_1016459401 | 3300000956 | Soil | SSISFEGPNGWKYSRRVVDPMVFAQVNVGDRVDIIWNTDLTVSVQ* |
| Ga0058891_15798172 | 3300004104 | Forest Soil | ASSITFVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVN* |
| Ga0062589_1010668541 | 3300004156 | Soil | ISFEGPNGWKYSRRVVDPMVFAQVNVGDRVDIIWNTDLAVSVQ* |
| Ga0058860_102178855 | 3300004801 | Host-Associated | VGPGGWKYSRHVVDPAVFEKIKVGDQADISWNTDLKVTVE* |
| Ga0062594_1010945562 | 3300005093 | Soil | KGASSATFEAPNGWKYSRRVIDPAVFDKVKVGDKVDIIWNTDLTVSVK* |
| Ga0066388_1042666101 | 3300005332 | Tropical Forest Soil | GPNGWKYSRRVVDPSILDKVKVGDKVDITWDTNVTVTMQ* |
| Ga0070675_1009654883 | 3300005354 | Miscanthus Rhizosphere | ISFVGPNGWKYSRRVVDPTIFDKVKVGDMVDITWDTDLTVSVQ* |
| Ga0070675_1010691271 | 3300005354 | Miscanthus Rhizosphere | GPNGWKYTRRIVDPTIFDKIKVGDQVDITWDSDLTVSVK* |
| Ga0070711_1004512333 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SSITFVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ* |
| Ga0070706_1015408851 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AITFVGPNGWKYSRRVVDPAVFDQVKVGDRVDITWNTDLSVSVE* |
| Ga0070707_1001372831 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ* |
| Ga0070697_1007916411 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | FVGPNGWKYSRHIVDPTVLDKAKVGDKVDITWNTDVTVAVQ* |
| Ga0068859_1007800801 | 3300005617 | Switchgrass Rhizosphere | IDKSTSSMTFVGPNGWKYSRRVVDPNVFDQVKAGDKVDITWSTDVNFAVQ* |
| Ga0068864_1010319142 | 3300005618 | Switchgrass Rhizosphere | FEAPNGWKYSRRVVDPTVFDKVKVGDKVDIIWNTDLTVSVK* |
| Ga0068866_107587771 | 3300005718 | Miscanthus Rhizosphere | SSISFEGVNGWKYSRRVVDPTVFDQVKVGDKVDITWSTDLSVLVE* |
| Ga0068863_1002218251 | 3300005841 | Switchgrass Rhizosphere | SMTFVGPNQWKYSRRIVDPNVFDQVKVGDRVDITWGTELVLAVE* |
| Ga0068863_1021444692 | 3300005841 | Switchgrass Rhizosphere | WKYSRRIVDPTVFDQVKAGDRVDITWSTDAAFVTE* |
| Ga0068858_1003112953 | 3300005842 | Switchgrass Rhizosphere | IDKAASSMTFVGPNGWKYSRRIVDPTVFDQVKVGDKIDVTWSTDVTYVVQ* |
| Ga0068860_1018489041 | 3300005843 | Switchgrass Rhizosphere | NGWKYSRRIVDPKVFDQVKVGDRVDITWSTDVTYVVQ* |
| Ga0068862_1001930174 | 3300005844 | Switchgrass Rhizosphere | KYSRHVVDPAVFEKIKVGDQADISWNTDLKVTVE* |
| Ga0070717_117878382 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NGWKYTRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ* |
| Ga0075028_1009017321 | 3300006050 | Watersheds | GPNGWKYSRHVVDPTVFDKVKVGDKVDITWNTDVTVTVQ* |
| Ga0097621_1006560992 | 3300006237 | Miscanthus Rhizosphere | GPNGWKYSRHVVDPAVLEKAKVGDAVDVTWNTDLKVTVE* |
| Ga0075421_1004028071 | 3300006845 | Populus Rhizosphere | WKYSRHIVDPAVLDKVKVGDKVDITWNTDVTVAVQ* |
| Ga0075421_1009019113 | 3300006845 | Populus Rhizosphere | FVGPNGWKYSRHVVDPAVFEKVKVGDQVDISWNTDLKVTVE* |
| Ga0075425_1017344243 | 3300006854 | Populus Rhizosphere | GWKYSRHVVDPAVFEKVKVGDQADISWNTDLKVTVE* |
| Ga0075429_1000770411 | 3300006880 | Populus Rhizosphere | TFVGPNGWKYSRHVVDPAVLEKVKIGDAVDVTWNTDLKVVVE* |
