NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F018010

Metagenome / Metatranscriptome Family F018010

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F018010
Family Type Metagenome / Metatranscriptome
Number of Sequences 237
Average Sequence Length 43 residues
Representative Sequence IKCRPLEMRVGEPISTAGLAMRDMEALSATVQKALEDLYYRP
Number of Associated Samples 205
Number of Associated Scaffolds 237

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.62 %
% of genes from short scaffolds (< 2000 bps) 87.76 %
Associated GOLD sequencing projects 188
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.359 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.236 % of family members)
Environment Ontology (ENVO) Unclassified
(20.675 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.055 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.57%    β-sheet: 5.71%    Coil/Unstructured: 65.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 237 Family Scaffolds
PF04545Sigma70_r4 10.97
PF04542Sigma70_r2 8.86
PF03544TonB_C 7.59
PF01401Peptidase_M2 6.75
PF01926MMR_HSR1 4.64
PF01850PIN 3.80
PF02824TGS 3.80
PF08281Sigma70_r4_2 3.38
PF00903Glyoxalase 3.38
PF01712dNK 1.27
PF03412Peptidase_C39 0.84
PF13411MerR_1 0.84
PF12867DinB_2 0.84
PF00248Aldo_ket_red 0.84
PF00117GATase 0.84
PF11734TilS_C 0.42
PF00216Bac_DNA_binding 0.42
PF08241Methyltransf_11 0.42
PF02810SEC-C 0.42
PF10387DUF2442 0.42
PF02875Mur_ligase_C 0.42
PF09535Gmx_para_CXXCG 0.42
PF07973tRNA_SAD 0.42
PF00005ABC_tran 0.42
PF08450SGL 0.42
PF15780ASH 0.42
PF02410RsfS 0.42
PF00156Pribosyltran 0.42
PF00892EamA 0.42
PF00850Hist_deacetyl 0.42
PF00829Ribosomal_L21p 0.42
PF02538Hydantoinase_B 0.42
PF06480FtsH_ext 0.42
PF03551PadR 0.42
PF11146DUF2905 0.42
PF10662PduV-EutP 0.42

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 237 Family Scaffolds
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 8.86
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 8.86
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 8.86
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 8.86
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 7.59
COG1428Deoxyadenosine/deoxycytidine kinaseNucleotide transport and metabolism [F] 1.27
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.84
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 0.84
COG0465ATP-dependent Zn proteasesPosttranslational modification, protein turnover, chaperones [O] 0.42
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.42
COG0799Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunitsTranslation, ribosomal structure and biogenesis [J] 0.42
COG0261Ribosomal protein L21Translation, ribosomal structure and biogenesis [J] 0.42
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.42
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.42
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.42
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.42
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.42


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.36 %
UnclassifiedrootN/A4.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001154|JGI12636J13339_1001202All Organisms → cellular organisms → Bacteria4348Open in IMG/M
3300001593|JGI12635J15846_10313643All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium975Open in IMG/M
3300001661|JGI12053J15887_10473731All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300002245|JGIcombinedJ26739_100307863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1468Open in IMG/M
3300002245|JGIcombinedJ26739_101228218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300002568|C688J35102_118920814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae613Open in IMG/M
3300004092|Ga0062389_101551530All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300004635|Ga0062388_101470282All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300004635|Ga0062388_101874312All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. 5B5617Open in IMG/M
3300005177|Ga0066690_10876086All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300005186|Ga0066676_10344216All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300005343|Ga0070687_100128836All Organisms → cellular organisms → Bacteria1458Open in IMG/M
3300005355|Ga0070671_101643359All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter570Open in IMG/M
3300005356|Ga0070674_100110561All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2017Open in IMG/M
3300005435|Ga0070714_101914822All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300005436|Ga0070713_101049966All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300005437|Ga0070710_10170430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1356Open in IMG/M
3300005450|Ga0066682_10112213All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1719Open in IMG/M
3300005529|Ga0070741_10919324All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005529|Ga0070741_10944522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300005529|Ga0070741_10951457All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300005532|Ga0070739_10070352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2119Open in IMG/M
3300005533|Ga0070734_10742506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae558Open in IMG/M
3300005537|Ga0070730_10729271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae627Open in IMG/M
3300005538|Ga0070731_10495048All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300005538|Ga0070731_11170831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300005541|Ga0070733_10153599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1494Open in IMG/M
3300005542|Ga0070732_10267581All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1024Open in IMG/M
3300005591|Ga0070761_10027435All Organisms → cellular organisms → Bacteria3176Open in IMG/M
