NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F017956

Metatranscriptome Family F017956

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017956
Family Type Metatranscriptome
Number of Sequences 237
Average Sequence Length 113 residues
Representative Sequence VRHFNKATGYGGQAYAQKTSEAMCDELGPKNDYMQMHVEEAGGTSLCNANKPESGCSDKQKDFISKWGTKPKDDLQKQVDRLTGMVDKDGASMKAEALTWAKQRLAIVKQLHKKDEL
Number of Associated Samples 126
Number of Associated Scaffolds 237

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 62.82 %
% of genes near scaffold ends (potentially truncated) 48.10 %
% of genes from short scaffolds (< 2000 bps) 98.73 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.468 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(54.430 % of family members)
Environment Ontology (ENVO) Unclassified
(88.186 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(59.072 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.45%    β-sheet: 0.00%    Coil/Unstructured: 56.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 237 Family Scaffolds
PF00504Chloroa_b-bind 0.42



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.47 %
UnclassifiedrootN/A2.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008832|Ga0103951_10497016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii659Open in IMG/M
3300008834|Ga0103882_10043525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii659Open in IMG/M
3300008998|Ga0103502_10293373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium599Open in IMG/M
3300009023|Ga0103928_10377605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii547Open in IMG/M
3300009028|Ga0103708_100300150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii510Open in IMG/M
3300009268|Ga0103874_1017946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii628Open in IMG/M
3300009269|Ga0103876_1030642All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Aureococcus → Aureococcus anophagefferens697Open in IMG/M
3300009269|Ga0103876_1039529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii643Open in IMG/M
3300009269|Ga0103876_1054227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii578Open in IMG/M
3300009276|Ga0103879_10015143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii683Open in IMG/M
3300009276|Ga0103879_10016740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii670Open in IMG/M
3300009276|Ga0103879_10018342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii658Open in IMG/M
3300009276|Ga0103879_10026625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii608Open in IMG/M
3300009279|Ga0103880_10049573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii599Open in IMG/M
3300012413|Ga0138258_1103686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii541Open in IMG/M
3300012413|Ga0138258_1286163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii626Open in IMG/M
3300012414|Ga0138264_1738619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii555Open in IMG/M
3300012416|Ga0138259_1850526Not Available618Open in IMG/M
3300012419|Ga0138260_10262325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii708Open in IMG/M
3300012419|Ga0138260_10314593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium752Open in IMG/M
3300012935|Ga0138257_1377002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium901Open in IMG/M
3300012935|Ga0138257_1744894Not Available508Open in IMG/M
3300018683|Ga0192952_1019529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii661Open in IMG/M
3300018692|Ga0192944_1037548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii703Open in IMG/M
3300018730|Ga0192967_1070832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii574Open in IMG/M
3300018762|Ga0192963_1034807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium854Open in IMG/M
3300018765|Ga0193031_1050100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii694Open in IMG/M
3300018766|Ga0193181_1038081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii699Open in IMG/M
3300018791|Ga0192950_1051050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii613Open in IMG/M
3300018822|Ga0193368_1040665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii644Open in IMG/M
3300018827|Ga0193366_1037025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii687Open in IMG/M
3300018831|Ga0192949_1028530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1135Open in IMG/M
3300018846|Ga0193253_1087609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium741Open in IMG/M
3300018848|Ga0192970_1054590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium749Open in IMG/M
3300018871|Ga0192978_1026113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1084Open in IMG/M
3300018873|Ga0193553_1112944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii674Open in IMG/M
3300018874|Ga0192977_1030590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1065Open in IMG/M
3300018885|Ga0193311_10022679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii867Open in IMG/M
3300018899|Ga0193090_1084715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium732Open in IMG/M
3300018913|Ga0192868_10042719All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Aureococcus → Aureococcus anophagefferens681Open in IMG/M