| Ga0068865_1015783871 | 3300006881 | Miscanthus Rhizosphere | KTSSTIAVVGPNGWKYSRRIVDPTVLDKVKVGDQVDLTWNTDMTVSVQ* |
| Ga0068865_1019671502 | 3300006881 | Miscanthus Rhizosphere | TSAITFVGPGGWKYSRHVVDPAVFEKIKVGDQADISWNTDLKVTVE* |
| Ga0075424_1002760614 | 3300006904 | Populus Rhizosphere | GWKYSRHIVDPAVFDKVKVGDKVDIIWATDVTVSVQ* |
| Ga0111539_118302072 | 3300009094 | Populus Rhizosphere | MTFVGPNGWKYSRHVVDPTVFEKVKVGDSVDITWNTDVTISVQ* |
| Ga0105245_124579131 | 3300009098 | Miscanthus Rhizosphere | ATFEAPNGWKYSRRVVDPAVFDKVKVGDKVDIIWNTDLTVSVK* |
| Ga0075418_115871241 | 3300009100 | Populus Rhizosphere | MVLASRRAGGRTVFNQVKVGDRVDIIWSTDLTVSVE* |
| Ga0105247_103192961 | 3300009101 | Switchgrass Rhizosphere | ASMTFVGPNGWKYSRHVVDPAVLEKAKVGDAVDVTWNTDLKVVVE* |
| Ga0075423_121695081 | 3300009162 | Populus Rhizosphere | GWKYSRHVVDPAVLEKAKVGDAVDVTWNTDLKVVVE* |
| Ga0105248_105706431 | 3300009177 | Switchgrass Rhizosphere | SFVGPNGWKYSRRVVDPTIFDKVKVGDMVDITWDTDLTVSVQ* |
| Ga0105249_134528352 | 3300009553 | Switchgrass Rhizosphere | SSITFVGPNGWKYSRRVVDQAVFDQVKTGDQVDITWNTDVTVMVE* |
| Ga0126382_121766851 | 3300010047 | Tropical Forest Soil | AVTFVGPDGWKYSRHVVDPTVFNQLKVGDQIDVTWNTDLQVTVQ* |
| Ga0126319_16509601 | 3300010147 | Soil | ASSITFVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ* |
| Ga0127503_104681551 | 3300010154 | Soil | SASSITFVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ* |
| Ga0134128_130525731 | 3300010373 | Terrestrial Soil | NGWKYSRRVVDPAVFDQVKVGDRVDIIWNTDLTVSVE* |
| Ga0105239_105570161 | 3300010375 | Corn Rhizosphere | WKYSRRVVDPTVFDQVKVGDKVDITWSTDLSVLVE* |
| Ga0134126_111195172 | 3300010396 | Terrestrial Soil | MTFVGPNGWKYSRRIVDPTVFDQVKVGDRVDITWSTDVTFVVE* |
| Ga0134124_121938372 | 3300010397 | Terrestrial Soil | WRYSRRVADPTLLDKIKPGDKIDITWDTNVTLAPQ* |
| Ga0126383_129293372 | 3300010398 | Tropical Forest Soil | ISFAGPNGWSYSRRVFDPTVLDQVKVGDKVDITWNIELKVPVE* |
| Ga0134127_109901002 | 3300010399 | Terrestrial Soil | SAITFVGPGGWKYSRHVVDPAVFEKIKVGDQADISWNTDLKVTVE* |
| Ga0134127_115823473 | 3300010399 | Terrestrial Soil | GPNGWKYSRHIVDPAVFDKVKVGDKVDITWATDVTVAVQ* |
| Ga0137364_104349391 | 3300012198 | Vadose Zone Soil | GWKYTRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ* |
| Ga0150985_1137464862 | 3300012212 | Avena Fatua Rhizosphere | ASSMTFVGPNGGKYSRRVVDPAVFNQVKTGDRVDITWSTDVNFAVQ* |
| Ga0157293_103305422 | 3300012898 | Soil | SSMTFVGPNQWKYSRRIVDPKVFDQVKVGDRVDITWGTELILAVE* |
| Ga0157297_100441692 | 3300012914 | Soil | FEGPNGWKYSRRVVDPMVFAQVNVGDRVDIIWNTDLAVSVQ* |
| Ga0164241_105096382 | 3300012943 | Soil | SISFADQNGWKYTRRVVDPTVFDKVKVGDKVDITWNTDLTVAVN* |
| Ga0164301_104204462 | 3300012960 | Soil | TFSGPNGWKYSRHVVDPTVFDKVKVGDKVDITWATDVTVAVQ* |
| Ga0164301_111284432 | 3300012960 | Soil | VVGPNDWRYSRRVADPTLLDKIKPGDKIDITWDTNVTLAPQ* |
| Ga0157370_112615391 | 3300013104 | Corn Rhizosphere | NGWKYSRRVIDPAVFDKVKVGDKVDIIWNTDLTVSVK* |