3300005610|Ga0070763_10139250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1259Open in IMG/M
3300005610|Ga0070763_10238261All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300005841|Ga0068863_100314540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1520Open in IMG/M
3300005878|Ga0075297_1018073All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae738Open in IMG/M
3300005888|Ga0075289_1067307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300005898|Ga0075276_10093970All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300006028|Ga0070717_11087814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300006047|Ga0075024_100897596All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300006052|Ga0075029_100811439All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300006162|Ga0075030_100004738All Organisms → cellular organisms → Bacteria12304Open in IMG/M
3300006162|Ga0075030_100362821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1155Open in IMG/M
3300006162|Ga0075030_101627249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia505Open in IMG/M
3300006354|Ga0075021_10574555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae718Open in IMG/M
3300006796|Ga0066665_11310677All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300006854|Ga0075425_101138643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae888Open in IMG/M
3300007788|Ga0099795_10058742All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300009093|Ga0105240_11158237All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300009520|Ga0116214_1311861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300009553|Ga0105249_12593725All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300009624|Ga0116105_1051324All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300009635|Ga0116117_1205024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300009665|Ga0116135_1001233All Organisms → cellular organisms → Bacteria13223Open in IMG/M
3300009665|Ga0116135_1108101All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300009700|Ga0116217_10737440All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300009760|Ga0116131_1125737All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300009824|Ga0116219_10133631All Organisms → cellular organisms → Bacteria1440Open in IMG/M
3300010043|Ga0126380_10842999All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300010043|Ga0126380_10999093All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300010046|Ga0126384_11723319All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300010159|Ga0099796_10560269All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300010359|Ga0126376_10796129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium922Open in IMG/M
3300010360|Ga0126372_10171567All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1767Open in IMG/M
3300010360|Ga0126372_11702988All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300010371|Ga0134125_11758580All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300010375|Ga0105239_13259048All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300010376|Ga0126381_101657101All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300010379|Ga0136449_100405285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2417Open in IMG/M
3300010379|Ga0136449_100521188All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2055Open in IMG/M
3300010398|Ga0126383_10078609All Organisms → cellular organisms → Bacteria2871Open in IMG/M
3300010937|Ga0137776_1671193Not Available2113Open in IMG/M
3300011120|Ga0150983_11172949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300012096|Ga0137389_11552157All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300012189|Ga0137388_11439300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300012199|Ga0137383_10863202Not Available661Open in IMG/M
3300012199|Ga0137383_11249264All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300012203|Ga0137399_10117718All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2082Open in IMG/M
3300012208|Ga0137376_10644082All Organisms → cellular organisms → Bacteria → Proteobacteria916Open in IMG/M
3300012211|Ga0137377_10625644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1013Open in IMG/M
3300012212|Ga0150985_121555978All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300012349|Ga0137387_10756409All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium703Open in IMG/M
3300012362|Ga0137361_11306347All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300012924|Ga0137413_11697325All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300012944|Ga0137410_11005945All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300012944|Ga0137410_11838107All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300012955|Ga0164298_10443466Not Available852Open in IMG/M
3300012955|Ga0164298_11100629All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300012986|Ga0164304_11585256All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300013307|Ga0157372_12029992All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300014169|Ga0181531_10223483All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300014489|Ga0182018_10657714All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300014654|Ga0181525_10030307All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3235Open in IMG/M
3300015051|Ga0137414_1235847All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2121Open in IMG/M
3300015242|Ga0137412_10700726All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300015262|Ga0182007_10433750All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300015373|Ga0132257_101386181All Organisms → cellular organisms → Bacteria → Acidobacteria894Open in IMG/M