3300018927|Ga0193083_10042839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii651Open in IMG/M
3300018927|Ga0193083_10067869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii543Open in IMG/M
3300018928|Ga0193260_10127003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii551Open in IMG/M
3300018928|Ga0193260_10139215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii523Open in IMG/M
3300018943|Ga0193266_10132419All Organisms → cellular organisms → Eukaryota636Open in IMG/M
3300018955|Ga0193379_10222001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii514Open in IMG/M
3300018966|Ga0193293_10074253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii626Open in IMG/M
3300018976|Ga0193254_10080401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii759Open in IMG/M
3300018982|Ga0192947_10196122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii666Open in IMG/M
3300018985|Ga0193136_10271800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium502Open in IMG/M
3300019009|Ga0192880_10140489All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Aureococcus → Aureococcus anophagefferens608Open in IMG/M
3300019021|Ga0192982_10095492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii983Open in IMG/M
3300019021|Ga0192982_10101102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii961Open in IMG/M
3300019021|Ga0192982_10181203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii746Open in IMG/M
3300019021|Ga0192982_10199288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii713Open in IMG/M
3300019022|Ga0192951_10312596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii594Open in IMG/M
3300019031|Ga0193516_10199284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii664Open in IMG/M
3300019032|Ga0192869_10152544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii953Open in IMG/M
3300019032|Ga0192869_10363772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii631Open in IMG/M
3300019032|Ga0192869_10371251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii624Open in IMG/M
3300019036|Ga0192945_10097764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium921Open in IMG/M
3300019040|Ga0192857_10349964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii514Open in IMG/M
3300019045|Ga0193336_10430075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii620Open in IMG/M
3300019048|Ga0192981_10352443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii535Open in IMG/M
3300019049|Ga0193082_10266528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium869Open in IMG/M
3300019049|Ga0193082_10452018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii706Open in IMG/M
3300019049|Ga0193082_10593875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii622Open in IMG/M
3300019049|Ga0193082_10665771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii587Open in IMG/M
3300019050|Ga0192966_10171178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium775Open in IMG/M
3300019050|Ga0192966_10217214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium683Open in IMG/M
3300019050|Ga0192966_10284639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii584Open in IMG/M
3300019054|Ga0192992_10185475Not Available668Open in IMG/M
3300019103|Ga0192946_1039657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii708Open in IMG/M
3300019108|Ga0192972_1081992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii572Open in IMG/M
3300019108|Ga0192972_1083674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium563Open in IMG/M
3300019150|Ga0194244_10051495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii679Open in IMG/M
3300019150|Ga0194244_10071397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii613Open in IMG/M
3300021345|Ga0206688_10181036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium784Open in IMG/M
3300021345|Ga0206688_10597343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium832Open in IMG/M
3300021350|Ga0206692_1027810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii595Open in IMG/M
3300021874|Ga0063147_151062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii636Open in IMG/M
3300021897|Ga0063873_1027343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium888Open in IMG/M
3300021898|Ga0063097_1049242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii857Open in IMG/M
3300021902|Ga0063086_1023920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1110Open in IMG/M
3300021905|Ga0063088_1027808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii769Open in IMG/M
3300021905|Ga0063088_1031535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii822Open in IMG/M
3300021911|Ga0063106_1036051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1015Open in IMG/M
3300021911|Ga0063106_1094288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium883Open in IMG/M
3300021913|Ga0063104_1062180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii854Open in IMG/M
3300021927|Ga0063103_1064002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii1071Open in IMG/M
3300021933|Ga0063756_1097995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii963Open in IMG/M
3300021936|Ga0063092_1112390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium656Open in IMG/M