| Ga0157378_120132321 | 3300013297 | Miscanthus Rhizosphere | TFVGPNGWKYSRRVVDPAVFDQVKVGDRVDITWNTDLTVSVE* |
| Ga0157375_129106741 | 3300013308 | Miscanthus Rhizosphere | GPNGWKYSRRVVDPTVFDQVKVGDKVDITWNTDLTVLVE* |
| Ga0163163_103876702 | 3300014325 | Switchgrass Rhizosphere | MTFVGPNAWKYSRRVVDPTVFDQVKVGDKVDITWSTEVNFAVQ* |
| Ga0163163_120766142 | 3300014325 | Switchgrass Rhizosphere | EGPNGWKYSRRVVDPEVFAQVKVGDRVDIVWNTDLTVTKAS* |
| Ga0163163_131375761 | 3300014325 | Switchgrass Rhizosphere | FAGPSGWKYSRQVVDPTVFDKVKVGDKVDITWNTDVTVSVN* |
| Ga0157380_100097699 | 3300014326 | Switchgrass Rhizosphere | WKYSRRVVDPKVFDQVKVGDRVDITWSTEVNFAVQ* |
| Ga0157380_106256501 | 3300014326 | Switchgrass Rhizosphere | SMTFVGPNGWKYSRHVVDPAVLEKAKVGDAVDVTWNTDLKVTVE* |
| Ga0157379_101510641 | 3300014968 | Switchgrass Rhizosphere | NGWKYSRRVVDPMAFDQVKVGDRVDITWSTEVNFAVQ* |
| Ga0157376_101062663 | 3300014969 | Miscanthus Rhizosphere | TSSISFEGVNGWKYSRRVVDPTVFDQVKVGDKVDITWSTDLSVLVE* |
| Ga0157376_102544961 | 3300014969 | Miscanthus Rhizosphere | TIAEVDKSASSMTFVGANGWKYSRRVVDPKVFDQVKVGDRVDITWSTEVNFAVQ* |
| Ga0157376_112250482 | 3300014969 | Miscanthus Rhizosphere | VGPNGWKYSRRIVDPTVFDQVKAGDRVDITWSTDAAFVTE* |
| Ga0132258_102679383 | 3300015371 | Arabidopsis Rhizosphere | SMTFVGPNDWKYSRRIVDPKVFDQVKVGDRVDITWSTDLVIAVE* |
| Ga0132258_109418263 | 3300015371 | Arabidopsis Rhizosphere | WKYSRRVVDPTVFDQVKVGDRVDITWNTDLTVSVE* |
| Ga0132258_118778213 | 3300015371 | Arabidopsis Rhizosphere | SISFQGPNGWKYSRRVVDPQVFDQVKVGDKVDIVWSTDLTVAVE* |
| Ga0132258_138366551 | 3300015371 | Arabidopsis Rhizosphere | STSSMTVVGPNGWKYSRDVVDPTVFDKVKVGDSVDITWNTDVTVSVQ* |
| Ga0132256_1010113761 | 3300015372 | Arabidopsis Rhizosphere | WKYSRRVLDPTVLDKVNVGDRVDIIWSTDVTVTAN* |
| Ga0132256_1013647041 | 3300015372 | Arabidopsis Rhizosphere | GWKYSRRVVDPTVLDKTNVGDQVDITWDTSVTVSVQ* |
| Ga0132257_1039447941 | 3300015373 | Arabidopsis Rhizosphere | STSSMTVVGPNGWKYSRDVVDPTVFDKVKVGDQVDISWNTDLTVKVE* |
| Ga0132255_1033787341 | 3300015374 | Arabidopsis Rhizosphere | GWKYSRRVVDPTVFNQVKVGDKVDIIWSTDLTVSVE* |
| Ga0182036_109097852 | 3300016270 | Soil | ITGTGPSGWKGSRRVGDPAGREKLKVGDQVDITWDTNVTVAVQ |
| Ga0182041_102746131 | 3300016294 | Soil | SAQSITFTGPNGWNYSRRVADPTVLDKIKVGDQVDITWDTSVTVAVQ |
| Ga0182041_111591533 | 3300016294 | Soil | MKYDRRVVDPTVLDKLKVGDQVDITWDTNVTVSVQ |
| Ga0182041_122462521 | 3300016294 | Soil | TFVGPNGWKYSRRVVDPSILDKVKVGDKVDITWSTDVTVTVN |
| Ga0182033_101580124 | 3300016319 | Soil | GPNGWKYSRRVVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0182035_104390461 | 3300016341 | Soil | SITFTGPNGWKYSRRVVDPTVLDKVKVGDQVDVTWDTDVTVSVQ |
| Ga0182035_107702682 | 3300016341 | Soil | SITFTGPNGWKYSRRVVDPTVLDKVKVGDQVDVTWDTDVTVAVQ |
| Ga0182035_120397321 | 3300016341 | Soil | NGWKYSRHIVDPAVFDKVKAGDKIDITWDADTTMSVEKP |
| Ga0182032_114523991 | 3300016357 | Soil | ASSVSFTGPNGWKYERHVVDPTVLDKLKVDITWDTNVTVAVQ |