3300016294|Ga0182041_11852806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300016357|Ga0182032_11893203All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300017823|Ga0187818_10426762All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300017930|Ga0187825_10295245All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300017933|Ga0187801_10267589All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300017943|Ga0187819_10531331All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300017948|Ga0187847_10353554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium805Open in IMG/M
3300017955|Ga0187817_10125255All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300017959|Ga0187779_10489905All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium812Open in IMG/M
3300017961|Ga0187778_10911619All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300017970|Ga0187783_10575543All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300017975|Ga0187782_11525763Not Available527Open in IMG/M
3300017999|Ga0187767_10113974All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300018007|Ga0187805_10493956All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300018012|Ga0187810_10173289All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300018013|Ga0187873_1158449All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300018062|Ga0187784_11581005All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300018062|Ga0187784_11629384All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300018085|Ga0187772_10224662All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300018085|Ga0187772_10724017All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300018086|Ga0187769_10078799All Organisms → cellular organisms → Bacteria2337Open in IMG/M
3300018090|Ga0187770_11750801All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300018468|Ga0066662_11275270All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300018468|Ga0066662_12366119All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300019256|Ga0181508_1256184All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300020579|Ga0210407_10645763All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium823Open in IMG/M
3300020579|Ga0210407_10648117Not Available821Open in IMG/M
3300020579|Ga0210407_10956241All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300020580|Ga0210403_10451746All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300020582|Ga0210395_10281178All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300020582|Ga0210395_10402088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1030Open in IMG/M
3300020583|Ga0210401_11120894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300021168|Ga0210406_10545034All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300021168|Ga0210406_10746913All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium749Open in IMG/M
3300021180|Ga0210396_11005052All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. WH15706Open in IMG/M
3300021181|Ga0210388_10481889All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300021181|Ga0210388_11517566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300021402|Ga0210385_10605801Not Available835Open in IMG/M
3300021403|Ga0210397_10650844All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium808Open in IMG/M
3300021406|Ga0210386_10780850All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300021407|Ga0210383_10856026All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300021407|Ga0210383_11343966All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300021420|Ga0210394_10215105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1678Open in IMG/M
3300021432|Ga0210384_10231718All Organisms → cellular organisms → Bacteria1662Open in IMG/M
3300021433|Ga0210391_11223602All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300021476|Ga0187846_10479398All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300021477|Ga0210398_10063271All Organisms → cellular organisms → Bacteria3019Open in IMG/M
3300021478|Ga0210402_10246964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1647Open in IMG/M
3300021559|Ga0210409_10996272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300022533|Ga0242662_10042732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1141Open in IMG/M
3300022711|Ga0242674_1036169All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300022714|Ga0242671_1077423All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300022850|Ga0224552_1056394All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300023090|Ga0224558_1124518All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300024330|Ga0137417_1497019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1727Open in IMG/M
3300025612|Ga0208691_1006780All Organisms → cellular organisms → Bacteria3139Open in IMG/M
3300025898|Ga0207692_10399084All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium857Open in IMG/M
3300025925|Ga0207650_10013642All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5631Open in IMG/M
3300025926|Ga0207659_11448021All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300025938|Ga0207704_11051699All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300026088|Ga0207641_10455888All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300026095|Ga0207676_11107372All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300026215|Ga0209849_1087522All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300026313|Ga0209761_1046362All Organisms → cellular organisms → Bacteria2467Open in IMG/M
3300026320|Ga0209131_1353308All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300026329|Ga0209375_1189914All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300026551|Ga0209648_10525288All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300026552|Ga0209577_10088809All Organisms → cellular organisms → Bacteria2527Open in IMG/M