3300021936|Ga0063092_1134243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium676Open in IMG/M
3300021939|Ga0063095_1063659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii560Open in IMG/M
3300021940|Ga0063108_1023934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii1019Open in IMG/M
3300021942|Ga0063098_1100520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii775Open in IMG/M
3300021943|Ga0063094_1050962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium701Open in IMG/M
3300030653|Ga0307402_10219219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii1064Open in IMG/M
3300030653|Ga0307402_10224464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1053Open in IMG/M
3300030653|Ga0307402_10238718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1023Open in IMG/M
3300030653|Ga0307402_10420778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium771Open in IMG/M
3300030653|Ga0307402_10451842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium743Open in IMG/M
3300030670|Ga0307401_10125817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1127Open in IMG/M
3300030670|Ga0307401_10220644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium857Open in IMG/M
3300030670|Ga0307401_10227915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium843Open in IMG/M
3300030670|Ga0307401_10272068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii768Open in IMG/M
3300030670|Ga0307401_10447318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium587Open in IMG/M
3300030671|Ga0307403_10268690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium903Open in IMG/M
3300030671|Ga0307403_10621063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii586Open in IMG/M
3300030699|Ga0307398_10188951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii1086Open in IMG/M
3300030699|Ga0307398_10363351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium791Open in IMG/M
3300030699|Ga0307398_10395301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium757Open in IMG/M
3300030699|Ga0307398_10822254All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Aureococcus → Aureococcus anophagefferens512Open in IMG/M
3300030702|Ga0307399_10161237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1010Open in IMG/M
3300030702|Ga0307399_10248251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium835Open in IMG/M
3300030702|Ga0307399_10350203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii710Open in IMG/M
3300030702|Ga0307399_10357161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium704Open in IMG/M
3300030702|Ga0307399_10538501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii574Open in IMG/M
3300030709|Ga0307400_10294072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1030Open in IMG/M
3300030709|Ga0307400_10319308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium986Open in IMG/M
3300030709|Ga0307400_10387355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii888Open in IMG/M
3300030709|Ga0307400_10416318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium853Open in IMG/M
3300030709|Ga0307400_10626284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii672Open in IMG/M
3300030756|Ga0073968_11954831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium736Open in IMG/M
3300030787|Ga0073965_11571939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii562Open in IMG/M
3300030856|Ga0073990_11938260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii648Open in IMG/M
3300030859|Ga0073963_11380462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium861Open in IMG/M
3300030871|Ga0151494_1411321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium775Open in IMG/M
3300030957|Ga0073976_11684035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium793Open in IMG/M
3300031459|Ga0073950_10013708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium777Open in IMG/M
3300031465|Ga0073954_10946757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii544Open in IMG/M
3300031522|Ga0307388_10269410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1064Open in IMG/M
3300031522|Ga0307388_10543157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium768Open in IMG/M
3300031522|Ga0307388_10583863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium741Open in IMG/M
3300031522|Ga0307388_10787804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii638Open in IMG/M
3300031522|Ga0307388_11002753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii565Open in IMG/M
3300031580|Ga0308132_1059477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium792Open in IMG/M
3300031580|Ga0308132_1080656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium670Open in IMG/M
3300031674|Ga0307393_1114168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii595Open in IMG/M
3300031709|Ga0307385_10145212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium894Open in IMG/M
3300031709|Ga0307385_10155407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii864Open in IMG/M
3300031709|Ga0307385_10325005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii586Open in IMG/M
3300031710|Ga0307386_10419518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii691Open in IMG/M