| Ga0182034_102427413 | 3300016371 | Soil | ASSITFTGPNGWKYSRRVVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0182034_102547391 | 3300016371 | Soil | SITFTGPNGWKYSRRVVDPTVLDKLKVGDQVDITWDTNVTVAVQ |
| Ga0182034_108515421 | 3300016371 | Soil | PNGWKYSRRVVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0182034_119480782 | 3300016371 | Soil | FVGPNGWKYSRHVVDPAVCDKVKAGDKIDITWDADATMSVEKP |
| Ga0182040_101743422 | 3300016387 | Soil | PSITFTGPNGWKYDRRVADPTVLDKIKVGDQVDITWDTNVTVAVQ |
| Ga0182040_104871871 | 3300016387 | Soil | SASSVSFTGPNGWKYERRVVDPTVLDKLKVGDLVDITWNTDVTVAVQ |
| Ga0182040_110999593 | 3300016387 | Soil | SASSVSFTGPNGWKYERRVVDPTVLDKLKVGDLVTITWNTDVTVAVQ |
| Ga0182040_111205281 | 3300016387 | Soil | ITFTGPNGWKYSRRVVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0182040_114086921 | 3300016387 | Soil | ITFTGPNGWKYSPRAVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0182037_109578502 | 3300016404 | Soil | GWNYSRRVADPTVLDKIKVGDQVDITWDTSVTVAVQ |
| Ga0182039_101672561 | 3300016422 | Soil | ASSITFTGPNGWKYSRRVVDPTVLDKLKVGDQVDITWDTNVTVAVQ |
| Ga0182039_104010603 | 3300016422 | Soil | ASSISFAGPNGWKYSRRVVDPAVLDKVKVGDKVDITSDTNVTVSVQ |
| Ga0163161_102294775 | 3300017792 | Switchgrass Rhizosphere | GVNGWKYSRRVVDPTVFDQVKVGDKVDITWSTDLSVLVE |
| Ga0163161_109457331 | 3300017792 | Switchgrass Rhizosphere | NGWKYSRHVVDPTVFDKVKVGDSVDITWNTDVTVSVQ |
| Ga0163161_111698183 | 3300017792 | Switchgrass Rhizosphere | GVNGWKYSRRVVDPTVFDQVKVGDKVDITWSTNLSVLVE |
| Ga0187814_102602241 | 3300017932 | Freshwater Sediment | PSITFVGPNGWKYSRHIVDPAVLNNLKVGDKVDITWNTDVTVAVQ |
| Ga0190270_108443501 | 3300018469 | Soil | KSASSVTFEGPNGWKYSRRVVDPTVFDKIKVGDKVDIVWNTDLTVSVK |
| Ga0190270_114454952 | 3300018469 | Soil | VGPNGWKYSRKVVDPTVLDNIKIGDRVDITWNTDVTIAVK |
| Ga0190274_113654132 | 3300018476 | Soil | AGSNGWKYTRRVVDPTVFDKVKVGDKVDITWITDITVTVN |
| Ga0173481_108681962 | 3300019356 | Soil | GVNTWKYSRHVVDPAVLEKVKVGDQVDISWNTDLKVTVE |
| Ga0210403_109013101 | 3300020580 | Soil | GPNGWKYSRHIVDPAVFDKLKVGDKVDITWNTDVTVAVQ |
| Ga0210401_115386222 | 3300020583 | Soil | FTGPNGWKYDRRVVDPAVLDKIKPGDKVDITWSTDVTVAVQ |
| Ga0210393_101219731 | 3300021401 | Soil | KSTSSITFVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0210397_105095281 | 3300021403 | Soil | WKYSRHIVDPTVFDKVKVGDKVDITWNTDVTVAVQ |
| Ga0210397_108413171 | 3300021403 | Soil | LDRGTSSISFEGVNGWKYSRRVVDPVVFDQVKVGDKVDITWNTELKISSQ |
| Ga0210387_104864363 | 3300021405 | Soil | ASAITFVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0210390_115922311 | 3300021474 | Soil | SITFVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0210392_107927802 | 3300021475 | Soil | SMTFSGPNGWKYSRHIVDPTVFDKVKVGDKVDITWNTDVTVAVQ |
| Ga0242648_10074113 | 3300022506 | Soil | ITFVGPNGWKYSRHIVDPAVFDKLKVGDKVDITWNTDVTVAVQ |
| Ga0242656_10703601 | 3300022525 | Soil | TFVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0242662_100095071 | 3300022533 | Soil | VGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0242662_100897801 | 3300022533 | Soil | TFVGPNGFKYSRHVVDPAVFDQVKVGDKVDISWRTGVTFSVE |