3300026557|Ga0179587_10390860All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300027535|Ga0209734_1060451All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300027565|Ga0209219_1015619All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300027568|Ga0208042_1010547All Organisms → cellular organisms → Bacteria2453Open in IMG/M
3300027575|Ga0209525_1133067All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300027590|Ga0209116_1008597Not Available2047Open in IMG/M
3300027625|Ga0208044_1025384All Organisms → cellular organisms → Bacteria2064Open in IMG/M
3300027652|Ga0209007_1016192All Organisms → cellular organisms → Bacteria → Acidobacteria1938Open in IMG/M
3300027652|Ga0209007_1043091All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1151Open in IMG/M
3300027667|Ga0209009_1075363All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300027737|Ga0209038_10104635All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300027842|Ga0209580_10181291All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1041Open in IMG/M
3300027855|Ga0209693_10200722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium982Open in IMG/M
3300027855|Ga0209693_10258887All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300027867|Ga0209167_10358985All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300027869|Ga0209579_10151695All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300027874|Ga0209465_10451703All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300027879|Ga0209169_10239165All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium951Open in IMG/M
3300027898|Ga0209067_10128716All Organisms → cellular organisms → Bacteria → Acidobacteria1332Open in IMG/M
3300027910|Ga0209583_10331870All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300027911|Ga0209698_10771503All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300027915|Ga0209069_10112461All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300028036|Ga0265355_1019380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300028047|Ga0209526_10991814All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300028381|Ga0268264_10033073All Organisms → cellular organisms → Bacteria4245Open in IMG/M
3300028871|Ga0302230_10185579All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M
3300028906|Ga0308309_10640498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium923Open in IMG/M
3300029883|Ga0311327_10619620All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300029943|Ga0311340_10008357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis13540Open in IMG/M
3300029999|Ga0311339_10271847All Organisms → cellular organisms → Bacteria → Acidobacteria1847Open in IMG/M
3300030011|Ga0302270_10550666All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae597Open in IMG/M
3300030045|Ga0302282_1069500All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300030049|Ga0302191_10368754All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300030053|Ga0302177_10729757All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300030057|Ga0302176_10450557All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300030399|Ga0311353_10004578All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis17995Open in IMG/M
3300030399|Ga0311353_10415795All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1207Open in IMG/M
3300030399|Ga0311353_11615491All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300030740|Ga0265460_12389167All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300030741|Ga0265459_12140945All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300031057|Ga0170834_103574673All Organisms → cellular organisms → Bacteria → Acidobacteria1422Open in IMG/M
3300031090|Ga0265760_10011052All Organisms → cellular organisms → Bacteria2579Open in IMG/M
3300031122|Ga0170822_16747418All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300031231|Ga0170824_111363709All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300031446|Ga0170820_13314431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300031474|Ga0170818_108449982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium960Open in IMG/M
3300031521|Ga0311364_11332889All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300031708|Ga0310686_114002872All Organisms → cellular organisms → Bacteria1955Open in IMG/M
3300031708|Ga0310686_115044632All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium862Open in IMG/M
3300031712|Ga0265342_10050879All Organisms → cellular organisms → Bacteria2473Open in IMG/M
3300031715|Ga0307476_10129160All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1804Open in IMG/M
3300031720|Ga0307469_10591110Not Available990Open in IMG/M
3300031753|Ga0307477_10567027All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300031753|Ga0307477_10667754All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300031754|Ga0307475_10422660All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1071Open in IMG/M
3300031754|Ga0307475_11066316All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300031823|Ga0307478_10548591All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300031823|Ga0307478_11524225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300031859|Ga0318527_10502908All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300031962|Ga0307479_10280749All Organisms → cellular organisms → Bacteria1646Open in IMG/M
3300032074|Ga0308173_11007293All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300032180|Ga0307471_103167793Not Available583Open in IMG/M
3300032205|Ga0307472_101222547Not Available719Open in IMG/M
3300032770|Ga0335085_10737528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1091Open in IMG/M
3300032783|Ga0335079_12313132All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300032829|Ga0335070_10915072All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium812Open in IMG/M