3300031710|Ga0307386_10651809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii560Open in IMG/M
3300031710|Ga0307386_10658046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium558Open in IMG/M
3300031710|Ga0307386_10793126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii511Open in IMG/M
3300031717|Ga0307396_10271712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii809Open in IMG/M
3300031717|Ga0307396_10317198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium745Open in IMG/M
3300031717|Ga0307396_10408015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii651Open in IMG/M
3300031717|Ga0307396_10450139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii618Open in IMG/M
3300031717|Ga0307396_10510326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii577Open in IMG/M
3300031725|Ga0307381_10074757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1076Open in IMG/M
3300031725|Ga0307381_10183839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii726Open in IMG/M
3300031729|Ga0307391_10293630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium882Open in IMG/M
3300031729|Ga0307391_10358104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium803Open in IMG/M
3300031729|Ga0307391_10373614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium787Open in IMG/M
3300031729|Ga0307391_10462053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii709Open in IMG/M
3300031729|Ga0307391_10542972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii655Open in IMG/M
3300031729|Ga0307391_10720944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii569Open in IMG/M
3300031729|Ga0307391_10890492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium513Open in IMG/M
3300031734|Ga0307397_10148864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1008Open in IMG/M
3300031734|Ga0307397_10202336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium878Open in IMG/M
3300031734|Ga0307397_10205153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii873Open in IMG/M
3300031734|Ga0307397_10321222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium705Open in IMG/M
3300031734|Ga0307397_10457459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii593Open in IMG/M
3300031734|Ga0307397_10457968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii593Open in IMG/M
3300031735|Ga0307394_10120949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1002Open in IMG/M
3300031735|Ga0307394_10197594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii789Open in IMG/M
3300031735|Ga0307394_10204234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium776Open in IMG/M
3300031735|Ga0307394_10295049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium643Open in IMG/M
3300031735|Ga0307394_10299240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium639Open in IMG/M
3300031737|Ga0307387_10244483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1046Open in IMG/M
3300031737|Ga0307387_10256776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1024Open in IMG/M
3300031737|Ga0307387_10369080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii870Open in IMG/M
3300031737|Ga0307387_10384539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium853Open in IMG/M
3300031737|Ga0307387_10444427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium797Open in IMG/M
3300031737|Ga0307387_10602084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium687Open in IMG/M
3300031737|Ga0307387_10758118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii612Open in IMG/M
3300031737|Ga0307387_10779457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium604Open in IMG/M
3300031737|Ga0307387_10829531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium585Open in IMG/M
3300031737|Ga0307387_10972665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii540Open in IMG/M
3300031738|Ga0307384_10293605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium740Open in IMG/M
3300031738|Ga0307384_10320521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium710Open in IMG/M
3300031738|Ga0307384_10460233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii598Open in IMG/M
3300031738|Ga0307384_10506119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii572Open in IMG/M
3300031739|Ga0307383_10145030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1089Open in IMG/M
3300031739|Ga0307383_10155967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii1054Open in IMG/M
3300031742|Ga0307395_10169906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium919Open in IMG/M
3300031742|Ga0307395_10364030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii627Open in IMG/M
3300031742|Ga0307395_10424672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium579Open in IMG/M
3300031742|Ga0307395_10482813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii541Open in IMG/M
3300031743|Ga0307382_10303414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium718Open in IMG/M
3300031743|Ga0307382_10424570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii605Open in IMG/M
3300031750|Ga0307389_10401891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii865Open in IMG/M
3300031750|Ga0307389_10656472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii682Open in IMG/M