| Ga0242662_100911891 | 3300022533 | Soil | GPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0242653_10689052 | 3300022712 | Soil | SSITFVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0242654_103485092 | 3300022726 | Soil | ASSITFVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0242654_104365541 | 3300022726 | Soil | FVGPNGWKYSRHIVDPSVIDKVKVGDKVDITWYTDVTVAVQ |
| Ga0207697_102001892 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | SEIDKGSSSMTFVGPNQWKYSRRIVDPNVFDQVKVGDRVDITWGTELVLAVE |
| Ga0207642_111115261 | 3300025899 | Miscanthus Rhizosphere | VGPNQWKYSRRIVDPKVFDQVKVGDRVDITWGTELILAVE |
| Ga0207688_104359972 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | SEIDKGASSMTFVGPNSWKYSRRIVDPMVFDQVKVGDKVDITWSTDVTFAVE |
| Ga0207680_101430914 | 3300025903 | Switchgrass Rhizosphere | SMTFVGANGWKYSRRVVDPKVFDQVKVGDRVDITWSTEVNFAVQ |
| Ga0207645_109292761 | 3300025907 | Miscanthus Rhizosphere | GPNGWKYSRRIVDPTVFDQVKVGDRVDITWSTDAAFVTE |
| Ga0207645_109800611 | 3300025907 | Miscanthus Rhizosphere | IDKAASSMTFVGPNGWKYSRRIVDPTVFDQVKVGDKIDVTWSTDVTYVVQ |
| Ga0207643_106857772 | 3300025908 | Miscanthus Rhizosphere | KSSSSISFAGPNGWKYTRRVVEPAVFDKVKVGDKVDITWNTDVTVAME |
| Ga0207643_107345651 | 3300025908 | Miscanthus Rhizosphere | TFVGPNGWKYSRRIVDPKVFDQVKVGDKVDVTWSTDVTYVVE |
| Ga0207684_104606621 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | FVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0207684_107936802 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ITFVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0207659_101128834 | 3300025926 | Miscanthus Rhizosphere | GPNDWKYSRRIVDPKVFDQVKVGDKVDITWSTDLTIDVN |
| Ga0207701_106125751 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | TFEAPNGWKYSRRVVDPAVFDKVKVGDKVDIIWNTDLTVSVK |
| Ga0207706_108659252 | 3300025933 | Corn Rhizosphere | IDKANSSMTFVGPNDWKYSRRIVDPKVFDQVKVGDKVDITWSTDLTIDVN |
| Ga0207706_112554191 | 3300025933 | Corn Rhizosphere | TFVGPNGWKYSRRIVDPKVFDQVKVGDRVDVTWSTDVTFAVE |
| Ga0207670_112537751 | 3300025936 | Switchgrass Rhizosphere | GPNQWKYSRRIVDPKVFDQVKVGDRVDITWGTELILAVE |
| Ga0207669_101670661 | 3300025937 | Miscanthus Rhizosphere | DRNASSISFEGPNGWKYSRRVVDPMVFAQVNVGDRVDIIWDTDLTVSVQ |
| Ga0207669_111449872 | 3300025937 | Miscanthus Rhizosphere | TFVGPNGWKYSRRIVDPKVFDQVKVGDRVDITWSTDVTYVVQ |
| Ga0207711_112128411 | 3300025941 | Switchgrass Rhizosphere | VGPNGWKYSRRIVDPKVFDQVKVGDRVDITWSTDVTYVVQ |
| Ga0207651_100200321 | 3300025960 | Switchgrass Rhizosphere | DKGSSSMTFVGPNQWKYSRRIVDPNVFDQVKVGDRVDITWGTELVLAVE |
| Ga0207640_118807161 | 3300025981 | Corn Rhizosphere | NASSISFEGPNGWKYSRRVVDPMVFAQVNVGDRVDIIWNTDLAVSVQ |
| Ga0207658_121730942 | 3300025986 | Switchgrass Rhizosphere | DKGTSSMTFVGPNAWKYSRRVVDPTVFDQVKVGDKVDITWSTEVNFAVQ |