3300032895|Ga0335074_10490157All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1281Open in IMG/M
3300032898|Ga0335072_10952472All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300033158|Ga0335077_10119154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3071Open in IMG/M
3300033826|Ga0334847_019213All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300034124|Ga0370483_0304479All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300034163|Ga0370515_0520814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300034282|Ga0370492_0331591All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300034817|Ga0373948_0136551All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.24%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.59%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.91%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil5.49%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.64%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.64%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.22%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.38%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.38%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.95%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.95%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.53%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.11%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.11%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.69%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.27%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.27%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.27%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.27%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.27%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.27%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.84%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.42%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.42%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.42%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.42%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.42%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.42%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.42%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.42%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005878Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104EnvironmentalOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300005898Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022711Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022850Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 1-5EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028036Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030049Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033826Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12636J13339_100120253300001154Forest SoilNTYHIKSRPLEMRIGEPITTAGCSLREMETLSAKVHQAMEDLYYSPPAPRST*
JGI12635J15846_1031364313300001593Forest SoilRVGEPISTAGLKLRDMEALSAKVKKALEDLYYGP*
JGI12053J15887_1047373123300001661Forest SoilMRVGQPISTAGLTIRDLEAVSQKVQKAVEELYYAPSVPSA*
JGIcombinedJ26739_10030786313300002245Forest SoilIKCRPLEMRVGEPISTAGMTMRDLDAASVKVRQEMEKLYYA*
JGIcombinedJ26739_10122821813300002245Forest SoilMDTYHIKCRPLEMRVGKPISTAGLTLRDMETVSAKVHAAVEELYYT*
C688J35102_11892081413300002568SoilMNTYHIKSQPLEMRVGEPISTAGLKGHDMEALSAKVKAAMEELYYPQTL*
Ga0062389_10155153023300004092Bog Forest SoilMDTYHIKCRPLEMRVGEPISTAGMKMRDLEAVSGKVKKAMEDLYYAPATLST*
Ga0062388_10147028223300004635Bog Forest SoilYHIKCRPLEMRVGEPISTAGLTVRDLEAVSGRVKTAMETLYYRPNDPTPMSF*
Ga0062388_10187431223300004635Bog Forest SoilPLEMRVGEPISTAGLTMRDMDAVSEKVRKAMEDLYYAQSPVQ*
Ga0066690_1087608623300005177SoilYHIKCRPLEMRVGEPISTTGLTVKDLPALSDRVQKAVEALYYRP*
Ga0066676_1034421623300005186SoilNTYHIKSRPLEMRVGEPISTAGYTLHDINTVSAKVQKAVEGLYYNRSET*
Ga0070687_10012883613300005343Switchgrass RhizosphereRLEMRVGKPIVTAGLAMTDMEALSSRVQKAVEEMYYDTRC*
Ga0070671_10164335913300005355Switchgrass RhizosphereMDTYHIKCRPLEMRVGQPISTAGYALRNMTELSDKVHKAVEDLYYQPVASA*
Ga0070674_10011056143300005356Miscanthus RhizosphereTYHIKCRPLEMRVGQPISTAEYTLRNMEALSDKVHQAVEDLYKRG*
Ga0070714_10191482213300005435Agricultural SoilTYHIKCRPLEMRVGEPISTTGLTMKDLQALSDRVQKAVEDLYYREEKS*
Ga0070713_10104996623300005436Corn, Switchgrass And Miscanthus RhizosphereCRPLEMRVGKPISTVGLTLRDLEALSAKVQKAVEDLYYRA*
Ga0070710_1017043033300005437Corn, Switchgrass And Miscanthus RhizosphereLLPMNTYHIKCRPLEMRVGEPIATTGLTMKDLESLSARVQKAVEDLYYG*
Ga0066682_1011221313300005450SoilIKPRPLEMRVGEPISTAGLKLRDMEALSAKVKKALEDLYYDH*
Ga0070741_1091932413300005529Surface SoilPLEMRVGEPISTTGLKLHDMEALSAKVQKAMEELYYAGRIPT*
Ga0070741_1094452223300005529Surface SoilIKCRPLEMRVGEPISTTGLTMKDLQALSERVQKAVEDLYYQP*
Ga0070741_1095145713300005529Surface SoilEMRVGEPISTTGLKLHDMEALSAKVQKAMEELYYAGRIPT*
Ga0070739_1007035243300005532Surface SoilDTYHIKSRPLEMRVGDPISTAGLGLRDMDQLSANVQHELESLYSKR*
Ga0070734_1074250623300005533Surface SoilHIKCRPLEMRVGEPISTAGLGMRDLEALSAKVQKAVEDLYYAGHEAPPSNAY*
Ga0070730_1072927123300005537Surface SoilSRPLEMRVGRPISTAHLKPRDMEMLSAQVKSAMEELYYG*
Ga0070731_1049504823300005538Surface SoilDTYHIKSRALEMRVGAPISTTGLTMKDLAVLSERVQKALEDLYYRPA*
Ga0070731_1117083113300005538Surface SoilYHIKCRPLEMRVGEPIATTGLTMKDLESLSARVQKAVEDLYYG*
Ga0070733_1015359933300005541Surface SoilYHIKCRPLEMRVGQPISTAGMTMRDMEVVSAKVKKQLEDLYYAPAPVSA*
Ga0070732_1026758123300005542Surface SoilKCRPLEMRVGEPIATAGLAVRDLEAVSGTVQRALEKLYYEN*
Ga0070761_1002743513300005591SoilISTVGLTMRDMEAVSAKVKKAMEDLYYAPALPST*
Ga0070763_1013925033300005610SoilCRPLEMRVGQPISTTGLTMRDLEAVSAKVRKAVEDLYYPQGEASA*
Ga0070763_1023826113300005610SoilHIKCRPLEMRVGEPISTAGLAGKDLEALSAKVQKAVEDLYYA*
Ga0068863_10031454013300005841Switchgrass RhizosphereCRPLEMRVGEPISTKGLKLHEMETLSAKVQKAVEDLYYSQSQLT*