3300031750|Ga0307389_10839771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii604Open in IMG/M
3300031752|Ga0307404_10266560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii709Open in IMG/M
3300031752|Ga0307404_10276368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium696Open in IMG/M
3300031752|Ga0307404_10351749All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Aureococcus → Aureococcus anophagefferens614Open in IMG/M
3300031752|Ga0307404_10398178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii576Open in IMG/M
3300032153|Ga0073946_1054894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium572Open in IMG/M
3300032463|Ga0314684_10223535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii1062Open in IMG/M
3300032463|Ga0314684_10821340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium528Open in IMG/M
3300032491|Ga0314675_10616187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii531Open in IMG/M
3300032492|Ga0314679_10127532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1128Open in IMG/M
3300032517|Ga0314688_10500319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii660Open in IMG/M
3300032517|Ga0314688_10530616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium639Open in IMG/M
3300032518|Ga0314689_10311263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium827Open in IMG/M
3300032519|Ga0314676_10777846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii553Open in IMG/M
3300032521|Ga0314680_10858593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii571Open in IMG/M
3300032540|Ga0314682_10391842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium766Open in IMG/M
3300032540|Ga0314682_10496701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium672Open in IMG/M
3300032615|Ga0314674_10581440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium573Open in IMG/M
3300032651|Ga0314685_10324446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii852Open in IMG/M
3300032707|Ga0314687_10157705All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1142Open in IMG/M
3300032711|Ga0314681_10446220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium726Open in IMG/M
3300032711|Ga0314681_10578718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii627Open in IMG/M
3300032713|Ga0314690_10337286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium748Open in IMG/M
3300032714|Ga0314686_10181640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1023Open in IMG/M
3300032723|Ga0314703_10335068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii625Open in IMG/M
3300032727|Ga0314693_10473713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii683Open in IMG/M
3300032733|Ga0314714_10679226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii564Open in IMG/M
3300032733|Ga0314714_10758090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium527Open in IMG/M
3300032743|Ga0314707_10307260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii825Open in IMG/M
3300032744|Ga0314705_10668605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium548Open in IMG/M
3300032745|Ga0314704_10448972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii713Open in IMG/M
3300032748|Ga0314713_10435206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii556Open in IMG/M
3300032752|Ga0314700_10570238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii600Open in IMG/M
3300033572|Ga0307390_10392084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii846Open in IMG/M
3300033572|Ga0307390_10438048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium803Open in IMG/M
3300033572|Ga0307390_10580416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium698Open in IMG/M
3300033572|Ga0307390_10615674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium678Open in IMG/M
3300033572|Ga0307390_10919134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii553Open in IMG/M
3300033572|Ga0307390_10986804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium534Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine54.43%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine24.05%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater11.81%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water4.22%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine3.38%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.27%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water0.42%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.42%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009023Planktonic microbial communities from coastal waters of California, USA - Canon-29EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009268Eukaryotic communities of water from the North Atlantic ocean - ACM43EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018683Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782475-ERR1712204)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018822Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001938 (ERX1782327-ERR1711869)EnvironmentalOpen in IMG/M