| Ga0207677_102833112 | 3300026023 | Miscanthus Rhizosphere | EAPNGWKYSRRVIDPAVFDKVKVGDKVDIIWNTDLTVSVK |
| Ga0207678_108530502 | 3300026067 | Corn Rhizosphere | ATFEAPNGWKYSRRVIDPAVFDKVKVGDKVDIIWNTDLTVSVK |
| Ga0207708_102579641 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | ASSMTFVGPNGWKYSRRIVDPTVFDQVKVGDKIDVTWSTDVTYVVQ |
| Ga0207676_114810271 | 3300026095 | Switchgrass Rhizosphere | FEAPNGWKYSRRVVDPTVFDKVKVGDKVDIIWNTDLTVSVK |
| Ga0207675_1026383962 | 3300026118 | Switchgrass Rhizosphere | SMTFVGPNDWKYSRRIVDPMVFDQVKVGDKVDITWSTDLTIDVN |
| Ga0207683_110422251 | 3300026121 | Miscanthus Rhizosphere | SSMTFVGPNGWKYSRRIVDPTVFDQVKVGDKIDVTWSTDVTYVVQ |
| Ga0209447_100919322 | 3300027701 | Bog Forest Soil | NASSITFVGPNGWKYSRHIVDPDVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0209328_100347204 | 3300027727 | Forest Soil | ASSITFIGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0209811_101240221 | 3300027821 | Surface Soil | SSISFEGPNGWKYSRRVVDPTVFNQVKVGDKVDIIWSTDLTVSVE |
| Ga0207428_104540851 | 3300027907 | Populus Rhizosphere | SFAGPNGFKYTRRVVDPTVFDKVKVGDKVDISWNTDIAVKVN |
| Ga0209526_106914531 | 3300028047 | Forest Soil | TSSITFVGPNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0247824_104369902 | 3300028809 | Soil | VGPNGWKYSRHVVDPAVLEKVKIGDAVDVTWNTDLKVVVE |
| Ga0222749_107529481 | 3300029636 | Soil | NGWKYTRHIVDPTVLDKVKVGDKVDITWNTDVTVAVQ |
| Ga0247643_11946592 | 3300030590 | Soil | VTFEGPNGWKYSRRVVDPTVFDKIKVGDKVDIIWNTDLTVSVK |
| Ga0265460_111923522 | 3300030740 | Soil | PNGWKYSRHIVDPAVLNNLKVGDKVDITWNTDVTVAVQ |
| Ga0075377_116967011 | 3300030844 | Soil | TSSITFAGPNGWKYSRRVVDPTVFDKVKVGDKVDITWNTDVTVAVN |
| Ga0138296_17587193 | 3300030923 | Soil | WKYSRHVADPAVFEKVKVGDQVDVTWNTDLKVSVQ |
| Ga0170834_1028856782 | 3300031057 | Forest Soil | PNGFKYTRRVVDPDVLDKVKVGDQVDITWNTDLTVSVEEPVSEE |
| Ga0170834_1053105473 | 3300031057 | Forest Soil | SAPSITFVGPNGFKYTRRVVDPDVLEKVKVGDQVDITWNTDLKVSVE |
| Ga0307497_105144642 | 3300031226 | Soil | FEAPNGWKYSRRVVDPAVYDKVKVGDKVDIIWNTDLTVSVK |
| Ga0170824_1103764293 | 3300031231 | Forest Soil | PNGFKYSRLVVDPTVFDQVKVGDKVDITWNTDVTFSVDN |
| Ga0170824_1150612583 | 3300031231 | Forest Soil | PNGWKYSRRVVDPTVFDKVKVGDKVDISWNTDVTVKVN |
| Ga0170824_1227426952 | 3300031231 | Forest Soil | FVGPNGFKYSRHVVDPAVFVKVKVGDKVDINWNTDLTISVE |
| Ga0170824_1237167992 | 3300031231 | Forest Soil | PNGWKYSRHIVDPTVLDKVKVGDKVDITWNTDVAVAVQ |
| Ga0170824_1279352822 | 3300031231 | Forest Soil | NGFKYTRRVVDPDVLDKVKVGDQVDITWNTDLKVSVE |
| Ga0170824_1288008691 | 3300031231 | Forest Soil | SGPNGWKYSQHIVDPSVFDKVKVGDKIDITWNTDVTVTVN |
| Ga0170820_128680122 | 3300031446 | Forest Soil | TFVGPNGFKYTRRVVDPDVLEKVKVGDQVDITWNTDLKVSVE |
| Ga0170819_111300372 | 3300031469 | Forest Soil | PNGWKYSRHIVDPTVFDKVKVGDTVDITWNTDITVAVN |
| Ga0170818_1095070223 | 3300031474 | Forest Soil | WKYSRHIVDPTVLDKVKVGDKVDITWNTDVTVAVN |
| Ga0170818_1126875041 | 3300031474 | Forest Soil | SMTFVGPNGWKYSRRIVDPAVFDQVKLGDKVDITWSTDVTYTVQ |