Ga0075297_101807323300005878Rice Paddy SoilNTYHIKCRPLEMRVGQAISTVDYTLRNMEELSDRVHKAVEDLYKSS*
Ga0075289_106730713300005888Rice Paddy SoilHIKCRPVEMRVGEPISTTGLHMRDLSALSAKVQKAVEDLYYQP*
Ga0075276_1009397023300005898Rice Paddy SoilLEMRVGEPISTAGMKGHDIEKLSAQVQGAVEELYYAGRDS*
Ga0070717_1108781413300006028Corn, Switchgrass And Miscanthus RhizosphereYHIKCRPLEMRVGAPISTAGLTLRDLEGVSAKAQKAIEDLYYA*
Ga0075024_10089759623300006047WatershedsYHIKCRPLEMRVGGPISTAGLTMRDLETLSNRVQAELEKLYNAQGASRE*
Ga0075029_10081143923300006052WatershedsPLEMRVGEPISTVGMTARDLEALSSQVQKALEALYYRP*
Ga0075030_100004738143300006162WatershedsYHIKCRPLEMRVGEPISTAGMTVRDLEVISNKVQKALEDLYYQA*
Ga0075030_10036282113300006162WatershedsYHIKCRPLEMRVGEPIPTAGLTGRDLEALSAKVQKELEKLYYAGSNHAA*
Ga0075030_10162724913300006162WatershedsPLEMRVGEPISTVGLTLRDLEAFSAKVQKAVEELYYR*
Ga0075021_1057455513300006354WatershedsTFELLPMNTYHIKSRPLEMRVGQPISTSGYTLRTMDALSDRVHRAVEDLYKGGFV*
Ga0066665_1131067723300006796SoilLLPLNTLHIKCRPLERRVGEPISTAGLTLDDMDQLSENVQKAMEELSCANEST*
Ga0075425_10113864323300006854Populus RhizospherePLEMRVGKPISTVGLTLRDMESLSAKVQRAVEEMYYEGRVENN*
Ga0099795_1005874213300007788Vadose Zone SoilPLEMRVGEPISTTGLTLRDVEMVSAKARKAIEDLYYAESPVSA*
Ga0105240_1115823713300009093Corn RhizosphereMNTYHIKCQPLEMRVGEPISTTGLSLREMESLSAKVQKALEDLYYR*
Ga0116214_131186123300009520Peatlands SoilQMRVGEPISTTGLTMKDLEALSAKVQKAVEDLYYA*
Ga0105249_1259372513300009553Switchgrass RhizosphereHIKCRPLEMRVGQPISTAGYSLRNMEALSDRVHKAVEDLYKGG*
Ga0116105_105132413300009624PeatlandKCRPLEMRVGEPISTTGMTMRDLEAVSAKVKKALEDLYYAESPVPA*
Ga0116117_120502413300009635PeatlandPLEMRVGKPISTTGLTMRDLEALSARVQKAVEELYYAPAS*
Ga0116135_1001233133300009665PeatlandISTVGLKMRDLEAVSAKVQKAVEDLYYPQSPAGA*
Ga0116135_110810113300009665PeatlandTYHIKCRPLEMRVGEPISTTGMTMRDLEAVSAKVKKALEDLYYAESPVPA*
Ga0116217_1073744023300009700Peatlands SoilPISTARMTMRDLEAVSARVKKAIEDLYYPEAPPTC*
Ga0116131_112573713300009760PeatlandMRVGEPISTVGLKMRDLEAVSAKVQKAVEDLYYPQSPAGA*
Ga0116219_1013363113300009824Peatlands SoilKCRPLEMRVGAPISTAGLTMKDLESLSAKVQKEMESLYYAERQ*
Ga0126380_1084299913300010043Tropical Forest SoilMDTFHIKCRPLEMRVGEPIPSAGLTLRDMEALSARVQRALEDLYYRPAFKS*
Ga0126380_1099909323300010043Tropical Forest SoilRVGEPIPTAGLALRDMETLSTKVQKALEDLYYQP*
Ga0126384_1172331913300010046Tropical Forest SoilRPLEMRVGQPISTAGYGPREMEELSANVKKAMEDLYYS*
Ga0099796_1056026913300010159Vadose Zone SoilPISTAGLTLRDLEAVSAKARKAIEDLYYAESPVSA*
Ga0126376_1079612923300010359Tropical Forest SoilHIKSRPLEMRLGAAIATAGLTMKDLPALSARVEKALEDLYYQE*
Ga0126372_1017156713300010360Tropical Forest SoilKCRPLEMRVGDPISTAGLSGHDMEALSARVQKAMEGLFHQRA*
Ga0126372_1170298823300010360Tropical Forest SoilMNTYHIKCQPLEMRVGEPISTTGLTMRDMETVSTRVQKAIEDLYYRP*
Ga0134125_1175858013300010371Terrestrial SoilPRPLEMRVGKPISTAGMTTRDMEALSAKVQSAVEEMYYDNRP*
Ga0105239_1325904813300010375Corn RhizosphereYHIKPRPLEMRVGKPISTEGLTLRDMEALSARVQRSVEEMYYEGKGENH*
Ga0126381_10165710113300010376Tropical Forest SoilMRVGQPIPTAGLTLRDMEALSAQVQRALEDLYYRSDFKS*
Ga0136449_10040528513300010379Peatlands SoilPLQMRVGEPISTTGLTMKDLEALSAKVQKAVENLYYRSDS*
Ga0136449_10052118843300010379Peatlands SoilPMNTYHIKCRPLEMRVGEPISTTGMTMRGMEAVSAKVKKAMEDLYYAGTTP*
Ga0126383_1007860943300010398Tropical Forest SoilHIKCQPLEMRVGKPISTTGLKLHDMTALSANVQKALEELYYTE*
Ga0137776_167119313300010937SedimentYHIKCRPLEMRLGQPISVAGLKGRDLEALSARVQKAMEELHDRPSALPA*
Ga0150983_1117294923300011120Forest SoilNTYHIKCRPLGMRVGEPISTAGLTMRDMEVVSAKVKKAMEDLYYAPTTLST*
Ga0137389_1155215713300012096Vadose Zone SoilPLEMRVGEPIATAGLTMRDLEGVSAKAQKAIEDLYYAESPVSA*
Ga0137388_1143930013300012189Vadose Zone SoilTYHIKCRPLEMRVGRPISTAGYTLRNMEELSDRVHRAVEDLYLKPVVSG*
Ga0137383_1086320213300012199Vadose Zone SoilMNTYHIKCRPLEMRVGAPISTAGLTGHDMQALSEKVHQAVFDLYNRK*
Ga0137383_1124926413300012199Vadose Zone SoilIKPRSLEMRVGEPIATTGLNLQNMEALSAEVQQALEAMYCDR*
Ga0137399_1011771813300012203Vadose Zone SoilTYHIKCRPLEMRVGQAISTAGYTLRNMEALLDKVHRAMEDLYLKPVVSD*
Ga0137376_1064408233300012208Vadose Zone SoilDTYHIKCRPLEMRIGKPIPVAGLTMNNLDQLSANVHRALEALYYNQPS*
Ga0137377_1062564413300012211Vadose Zone SoilPLEMRVGEPISTAGLKMKDLEALSAEVRKAVEELYYP*
Ga0150985_12155597823300012212Avena Fatua RhizosphereLEMRVGKPIPTAGLDTKDMGQLSAKLQRAVEEMYYDGH*
Ga0137387_1075640913300012349Vadose Zone SoilNTYHIKPRSLEMRVGHPIATAGLTLRDLEQLSAKVQKEMKGLYEAG*
Ga0137361_1130634713300012362Vadose Zone SoilLNTYHIKCRPLEMRVGEPISTAGLLGHDMDALSARVQKAVEDLNDGRA*
Ga0137413_1169732523300012924Vadose Zone SoilTYHIKSRPLEMRVGQPISTAGMTLRDTEAVSARVRAAIEGLYKNG*
Ga0137410_1100594523300012944Vadose Zone SoilVGEPISTAGLTLHDMETLSGKVQKAMEDLYYRVSA*
Ga0137410_1183810723300012944Vadose Zone SoilYHIKSRPLEFRVGDPIPTAGLKMADLEALSGRVQRALEELYYAPTPEAP*
Ga0164298_1044346613300012955SoilFDLLPMNTYDIKSQALEMRVGAPISTAGLSLRDMDGVSSKVREAMLELYAAPRER*
Ga0164298_1110062923300012955SoilKCRPLEMRVGEPISTTGLTMKDLQALSERVQKAVEDLYYRP*
Ga0164304_1158525613300012986SoilRPLEMRIGAPISTAGLTGHDMQALSEKVHQAVTNLYSRK*
Ga0157372_1202999223300013307Corn RhizospherePMNTYHIKRRPLEMRVGKPISTGGYTLRNMDELSDRVHQAVEDLYKGRPL*
Ga0181531_1022348313300014169BogPLEMRVGEPISTAGLTMRDMEAVSAKVKKAMEDLYYAPASLSI*
Ga0182018_1065771423300014489PalsaEMRVGKPISTAGLAPRDLENLSGKVQKELEALYYASRSPQ*
Ga0181525_1003030743300014654BogCRPLEMRVGEPISTVGLTMRDMEAVSAKVRKAMEDLYYSEGSS*
Ga0137414_123584743300015051Vadose Zone SoilMNTYHIKCQPLEMRVGEPISTTGLTLHGMEALSGKVQKALEDLYYHDSAE*
Ga0137412_1070072613300015242Vadose Zone SoilGEPISTTGLTLRDVEMVSAKARKAIEDLYYAESPVSA*
Ga0182007_1043375013300015262RhizosphereMNTYHIKCRPLEMRVGQPISTTGLTMKDLQALSDRVQKAVEDLYYREEKS*
Ga0132257_10138618113300015373Arabidopsis RhizosphereIKCRPLEMRVGQPISTGGYTLRNMGELADRVLEAVEDLHAKPVSD*
Ga0182041_1185280613300016294SoilTYHIKCRPLEMRVGEPISTAALRLRDMESLSTKVQRALEDLYYRP
Ga0182032_1189320313300016357SoilCRPLEMRVGEPISTIGLTLRDLPALSARVQKSLEDLYYHP
Ga0187818_1042676213300017823Freshwater SedimentQPISTTGMTMRDLEAVSAKVLKAVEDLYYASSPLPA
Ga0187825_1029524513300017930Freshwater SedimentIKCWPLEMRVGDPISTQGLTGRDLEGLSSRVQAAVEKLYYSDGSNST