3300018827Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001938 (ERX1782415-ERR1712182)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018943Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001290 (ERX1789547-ERR1719206)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019054Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021897Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021933Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Euk - ARK-7-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021936Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-15M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030756Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030787Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030871Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_R_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030957Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031459Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031465Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032153Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103951_1049701613300008832MarineVRHFNKATGYGGVAYSQKTSEAMCDELGPKNDYMHMYVEEAGGTSLCNANKPETGCSDKQKDFISKWREKPKDDLQKQVDRLTGMVAKDGASMNAEALTWAKHRLAIVKQLHKKDEL*
Ga0103882_1004352513300008834Surface Ocean WaterKKTSSAMCDELGPKEEYMQMHIEEAGGTSLCNIDNSEAGCNEKQKEFIAKWNGKGKDDLQKQLDRLTGMVGKDGSSMKPEALTWAKQRLAIVKQLHKKEEL*
Ga0103502_1029337313300008998MarineVRYFNKATGYGGKAYEKKTSKAMCDELGPKEEYMQQFVEEAGGTSLCNAKNPGSGCSEKQLGFIEKWKAKGEADLQKQLDRLTGMLEKDGGSMKPEALSWAKQRLSIFKQLAQKDEL*
Ga0103928_1037760513300009023Coastal WaterEKAMCDELGPKEEYMQMYVEEIGGVSQCNVATPDVGCSDEQKKFIAKWGEKSKDDLQAQITRLKGMVDKDGTSMKPEALKWAKQRLAIVSQFKKQKDEL*
Ga0103708_10030015013300009028Ocean WaterKTDKAMCDELGPKEEYMQLLVEEHGGTSLCNVSSPDKGCSEQQQKFITKWGDKNKEELQKQIDRLSGMVDKDGASMKADALAWAKQRLSIVKQFKKKHDEL*
Ga0103874_101794613300009268Surface Ocean WaterNKATGYGGAPYAKKTDKAMCDELGPKEEYMQQYIEDIGGVSLCSVTNADVGCSEEQKKFIAKWGEKNKDDLEAQHKRLTGMVDKDGSSMKPEALKWAKQRLSIVKQFQKKRDEL*
Ga0103876_103064213300009269Surface Ocean WaterPTVRYFNKETGYGGKPYAKKTDKAMCDELGPKEEYMQMFVEEAGGTSLCNVSTPDQGCSDQQKKFIVKWGDKDKDELQKQVDRLASMVEKDGSSMKADALTWAKQRLNIVKQFKKQKEEL
Ga0103876_103952913300009269Surface Ocean WaterRHFNKQTGYGGAKYEKKTGDAMCDELGPKTDYMQIHVEEAGGTSLCNILTPDKGCTDQQKTFGEKWGGKSKDDLAKQMDRLTGMVDKDGGSMKPEALTWAKQRLAIIKQLHKKDEL*
Ga0103876_105422713300009269Surface Ocean WaterGWPTIRHFNKQTGYGGEAYKKKTDQAMCDELGPKQEYMQMFVEEAGGTSLCNINNTEQGCSDQQKKFIAKWGDKPKDELQKQVDRLAGMVDKDGSSMKPDALKWAKQRLKIFSQLTAKTEL*
Ga0103879_1001514313300009276Surface Ocean WaterAYAKKTAGAMCDELGPKEEYMQMHIEEAGGTSLCSVKNTESGCNDQQKKFIDKWGDKPKDELQKQLDRLTGMVDKDGASMKPEALSWAKQRLSIVKQLHKKDEL*
Ga0103879_1001674013300009276Surface Ocean WaterPTVRYFNQGTGYGGKAYEKKTGDAMCDELGPKQSYMQEFVEQFATLCNINDTSTGCSDKQKDFITKWTGKAKDELQKQLDRLGGMVGKDASAMKPEALTWAKQRLAIIKQFHKKEEL*
Ga0103879_1001834213300009276Surface Ocean WaterGWPTVRHFNKQTGYGGAAYVKKTSGAMCDELGPKEDYMQMHIEEAGGTSLCSVKNTDSGCNDQQKKFIEKWGDKPKDELQKQLDRLTGMVDKDGASMKPEALTWAKQRLAIVKQLHKKDEL*
Ga0103879_1002662513300009276Surface Ocean WaterGDAMCDELGPKTDYMKIHVEEAGGTSQCNILKPEVGCTDQQKSFGEKWGAKGKDDLAKQMERLTGMVDKDGGSMKPEALTWAKQRLAIIKQLHKKDEL*
Ga0103880_1004957313300009279Surface Ocean WaterKATGYGGAPYAKKTDKAMCDELGPKEEYMQQYIEDIGGVSLCSVTNADVGCSEEQKKFISKWGEKSKEDLEAQHKRLSGMVDKDGSSMKPEALKWAKQRLSIVKQFQKKKDEL*
Ga0138258_110368613300012413Polar MarineMCDELGPKNDYMQQYVEEFGSSLCNANTPDSGCSDKQKEFIAKWGAKPKADLQKQVDRLIGMVDKDGGSLNPEALTWAKQRLSIVKQLHKKDEL*
Ga0138258_128616313300012413Polar MarineTDEAMCTELGPGKEYMQMHIEEAGGTSLCSVNDTSSGCSDQQKKFIEKWSAKPKDDIQKQVDRLNGMVDKDGASMKPEALTWAKQRLAIVKALHKKEAKEEL*
Ga0138264_173861913300012414Polar MarineFNKATGYGGEAYVKKTDEAMCTELGPGKEYMQMHIEEAGGTSLCNVNDTSNGCSDQQKKFIEKWNAKPKDDIQKQVDRLLGMVDKDGASMKPEALTWAKQRLAIVKALHKKEAKEEL*
Ga0138259_185052613300012416Polar MarineGGEAYVKKTDEAMCTELGPGKEYMQMHIEEAGGTSLCNVNDTSNGCSDQQKKFIEKWNAKPKDDIQKQVDRLLGMVDKDGASMKPEALTWAKQRLAIVKALHKKEAKEEL*
Ga0138260_1026232523300012419Polar MarineVRSFNKASGYGGQAYVQKTGDAMCDELGPKNDYMSMFVEEAGGTSLCNANKPESGCSDKQTEFISKWGAKPKDELQKQVDRLSGMVDKDGSSMKAESLTWAKQRLAIVKQLHKKDEL*
Ga0138260_1031459313300012419Polar MarineMCDELGPKTEYMLQFVEDAGGVSQCSVSTPETGCSDQQKKFIAKWGEKPKDELQKQIDRLAGMVDKDGASMKPDALSWAKQRMNIVKQLHKKEEL*
Ga0138257_137700223300012935Polar MarineVRFFNKGTGLGGEAYKQKTSTAMCDELGPKTEYMLQFVEDAGGVSQCSVSTPETGCSDQQKKFIAKWGEKPKDELQKQIDRLAGMVDKDGASMKPDALSWAKQRMNIVKQLHKKEEL*
Ga0138257_174489413300012935Polar MarineKTDEAMCTELGPGKEYMQMHIEEAGGTSLCNVNDTSNGCSDQQKKFIEKWNAKPKDDIQKQVDRLLGMVDKDGASMKPEALTWAKQRLAIVKALHKKEAKEEL*
Ga0192952_101952913300018683MarineWPTVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFISKWGAKPKDELQKQIDRLSGMVDAAASSMKAEALTWAKKRLSIVKQLHKKEEL
Ga0192944_103754813300018692MarineTDQGAGGGGWPTVRHFNKGTGYGGKEYVKKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTATGCSDKQKDFIGKWNSKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0192967_107083223300018730MarineTSTAMCDELGPKTEYMLQFVEDAGGVSQCSVSTPETGCSDQQKKFIEKWGAKPKDDLQKQIDRLAGMVDKDGASMKPDALSWAKQRMNIVKQLHKKEEL
Ga0192963_103480723300018762MarineVRHFNKATGYGGQAYAQKTGEAMCDELGPKNDYMSMLIEEAGGTSLCNANKPESGCSDKQKEFILKWGEKAKDELQKQVDRLSGMVEKDGASMKQESLTWAKQRLSIVKQLHKKDEL
Ga0193031_105010013300018765MarineHFNKQTGYGGAPYSKKTDKAMCDELGPKEEYMHIHIEEAGGTSLCDINNTEKGCTDKQKDFITKWGTESKDKLQKQLERLSGMVDKDGSSMKPDALKWAKQRLNIVKQLSKKEEL
Ga0193181_103808113300018766MarineWPTVRHFNKQTGYGGAAYVKKTSSAMCDELGPKEEYMRIYIEEAGGTSLCNINNSDSGCNDKQKEFITKWSGKGKDDLQKQLDRLSGMVDKDGSSMKPEALTWAKQRLAIVKQLHKKEEL