| Ga0170818_1153808083 | 3300031474 | Forest Soil | APSITFVGPNGFKYTRRVVDPDVLDKVKVGDQVDITWNTDVTVAVQ |
| Ga0318516_104305872 | 3300031543 | Soil | APSITFTGPNGWKYSRRVVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0318541_103267341 | 3300031545 | Soil | PSITYTGPNGWKYSRRVVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0318541_105497983 | 3300031545 | Soil | TFTGPNGWKYSRRVVDPTVLDKGKVGDQVDITWDTNVTVAVQ |
| Ga0318538_106262971 | 3300031546 | Soil | RPSGWKYSRRVLDPTVLDKIKVGDQVDITWDTNVTVAVQ |
| Ga0310887_105826661 | 3300031547 | Soil | KGASSMTFVGPNSWKYSRRIVDPMVFDQVKVGDKVDITWSTDVTFAVE |
| Ga0318515_100831953 | 3300031572 | Soil | PNGWKYSRRVVDPSVLDKVKVGDQVDITWDTDVTVAVQ |
| Ga0318572_103541213 | 3300031681 | Soil | TFTGPNGWKYSRRVLDPTVLDKVKVGDQVDITWDTDVAVAVQ |
| Ga0307469_105991674 | 3300031720 | Hardwood Forest Soil | GPNGWKYSRRVVDPAVFDQVKVGDRVDITWNTDLSVSVE |
| Ga0307469_106069174 | 3300031720 | Hardwood Forest Soil | SFVGPNDWKYSRRVVDPTVFDQVKVGDKVDITWNTDLTVAVQ |
| Ga0318500_102952951 | 3300031724 | Soil | TFTGPNGWKYSRRVVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0307468_1003033962 | 3300031740 | Hardwood Forest Soil | WQYSRRVVDPTVFDQVKVGDRIDITWNTDLVVSKE |
| Ga0307468_1019871851 | 3300031740 | Hardwood Forest Soil | SSVSFEAPNGWKYSRRVVDPTVFDKIKVGDKVDITWNTDLTVSVE |
| Ga0318492_108041081 | 3300031748 | Soil | SITFTGPNGWKYSRRVADPTVLDKIKVGDQVDITWDTNVTVAVQ |
| Ga0318509_102158911 | 3300031768 | Soil | GPNGWKYSRHIVDPSVFDKVKVGDKLDITWDADTTLSVEKP |
| Ga0318529_104962602 | 3300031792 | Soil | WKYDRRVADPTVLDKVKVGDQADITWDTNVTVAVQ |
| Ga0318576_106256411 | 3300031796 | Soil | ASSVFTGPNGWKYSRRVVDPTVLDKVKVGDQVDITWDPNVTVSVQ |
| Ga0318523_102532421 | 3300031798 | Soil | FTGPNGWKYSRRVVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0307478_111406011 | 3300031823 | Hardwood Forest Soil | ASSITFVGPNGWKYSRHIVDPTVLDRVKVGDKVDITWNTDVTVAVQ |
| Ga0307478_114875571 | 3300031823 | Hardwood Forest Soil | TFVGPNVWKYSRHIVDPAVFDKLKVGDKVDITWNTDVTVAVQ |
| Ga0318499_103253941 | 3300031832 | Soil | TGPNGWKYDRRVVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0310917_106664882 | 3300031833 | Soil | WKYERRVVDPTVLDKLKVGDQVDITWDTNVTVAVQ |
| Ga0306919_100848364 | 3300031879 | Soil | TGPNGWKYSRRVVDPSVLDKVKVGDQVDITWDTDVTVAVQ |
| Ga0306919_101328793 | 3300031879 | Soil | GPNGWNYSRRVADPTVLDKIKVGDQVDITWDTSVTVAVQ |
| Ga0306919_112159292 | 3300031879 | Soil | GPNGWKYSRRVVDPTVLDKGKVGDQVDITWDTNVTVAVQ |
| Ga0318544_100064631 | 3300031880 | Soil | GPNGWKYDRRAVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0306925_102629064 | 3300031890 | Soil | GPNGWKYDRRVADPTVLDKVKVGDQADITWDTNVTVAVQ |
| Ga0306925_104866733 | 3300031890 | Soil | NGWKYERRVVDPTVLDKLKVGDLVDITWNTDVTVAVQ |
| Ga0306925_104923561 | 3300031890 | Soil | WKYSRRVVDPTVLDKVKVGDQVDITWDPNVTVSVQ |
| Ga0306925_115776002 | 3300031890 | Soil | FTGPNGWKYERRVVDPTVLDKLKVGDQVDITWDTNVTVAVQ |