Ga0187801_1026758913300017933Freshwater SedimentTYHIKCHPLAMRVGEPIPTAGLTTRDLGALSNQVKAEMERLYYGK
Ga0187819_1053133113300017943Freshwater SedimentMRVGDPISTTGLTMRDLEAVSAKVRKAMSDLYYAPASQSA
Ga0187847_1035355423300017948PeatlandRPLEMRVGEPISTAGMTMRDLEAVSAKVMQELQRLYYA
Ga0187817_1012525523300017955Freshwater SedimentHIKSRPLEMRVGEPISTAGYDLRHMEELSAKVQKAMEQLYSEGR
Ga0187779_1048990513300017959Tropical PeatlandIKCRPLEMRVGEPISTAGMTGRDLGAVSTKVQKAVEDLYYAA
Ga0187778_1091161913300017961Tropical PeatlandCRPLEMRVGEPISTAGLTGRDLETVSNQVRAAMERLYYSSGAVSE
Ga0187783_1057554313300017970Tropical PeatlandEMRVGEPISTAGLTMRDLEALSARVQKAVEELYYR
Ga0187782_1152576323300017975Tropical PeatlandRPLEMRVGEPIPTAGLTTRDLEVLSNRVKTAMENLYYSEGSTS
Ga0187767_1011397413300017999Tropical PeatlandPISTAGLTLRDMEALSSKVKTELEALYYQPSSATV
Ga0187805_1049395613300018007Freshwater SedimentMRVGCPISTAGYGMRDLEALSEKVHQAMEELYYQPKPTQTA
Ga0187810_1017328913300018012Freshwater SedimentIKCRPLEMRVGEPISTAGLAMRDMEALSATVQKALEDLYYRP
Ga0187873_115844923300018013PeatlandRPLEMRVGEPISTAGMTMRDLETVSVKVKKAMEDLYYAQDPVQ
Ga0187784_1158100523300018062Tropical PeatlandEMRVGEPISTEGMAMRDLEALSAKVQKAVEELYYRS
Ga0187784_1162938423300018062Tropical PeatlandSRPLEMRVGEPISTAGLTLDDMGALSDRVRKAMEDLCYAGQPPRTS
Ga0187772_1022466233300018085Tropical PeatlandRVGEPISTAGLTTRDLEALSARVQKAMEDLYYSPFPVRS
Ga0187772_1072401723300018085Tropical PeatlandYHIKSRPLEMRVGRPISTAGLTLEDMGALSNRVRTAMEDLYDAGRSARTP
Ga0187769_1007879913300018086Tropical PeatlandPLEMRVGQPIPTAGLTTRDLEGLSNRVKAAMENLYYSEGCGAEEVC
Ga0187770_1175080113300018090Tropical PeatlandMNTYHIKSRPLEMRIGRPISTAGLTLEDMGALSNRVRTAMEDLYDAGRSARTP
Ga0066662_1127527023300018468Grasslands SoilRVGEPISTAGYKPHDVAALSAKVQKAVEGLYYNRSET
Ga0066662_1236611913300018468Grasslands SoilTYHVKCRPVEMRVGEPISTTGMTTHNIDALAARVQQEVEKLYYGASEPRH
Ga0181508_125618413300019256PeatlandLEMRVGEPISTTGLTMRDLDALSTQVQAALEELYYRA
Ga0210407_1064576333300020579SoilLLPMNTYHIKSRPLEMRVGAPISTAGLKGRDLQKLSARVQKAVEDLYYRA
Ga0210407_1064811723300020579SoilTYHIKSRPLEMRVGEPISTASYGPREMEQLSARVKKAMEELYYS
Ga0210407_1095624123300020579SoilMNTYHIKSRRLEMRVGEPIPTAGCSLDHMETLSENVHKAMEELYSAPGEVVLREKT
Ga0210403_1045174633300020580SoilYHIKCRPLEMRVGDPISTAGLTMRDLEGVSEKVRRAMEELYYRA
Ga0210395_1028117813300020582SoilMNTYHIKSRPLEMRVGEPISTASYGPREMEQLSAKVKKAMEDLYYS
Ga0210395_1040208813300020582SoilKCRPLEMRVGEPISTTGLTMKDLESLSARVQKAVEDLYYR
Ga0210401_1112089413300020583SoilHIKCRPLEMRVGEPISTAGLTMRDMEVVSAKVKKAMEDLYYAPTTLPN
Ga0210406_1054503413300021168SoilLPMNTYHIKCRPLEMRVGKPISTAGRSLRDMDAISAEVKQAMEALARS
Ga0210406_1074691313300021168SoilMRVGEPISTAGLTIRDMETLSAKVQAALEDLYYRP
Ga0210396_1100505213300021180SoilKCRPLEMRVGEPISTAGLKMKDMEAVSEKVRKAMEELYYRA
Ga0210388_1048188923300021181SoilNTYHIKCRPLEMRVGEPISTAGLTMRDMEAVSARVKKAMEDLYYAPTTLSTQICP
Ga0210388_1151756613300021181SoilHIKCRPLEMRVGEPISTAGLTIRDMEAVSAKVRKAIEDLYYDA
Ga0210385_1060580113300021402SoilPISTAGLTMRDLEAVSAKVKKALEDLYYATASAPA
Ga0210397_1065084423300021403SoilLEMRVGEPISTNGLKARDLQMLSAQVQKAVEDLYYKK
Ga0210386_1078085013300021406SoilEMRVGEPISTTGMTVRDLEGVSAKVRKAIEDLYYAKSPDPV
Ga0210383_1085602623300021407SoilPISTAGLTIRDMEAVSEKVRKAMEDLYYADRAAPA
Ga0210383_1134396613300021407SoilEMRVGEPISTAGMTMRDLEAVSARVKKAMEDLYYAA
Ga0210394_1021510533300021420SoilCRPLEMRVGEPISTVGLKMKDLEVVSAKVRKAMEDLYYQK
Ga0210384_1023171813300021432SoilLEMRVGDPISAAGLTMRDLEGVSEKVRRAMEELYYAPASPSA
Ga0210391_1122360223300021433SoilCRPLEMRVGEPISTAGLTLRDLETLSERVKKAVEELYYRP
Ga0187846_1047939813300021476BiofilmEPIATAGLKLDDMEALSARVQKAMEDLYCRGGLAQST
Ga0210398_1006327133300021477SoilEMRVGEPISTTGMTVRDLETVSAKVRKAIEDLYYAKSPDPV
Ga0210402_1024696433300021478SoilKCRPLEMRVGEPISTAGLTGRDLESLSARVQKAMEDLYYRI
Ga0210409_1099627213300021559SoilNTYHIKCRPLEMRVGQPISTSGYTLRNMDVLSDRVHKAVVDLHERRVQ
Ga0242662_1004273213300022533SoilIKCRPLEMRVGEPISTTGLTMKDLESLSARVQKAVQDLYYRP
Ga0242674_103616913300022711SoilTYHIKCRPLEMRVGEPISTAGMTMRDLEAASVKVRQEMEKLYYA
Ga0242671_107742313300022714SoilHIKCRPLEMRVGEPISTAGLTGKDLETLSARVQKAVEDLYYAPQ
Ga0224552_105639413300022850SoilEMRVGEPIPTTGMTMRDLEAVSEKVKKEMEKLYYEA
Ga0224558_112451813300023090SoilPISTVGLKMRDLEAVSAKVQKAVEDLYYPQSPAGA
Ga0137417_149701913300024330Vadose Zone SoilMNTYHIKSQPLEMRVGDPISTAGLTGHDMQKLSEKVQKAVSDLYYQASQAKDPRQP
Ga0208691_100678013300025612PeatlandLEMRVGEPISTTGLTMRDLEALSARVQKAVEELYYAPAS
Ga0207692_1039908413300025898Corn, Switchgrass And Miscanthus RhizosphereHVKPRPLEMRVGKPISTQGLTLRDMDELSRRVQTAMEEMYYSA
Ga0207650_1001364273300025925Switchgrass RhizosphereMRVGKPIVTAGLAMTDMEALSSRVQKAVEEMYYDTRC
Ga0207659_1144802123300025926Miscanthus RhizosphereWLEMRVGKPIVTAGLAMTDMEALSSRVQKAVEEMYYDTRC
Ga0207704_1105169913300025938Miscanthus RhizosphereRRLEMRVGKPIVTAGLAMTDMEALSSRVQKAVEEMYYDTRC
Ga0207641_1045588823300026088Switchgrass RhizosphereCRPLEMRVGEPISTKGLKLHEMETLSAKVQKAVEDLYYSQSQLT
Ga0207676_1110737223300026095Switchgrass RhizosphereTYHIKCQPLQMRVGEPISTAGLKLQDMEDLSARVQRAMEDL
Ga0209849_108752223300026215SoilVEPISTAGCTRRDMDTLSAEVQAAMEELYYRAKPANPA
Ga0209761_104636243300026313Grasslands SoilMNTYHIKSRPLEMRVGEPISTAGYTLHDINTVSAKVQKAVEGLYYNRSET
Ga0209131_135330813300026320Grasslands SoilMNTYHIKCRPLEMRVGEPISTTGLKMRDLEAVSAKVRKAMEDLYYAESPVPE
Ga0209375_118991423300026329SoilIKPRPLEMRVGEPISTAGLKLRDMEALSAKVKKALEDLYYDH
Ga0209648_1052528823300026551Grasslands SoilYHIKCRPLEMRVGEPISTAGLKMRDTEAVSEKVRKAMEDLYYQS
Ga0209577_1008880913300026552SoilVGEPISTAVLTLDEMDTLSAKVQSAMEELYYANETP
Ga0179587_1039086013300026557Vadose Zone SoilDTYHIKCRPLKMRVGRPISTSGYTLRNMEELSDRVHDAVVKLYTKSVAGE
Ga0209734_106045113300027535Forest SoilMNTYHIKCRPLEMRVGQPISTSGYTLRNMDALSERVHKAVVDLHERRVQ
Ga0209219_101561913300027565Forest SoilALEMRVGEPISTTGLKGRDVQTLSAKVQKAVEDLYYRPV
Ga0208042_101054713300027568Peatlands SoilPLEMRVGEPISTAGLTMRDLEALSAKVQAALEELYYRR
Ga0209525_113306723300027575Forest SoilPLEMRVGEPISTAGMTMRDLDAASVKVRQEMEKLYYA
Ga0209116_100859713300027590Forest SoilTYHIKCRPLEMRVGEPISTAGLKMRDMEAVSAKVKKELEDLYSAESRVQE