Ga0192950_105105013300018791MarineVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFITKWGAKPKDELQKQIDRLSGMVDAAASSMKAEALTWAKKRLSIVKQLHKKEEL
Ga0193368_104066513300018822MarineKQTGYGGAPYSKKTDKAMCDELGPKEEYMHIHIEEAGGTSLCDINNTEKGCTDKQKDFITKWGTESKDKLQKQLERLSGMVDKDGSSMKPDALKWAKQRLNIVKQLSKKEEL
Ga0193366_103702513300018827MarineVRHFNKQTGYGGAPYSKKTDKAMCDELGPKEEYMHIHIEEAGGTSLCDINNTEKGCTDKQKDFITKWGTESKDKLQKQLERLSGMVDKDGSSMKPDALKWAKQRLNIVKQLSKKEEL
Ga0192949_102853013300018831MarineVRHFNKGTGYGGKEYVKKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTATGCSDKQKDFIGKWNSKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0193253_108760913300018846MarineVSLSKNQVREIHGTDQGAGGGGWPTVRHFNKATGYGGAPYAKKTDEAMCDELGPKHDYMQLHIEEAGGTSLCNVNDTAKGCSDKQKDFIGKWNEKSKDDLQKQVDRLTGMVEKDGASMKPEALTWA
Ga0192970_105459023300018848MarineVRHFNKATGYGGAPYAKKTSSAMCDELGPKNDYMQQYVEEAGGTSLCNANAVLEGVDSGGCSDKQREFIQKWGAKPKADLQEQVDRLMGMVDKDGESLKPEALTWAKQRLAIVKQLHKKEEL
Ga0192978_102611323300018871MarineVRHFNKGTGYGGKEYVKKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTTTGCSDKQKDFIGKWNSKPKDDLQKQIDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0193553_111294413300018873MarineNKQTGYGGAAYVKKTNKAMCDELGPKEEYMQLLVEEAGGASLCNINNSETGCSEQQKKFISKWGDKGKDELQKQLDRLSGMVEKDGSSMKAEALTWAKQRLNIVKQFKKQKDEL
Ga0192977_103059013300018874MarineVRHFNKGTGYGGKEYVKKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTTTGCSDKQKDFIGKWNSKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0193311_1002267913300018885MarineVRHFNKATGYGGQAYSKKTSEAMCDELGPKNDYMQQYVEEAGGTSLCNANKPETGCSDKQKEFIAKWGAKPKDELQKQVDRLTGMVDKDGAKMKPEALTWAKQRLAIFKQLHKKDEL
Ga0193090_108471523300018899MarineVRFFNKGTGLGGEAYKQKTSTAMCDELGPKTEYMLQFVEDAGGVSQCSVSTPETGCSDQQKKFIEKWGAKPKDDLQKQIDRLAGMVDKDGASMKPDALSWAKQRMNIVKQLHKKEEL
Ga0192868_1004271913300018913MarineGWPTVRHFNKQTGYGGAPYSKKTDKAMCDELGPKEEYMHIHIEEAGGTSLCDINNTEKGCTDKQKDFITKWGTESKDKLHKQLERLSGMVDKDGSSMKPDALKWAKQRLNIVKQLSKKEE
Ga0193083_1004283913300018927MarineKEGEFMKTFVEEAAGTSLCSVLKMESGCSDKEKDFIGKYNTKTKDEVQKQHDRLVGMIEKDGASMKPEALAWAKKRLGIVKQLTKVAAAAKTEL
Ga0193083_1006786913300018927MarineVRHFNKATGYGGQAYVKKTSEAMCDELGPKNDYMNMFVEEAGGTSLCNANKPETGCSDKQKDFISKWGTKPKDDLQKQVDRLTGMVDKDGASMKPEALTWAKQRLAIVKQLATKYEL
Ga0193260_1012700313300018928MarinePTVRHFNKATGYGGAAYVKKTSSAMCDELGPKEEYMRIHIEEAGGTSLCNINNSDAGCNDKQKEFITKWTGKGKDDLQKQLDRLSGMVDKDGSSMKPEALTWAKQRLAIVKQLHKKDEL
Ga0193260_1013921513300018928MarineAKYEKKTDGAMCDELGPKNEYMHMHIEEAGGTSLCNANKPETGCSDKQKDFITKWGGKGKDDLEKQVERLNGMVDKDGASMKPEALTWAKQRLNIVKQLHKRDEL
Ga0193266_1013241923300018943MarineVRYFNKETGYGGKPYAQKTDKAMCDELGPKEEYMQMFIEEAGGTSLCNVSTPDQGCSDQQRKFIAKWGDKDKEELQKQVDRLASMVEKDGSSMKADALTWAKQRLNIV
Ga0193379_1022200113300018955MarinePTVRHFNKETGYGGKAYVKKTSGAMCDELGPKEEYMAMHIEEAGGTSLCNVNTEQGCSEQQKTFIGKWKDKGKDDFQKQIDRLTGMVDKDGSSMKPEALTWAKQRLAIVKNLHKGKEEL
Ga0193293_1007425313300018966MarineYAKKTSEAMCDELGPKNNYMQQYVEEAGGTSLCNVNKPETGCSDKQKDFIAKWGVKPKEDLQKQVDRLTGMVDKDGASMKPEALTWAKQRLAIVKQLHKKDEL
Ga0193254_1008040113300018976MarineVRHFNKATGYGGQAYAKKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFISKWGTKPKDELQKQIDRLSGMVDKDGSSMKAESLTWAKQRLAMVKQLHKKDEL
Ga0192947_1019612223300018982MarinePTVRHFNKATGYGGQAYAKKTSEAMCDELGPKNDYMNMFVEEAGGTSLCNANKPESGCSDKQKDFISKWGSKAKDDLQKQIDRLSGMVDKDGSSMKADSLTWAKQRLAMVKQLHKRDEL
Ga0193136_1027180013300018985MarineVRYFNKQTGYGGAAYVKKTNKAMCDELGPKEEYMQLMIEEMGGTSLCNINNSASGCSEQQQKFISKWGDKGMDELQKQLDRLSGMVEKDGSSMKAEALTWAKQRLNIVKQ
Ga0192880_1014048913300019009MarineQGAGSGGWPTVRHFNKQTGYGGAKYEQKTKDAMCDELGPKTDYMAIHIEEAGGTSLCNATTEQGCSDEQKKFISKWGGKPKDELQKQLDRLSGMVDKDGGSMKAESLAWAKRRLAIVKQLHKKEEL
Ga0192982_1009549223300019021MarineVRHFNKATGYGGVAYSQKTSEAMCDELGPKNDYMNMYVEESGSTSLCNANKPEAGCSDKQKDFISKWGTKPKDDIQKQVDRLAGMVDKDGASMKAEALTWAKQRLAIVKQLHKKDEL
Ga0192982_1010110223300019021MarineVRQFNKATGYGGQAYVQKTGEAMCDELGPKNDYMNMFVEEAGGTSLCNANKPDSGCSDKQKEFISKWGTKPKDELQKQVDRLSGMVDKDGSSMKAEALTWAKQRLAIVKQLHKKDEL
Ga0192982_1018120323300019021MarineQVQTIHGTAQGAGSGGWPTVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFITKWGAKPKDELQKQIDRLSGMVDAAASSMKAEALTWAKKRLSIVKQLHKKQEL
Ga0192982_1019928813300019021MarineVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFITKWGAKPKDELQKQIDRLSGMVDAAASSMKAEALTWAKKRLSIVKQLHKKDEL
Ga0192951_1031259613300019022MarineCDELGPKNDYMNMYVEESGSTSLCNANKPEAGCSDKQKDFISKWGTKPKDDLQKQVDRLTGMVDKDGASMKAEALTWAKQRLAIVKQLHKKDEL
Ga0193516_1019928413300019031MarineTSSAMCDELGPKEEYMAMHIEEAGGTSLCNVNTEQGCSEQQKTFIGKWKDKGKDDFQKQIDRLTGMVDKDGSSMKPEALTWAKQRLAIVKNLHKGKDEL
Ga0192869_1015254413300019032MarineMCDELGPKQDYMKMYVEEAGGTSLCNIKKTDTGCSDKQKDFITKYEGKTKDDIQKQLDRLSGMVDKDGSSMKPEALTWAKQRLAIVKQLHKREEL
Ga0192869_1036377213300019032MarineYFNKETGYGGAAYKKKTSQAMCDELGPGKEFMKELVEEAAGTSLCNVQKADSGCSDKEKDFIKKWADKPKDDLQKQLDRLNGMIDKDGESMKAEALGWAKKRLGIFKQLTKTASAAKSEL
Ga0192869_1037125113300019032MarineHGAKKTGDAMCNELGPKTEYMHMYVEEAGGTSLCSVKDTSSGCSDQQKKFIEKWGDKAKDELQKQVDRLSGMVDKDGASMKPEALTWAKQRLAIVKQLHKKDEL
Ga0192945_1009776423300019036MarineVRHFNKATGYGGQAYAKKTSEAMCDELGPKNDYMNMFVEEAGGTSLCNANKPESGCSDKQKDFISKWGSKAKDDLQKQIDRLSGMVDKDGSSMKADSLTWAKQRLAMVKQLHKRDEL
Ga0192857_1034996413300019040MarineGGKAYVKKTDKAMCDELGPKEEYMQMFVEEAGGTSLCNAQTPESGCNDQQKKFIEKWGTKPKDELQKQVDRLAGMVDKDGASMKPEALTWAKQRLAIVKQLHKREEL