| Ga0318522_102125551 | 3300031894 | Soil | TGPNGWKYSRRVVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0306923_100767839 | 3300031910 | Soil | TGPNGWKYERRVVDPTVLDKLKVGDLVDITWNTDVTVAVQ |
| Ga0306923_108273141 | 3300031910 | Soil | HLHWSEGPNGWKYSRRVVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0306921_105150223 | 3300031912 | Soil | IDKSASSVSFTGPNGWKYERHVVDPTVLDKLKVDITWDTNVTVAVQ |
| Ga0306921_114928361 | 3300031912 | Soil | FTGPNGWKYDRRVADPTVLDQVKVGDQVDITWDTNVTVAVQ |
| Ga0306921_120120181 | 3300031912 | Soil | PNGWKYERRVVDPTVLDKVKVGDQVDITWDTNVTVAIQ |
| Ga0306921_123838302 | 3300031912 | Soil | NASSITFTGPNGWKYSRRVVDPTVLDKVKVGDQVDITWDTNVTVSVQ |
| Ga0310916_114612281 | 3300031942 | Soil | FTGPNGWKYSRRVVDPTVLDKIKVGDQVDITWDTNVTVAVQ |
| Ga0310913_106801822 | 3300031945 | Soil | GWKYSRRVVDPTVLDKIKVGDLVDITWDTDVTVSVQ |
| Ga0310913_108252771 | 3300031945 | Soil | WKYERRVVDPTVLDKLKVGDLVDITWNTDVTVAVQ |
| Ga0310913_112444472 | 3300031945 | Soil | NGWKYERRVVEPTVLDKVKVGDQVDVTWDTNVTVSVQ |
| Ga0310910_101283864 | 3300031946 | Soil | PNGWKYERRVVDPTVLDKLKVGDLVDITWNTDVTVAVQ |
| Ga0310910_112080951 | 3300031946 | Soil | WKYSRRVVDPTVLDKVKVGDQVDITWDTNVTVSVQ |
| Ga0310909_108732191 | 3300031947 | Soil | RMKYDRRVVDPTVLDKLKVGDQVDITWDTNVTVSVQ |
| Ga0306922_102223941 | 3300032001 | Soil | NGWKYSRRFVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0310911_100577441 | 3300032035 | Soil | GWKYERRVVDPTVLDKLKVGDLVDITWNTDVTVAVQ |
| Ga0318558_103384981 | 3300032044 | Soil | SITFTGPNGWKYGRRVADPTVLDQVKVGDQVDITWDTNVTVAVQ |
| Ga0318575_106446521 | 3300032055 | Soil | TFTGPNGWKYDRRVVDPTVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0318510_101705412 | 3300032064 | Soil | FTRPSGWKYSRRVLDPTVLDKIKVGDQVDITWDTNVTVAVQ |
| Ga0318513_105597241 | 3300032065 | Soil | KSAQSITFTGPNGWKYSRRVVDPAVLDKVKVGDKVDITSDTSVTIAVQ |
| Ga0306924_101591964 | 3300032076 | Soil | MTTTITGIDPAVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0306924_115326421 | 3300032076 | Soil | GPNGWKYERRVVDPTVLDKLKVGDQVDITWDTNVTVAVQ |
| Ga0306924_117564821 | 3300032076 | Soil | NGWKYSRRVVDPTVLDKLKVGDLVDITWDTDVTVAVQ |
| Ga0318577_104455072 | 3300032091 | Soil | NGWKYSRRVVDPTGLEKLKVGDQVDITWDTSVTVAVQ |
| Ga0307471_1031473651 | 3300032180 | Hardwood Forest Soil | SASSMTFVASYGWKYSRRIVDPKVFDQVKVGDKVDITWSTEVNFAVQ |
| Ga0306920_1006973294 | 3300032261 | Soil | FTGPNGWKYERRVVDPTVLDKLKVGDLVDITWNTDVTVAVQ |
| Ga0306920_1015222071 | 3300032261 | Soil | GPNGWKYERRVVDPTVLDKLKVGDLVDITWNTDVTVAVQ |
| Ga0306920_1024102832 | 3300032261 | Soil | FTGPNGWKYSRRVVDPAVLDKVKVGDQVDITWDTNVTVAVQ |
| Ga0310811_107023352 | 3300033475 | Soil | ISFEGVNGWKYSRRVVDPTVFDQVKVGDKVDITWSTDLSVLVE |
| Ga0247830_111675761 | 3300033551 | Soil | KSTSSMTFVGPNGWKYSRHVVDPAVLEKAKVGDAVDVTWNTDLKVVVE |
| Ga0364929_0121323_1_123 | 3300034149 | Sediment | VGPNGWKYSRRVVDPAVFNQVKVGDRVDITWNTDLTVSVN |
| Ga0314793_131603_424_549 | 3300034668 | Soil | FVGPGGWKYSRHVVDPAVFDKVKVGDQVDISWNTDLKVTVE |
| ⦗Top⦘ |