Ga0208044_102538433300027625Peatlands SoilMRVGAPISTAGLTMKDLESLSAKVQKEMESLYYAERQ
Ga0209007_101619233300027652Forest SoilLLPMNTYHIKSRPLEMRVGAPISTAGLKGHDLQKLSARVQTAVEDLYYRA
Ga0209007_104309113300027652Forest SoilLLPMNTYHIKSRPLEMRVGAPISTAGLKGHDLQKLSARVQKAVEDLYYRA
Ga0209009_107536313300027667Forest SoilTYHIKCRPLEMRVGQPISTAGYSLRNMEELSDKVHRAVEDLYLKPVVSD
Ga0209038_1010463523300027737Bog Forest SoilMRVGEPISTAGMTMRDLEAVSARVKKAMEDLYYAPSPSPA
Ga0209580_1018129113300027842Surface SoilKCRPLEMRVGEPIATAGLAVRDLEAVSGTVQRALEKLYYEN
Ga0209693_1020072213300027855SoilHIKCRPLEMRVGEPISTAGLAGKDLEALSAKVQKAVEDLYYA
Ga0209693_1025888733300027855SoilCRPLEMRVGQPISTTGLTMRDLEAVSAKVRKAVEDLYYPQGEASA
Ga0209167_1035898523300027867Surface SoilYHIKCRPLEMRVGEPISTAGLTLRDLEAFSAKVQKAVEDLYYS
Ga0209579_1015169523300027869Surface SoilEMRVGEPISTAGLTMRDLESLSGRVQKAVEDLYHAPVSQPA
Ga0209465_1045170313300027874Tropical Forest SoilLPMNTYHIKSRPLEMRVGAPIATAGLTMKDLPALSARVEKALEDLYYQE
Ga0209169_1023916523300027879SoilMRVGEPISTAGMTMRDLEAVSGKVMQELQSLYYQA
Ga0209067_1012871633300027898WatershedsPMNTYHIKCRPLEMRVGAPISTAGLTMKDLESLSARVQKAVEDLYYN
Ga0209583_1033187013300027910WatershedsIKCRQLEMRVGEPISTAGLTGHDMQALSNRVQKAVEDLYESGSSVTNSPTSVPV
Ga0209698_1077150313300027911WatershedsYHIKCRPLEMRVGEPISTAGMTVRDLEVISNKVQKALEDLYYQA
Ga0209069_1011246143300027915WatershedsTYHIKSRPLEMRVGHPISTSGYTVRNMDALSDRVHAAVEDLYKSGFE
Ga0265355_101938023300028036RhizosphereKCRPLEMRVGEPISTAGMTMRDLDAASVKVRQEMEKLYYA
Ga0209526_1099181413300028047Forest SoilEPISTAGMTMRDLEAVSARVKKAMEELYYAPASQPA
Ga0268264_1003307353300028381Switchgrass RhizosphereIKPRRLEMRVGKPIVTAGLAMTDMEALSSRVQKAVEEMYYDTRC
Ga0302230_1018557923300028871PalsaVGEPISTAGLTMRDMDAVSAKVHKAIEDLYYAESPVPL
Ga0308309_1064049813300028906SoilNTYHIKCRPLEMRVGEPISTAGMTMRDLEAVSGKVMQELQSLYYQA
Ga0311327_1061962023300029883BogRPLEMRVGEPIPTTGMTMRDLEAVSEKVKKEMEKLYYEA
Ga0311340_10008357143300029943PalsaRVGEPISTAGLTMRDMDAVSAKVHKAIEDLYYAESPASA
Ga0311339_1027184733300029999PalsaIKCRPLEMRVGEPISTAGLTLRDMETLSARVQKAVEELYYQP
Ga0302270_1055066613300030011BogYHIKCRPLEMRVGEPIPTTGMTMRDLEAVSEKVKKEMEKLYYEA
Ga0302282_106950013300030045FenCRPLEMRVGAPISTVGLTMRDMDAVSEKVRKAMEELYYRA
Ga0302191_1036875413300030049BogIKCRPLEMRVGAPISTVGLTMRDMDAVSEKVRKAMEELYYRA
Ga0302177_1072975713300030053PalsaRPLEMRVGEPISTAGLTIRDMEALSAKVQKALEDLYSR
Ga0302176_1045055723300030057PalsaEPISTVGLKMKDLEAVSARVRKAMEDLYYAESPVPA
Ga0311353_10004578173300030399PalsaEMRVGEPISTAGLTMRDMDAVSAKVHKAIEDLYYAESPASA
Ga0311353_1041579533300030399PalsaLEMRVGEPIPTKGLTVRDLEALSQRVKTAMEKLYYAP
Ga0311353_1161549123300030399PalsaRPLEMRVGKPISTAGLTLRDMETVSAKVHAAVEELYYA
Ga0265460_1238916713300030740SoilPLEMRVGEPISTTGMTMRDLERVSGKVRTELERLYYQE
Ga0265459_1214094533300030741SoilCRPLEMRVGEPISTVGLTMRDMEAVSAKVKKAMEDLYYAPALPST
Ga0170834_10357467313300031057Forest SoilHIKCRPLEMRVGEPISTAGLKLKDLEALSAKVQKAVEDLYYR
Ga0265760_1001105213300031090SoilCRPLEMRVGEPISTAGLTMRDMEAVSAKVKKAMEDLYYAPTALST
Ga0170822_1674741813300031122Forest SoilIKCRPLEMRVGEPISTTGLTLRDLEALSGRVKKAIEDLYYAS
Ga0170824_11136370913300031231Forest SoilHIKCRPLEMRVGEPISTTGLTLRDLEALSGRVKKAIEDLYYAS
Ga0302323_10289243313300031232FenYHIKSRPLEMRVGEPISTAGLTLRDMEAVSAKVKAAIDDLRAAPSQQLQS
Ga0170820_1331443113300031446Forest SoilKSRPIEMRVGEPIATAGLTLRDMDALSAKVQREMEGMYYAASDSGGN
Ga0170818_10844998213300031474Forest SoilELLPMDTYHIKSRPLEMRVGAPIATAGLTLREMDALSARVQKEMEGMYYHTSDSAII
Ga0311364_1133288913300031521FenHIKCRPLEMRVGEPISTAGRTMRDLEAVSNQVEAAMKKLYYGS
Ga0310686_11400287233300031708SoilEMRVGEPISTAGLKMKDMEEVSAKVRKAMEDLYYAGSPVPA
Ga0310686_11504463223300031708SoilHIKCRPLEMRVGEPISTAGLTMRDTEAVSEKVKKAMEELYYAPSR
Ga0265342_1005087913300031712RhizosphereGEPISTVGLTMRDLEALSARVQAAVEDLYYSRLPASK
Ga0307476_1012916013300031715Hardwood Forest SoilHIKCRPLEMRVGEPISTVGLKMRDLEAVSEKVRKAMEELYYGAAWPSV
Ga0307469_1059111023300031720Hardwood Forest SoilTYHIKCRPLEMRVGKPISTAGLSGHDMNALSARVQKAVEDLYDGRAETT
Ga0307477_1056702723300031753Hardwood Forest SoilKCRPLEMRVGEPISTAGLAMRDLEALSSKVQKAVEDLYYPENASSMI
Ga0307477_1066775413300031753Hardwood Forest SoilVGDPISTAGLTMRDTEAVSEKVHKAIEDLYYEPSTLSASP
Ga0307475_1042266013300031754Hardwood Forest SoilPLEMRVGEPISTEGLKVRDLAALSARVQKAVEDLYYKPS
Ga0307475_1106631623300031754Hardwood Forest SoilPVSTAGLSMRDLEAVSAKVHKAMEDLYYADGRTST
Ga0307478_1054859133300031823Hardwood Forest SoilHIKPRPLEMRVGEPISTTGLTLRDTEAVSAKVQEALEDLYYADPALAPLKELAP
Ga0307478_1152422513300031823Hardwood Forest SoilKCRPLEMRVGEPISTSGLTMRDMEAVSEKVKKAMEDLYYQA
Ga0318527_1050290813300031859SoilNTYHIKCQPLEMRVGAPISTEGLSGHDMQALSDKVQKAVTDLYAAS
Ga0307479_1028074913300031962Hardwood Forest SoilIKSRPLEMRVGEPISTAGLSGHDMQALSEKVQKAVSDLYYGAPKSRPRQNT
Ga0308173_1100729313300032074SoilHIKCRPLQMRVGEPISTTGLTMKDLPALSDRVQKAVEALYYRP
Ga0307471_10316779323300032180Hardwood Forest SoilTYHIKCHPLEMRVGSPISTAGLTGHDMQALSDKVQKAVSDLYYSHGS
Ga0307472_10122254713300032205Hardwood Forest SoilHIKCHPLEMRVGKPLSTAGLSGHDMNALSARVQKAVEDLYDGRAETT
Ga0335085_1073752823300032770SoilKSRPLEMRVGEPISTTGLTLRDMQTLSAKVQKAMEDLYYRP
Ga0335079_1231313213300032783SoilPMNTYHIKCRPLEMRVGEPISTVGTDLRHMEELSAKVEKALEDLYYR
Ga0335070_1091507223300032829SoilRPLEMRLGQPISTTGMTVRDLDSLSTKVQTAMESLYYHSGPA
Ga0335074_1049015713300032895SoilVGEPISTAGMTMGDLETVSRKVQAALEALYDPPSSVSQ
Ga0335072_1095247223300032898SoilMDTYHIKCRPLEMRVGEPISTKGTTMADLETVSHRVHAALEALYYAPRPVSQ
Ga0335077_1011915413300033158SoilYHIQSRPLEMRVGEPISTAGLTLDDMGALSDRVRKAMEDLYYLGQAPRTS
Ga0334847_019213_604_7263300033826SoilMRVGEPISTIGLTVRDLEALSNKVRTALEKLYYSESSVSQ
Ga0370483_0304479_6_1643300034124Untreated Peat SoilMNTYHIKCRPLEMRVGEPISTAGLSMRDMETVSAKVRKAMEELYYAPAPQSA
Ga0370515_0520814_11_1183300034163Untreated Peat SoilMRVGEPISTAGMTMRDMEAVSEKVWKAMEDLYYAK
Ga0370492_0331591_502_6093300034282Untreated Peat SoilMRVGEPIPTTGMTMRDLEAVSEKVKKEMEKLYYEA
Ga0373948_0136551_453_5963300034817Rhizosphere SoilMNTYHIKCRPLEMRVGQPISTAEYTLRNMEALSDKVHQAVEDLYKRG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.