Ga0193336_1043007513300019045MarineKQTGYGGAAYAKKTSSAMCDELGPKTEYMQMHVEEAGGTSLCNALKPEAGCTDQQKTFITKYSDKSKEDIQKQMDRLAGMVEKDGASMKPEALTWAKQRLSIVKALHKKDEL
Ga0192981_1035244313300019048MarineMCDELGPKNDYMQQYVEEAGGASLCNANKPETGCSDKQKDFISKWGAKPKEDLQKQVDRLTGMVDKDGASMKPEALTWAKERLSIVKQLHKKDEL
Ga0193082_1026652823300019049MarineVRYFNKATGYGGKAYEKKTSQAMCDELGPKEEYMQKFVEEAGGTSLCNAKAPGGGCTEKQLGFIDKWKDKGEAELQKQLDRLSGMVDKDGASMKPEALSWAKARLSIFKQLTKKDEL
Ga0193082_1045201813300019049MarineHGGGWPTVRHFNKATGYGGQAYVKKTSEAMCDELGPKNDYMNMFVEEAGGTSLCNANKPETGCSDKQKDFISKWGTKPKDELQKQIDRLSGMVDKDGSSMKAESLTWAKQRLAMVKQLHTKDEL
Ga0193082_1059387513300019049MarineHGGGQAYAKKTGEAMCDELGPKNDYMQQYVEEAGGTSLCNANKPETGCSDKQKDFIAKWGAKAKDELQKQVDRLTGMVDKDGASMKPEALTWAKQRLAIVKQLHKKDEL
Ga0193082_1066577113300019049MarineQTGCGGSPYVKKTDKAMCDELGPKEEYMQQYIEEIGGVSLCNVSNPDQGCTDEQKKFIVKWGDKNKDDLEAQLKRLSTMVDKDGSSMKAEALKWAKQRLSIVKQFKKQKDEL
Ga0192966_1017117813300019050MarineVRHFNKATGYGGKAYVQKTDQAMCDELGPKTDYMQLHIEEAGGTSLCNPLKVGDSCSDQQKKFITKWAGESIDKLQSQVTRLAGMVEKDGASMKPEALTWAKQRLKIVETFHANGGKKEE
Ga0192966_1021721413300019050MarineVRHFNKATGYGGKAYVQKTDQAMCDELGPKTDYMQLHIEEAGGTSLCNPLKVGDSCSDQQKKFITKWAGESIDKLQSQVTRLAGMVEKDGASMKPEALTWAKQRLKIVETFHSNGGKKEE
Ga0192966_1028463923300019050MarineTWDFNKATGYGGVAYSQKTSEAMCDELGPKNDYMNMYVEESGSTSLCNANKPEAGCSDKQKDFISKWGTKPKDDLQKQVDRLTGMVDKDGTSMKAEALTWAKQRLAIVKQLHKKDEL
Ga0192992_1018547513300019054MarineHGKTDDAMCDELGPKTEYMQMHVEEAGGTSLCNVNNTAQGCSDEQKKFIAKWGDKAKADLQKQVDRLASMVDKDGASMKPEALTWAKQRLNIVKQLHKKEEL
Ga0192946_103965723300019103MarineKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTATGCSDKQKDFIGKWNSKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0192972_108199223300019108MarineGEAMCDELGPKNDYMNMFVEEAGGTSLCNANKPDSGCSDKQKEFISKWGTKPKDELQKQVDRLSGMVDKDGSSMKAEALTWAKQRLAIVKQLHKKDEL
Ga0192972_108367413300019108MarineVRHFNKATGYGGVAYSQKTSEAMCDELGPKNDYMNMYVEESGSTSLCNANKPEAGCSDKQKDFISKWGTKPKDDIQKQVDRLAGMVDKDGASMKA
Ga0194244_1005149513300019150MarineYVKKTSGAMCDELGPKEDYMQMHIEEAGGTSLCSVKNTDSGCNDQQKKFIEKWGDKPKDELQKQLDRLTGMVDKDGASMKPEALTWAKQRLAIVKQLHKKDEL
Ga0194244_1007139713300019150MarineSKQTGYGGAPYAKKTDKAMCDELGPKEEYMQQFVEEIGGVSLCSVANVDVGCSDEQKKFIAKWGEKDKDELAAQLARLSGMVDKDGSSMKPEALKWAKQRLNIVKQFKKQKDEL
Ga0206688_1018103623300021345SeawaterVRYFNKGTGYGGKGYEKKTSSAMCDELGPKNEYMQQFIEDAGGVSQCSVATPETGCSDQQKKFITKWAEKPKDELQKQIDRLFGMVEKDGASMKPEALSWAKKRMNIVQQLHKKEEL
Ga0206688_1059734313300021345SeawaterVRYFNAATGLGGKAYEQKTSTAMCDELGPKTEYMQQFVEEAGGASLCNVATPEVGCSEQQKKFIGKWGAKPKDELQKQIDRLSGMVDKDGASMKPEALSWARQRMSIVKQLHKKEEL
Ga0206692_102781013300021350SeawaterGGAPYAKKTDEAMCDELGPKHDYMQLHIEEAGGTSLCNVNDTTTGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGLSKDEL
Ga0063147_15106213300021874MarineVRHFNKATGYGGEPYAKKTGEAMCDELGPKNDYMQQYVEDLGGTSLCNANKPDTGCSDKQKDFISKWGTKPKDDLQKQVDRLMGMVDKDGASMKAEALTWAKQRLAIVKQLHKNLDKKDE
Ga0063873_102734323300021897MarineVRHFNKATGYGGEAYKQKTSTAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQKDFIAKWGAKAKDELQKQVDRLTGMVDKDGASMKPETLTWAKQRLAIVKQLHKKEEL
Ga0063097_104924223300021898MarineVRHFNKATGYGGEAYKQKTSTAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQKDFIGKWGAKPKDDLQKQVDRLMGMVDKDGASMKPEALTWAKQRLAMVKQLHKKDEL
Ga0063086_102392023300021902MarineVRHFNKATGYGGKAYEKKTGDAMCDELGPKNEYMQMHIEEAGGTSLCNANKPESGCSDQQKTFITKYADKSKDDLKKQVDRLSGMVDKDGASMKPEALTWAKQRLAIVKSLHSKDEL
Ga0063088_102780823300021905MarineVRHFNKATGYGGQAYKQKTSQAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQKDFIAKWGAKPKDELQKQVDRLTGMVDKDGASMKTEALMWAKQRLAIVKQLHNKDEL
Ga0063088_103153523300021905MarineVRHFNKATGYGGEAYVQKTSTAMCDELGPKNDYMQQYVEEAGGTSLCNANKPEAGCSDKQKDFIAKWGAKPKDELQKQVDRLTGMVDKDGASMKPESLTWAKQRLAIVKQLHKKEEL
Ga0063106_103605123300021911MarineVRYFNKGTGYGGKGYEKKTSSAMCDELGPKNEYMQQFIEDAGGVSQCSVATPETGCSDQQKKFIAKWGEKPKDELQKQIDRLAGMVDKDGASMKPEALSWAKQRMNIVKQLHKKEEL
Ga0063106_109428823300021911MarineVRHFNKGTGYGGKAYEQKTSGAMCDELGPKTENMLQHVEDAGGVSQCSVSTPEAGCSDQQKKFIEKWGAKPKDELQKQIDRLSGMVDKDGASMKPDALSWAKQRMNIVKQLHKKEEL
Ga0063104_106218023300021913MarineVRHFNKATGYGGEPYAKKTGEAMCDELGPKNDYMQQYVEDLGGTSLCNANKPDTGCSDKQKDFVSKWGTKPKDDLQKQVDRLMGMVDKDGASMKAEALTWAKQRLAIVKQLHKNLDKKDE
Ga0063103_106400223300021927MarineMCDELGPKNDYMQQYVEDLGGTSLCNANKPDTGCSDKQKDFVSKWGTKPKDDLQKQVDRLMGMVDKDGASMKAEALTWAKQRLAIVKQLHKNLDKKDEL
Ga0063756_109799523300021933MarineVRHFNKATGYGGQAYVKKTSEAMCDELGPKNDYMNMYVEEAGGTSLCNANKPEAGCSDKQKDFISKWGAKPKDDLQKQVDRLTGMVDKDGASMKAETLTWAKQRLAIVKQLHKKDEL
Ga0063092_111239023300021936MarineVRHFNKATGYGGKAYEQKTSGAMCDELGPKTENMLQHVEDAGGVSQCSVSTPEAGCSDQQKKFIEKWGAKPKDELQKQIDRLSGMVDKDGASMKPDALSWAKQRMNIVKQLHKKEEL
Ga0063092_113424323300021936MarineVRHFNKQTGYGGEAYKQKTGDAMCDELGPKTDNMLLHIEEAGGTSLCSISNTESGCSDAQKKFIEKWGAKPKDELQKQLDRLAGMIDKDGNSMKPEALTWAKQRASIVKQLHKKEEL
Ga0063095_106365913300021939MarineYVQKTQTAMCDELGPKTEYMGMHIEEAGGTSLCNVTTKQGCSDQQTKFIAKWGDKAKDELQKQVDRLTGMVDKDGASMKAEALTWAKQRLNIVKKLHAKEEL
Ga0063108_102393423300021940MarineVRHFNKATGYGGAAYVKKTSEAMCDELGPKNDYMNMYVEEAGGTSLCNANKPEAGCSDKQKDFISKWGAKPKDDLQKQVDRLTGMVDKDGASMKAETLTWAKQRLAIVKQLHKKDEL
Ga0063098_110052023300021942MarineVRHFNKATGYGGQAYIQKTSTAMCDELGPKNDYMQQYVEEAAGTSLCNANKPDTGCSDKQTDFIAKWGAKPKDELQKQVDRLMGMVDKDGASMKAETLTWAKQRLAIVKQLHKKDEL
Ga0063094_105096223300021943MarineVRYFNKGTGYGGKGYEKKTSSAMCDELGPKNEYMQQFIEDAGGVSQCSVATPETGCSDQQKKFIAKWGEKPKDELQKQIDRLSGMVDKDGASMKPEALSWAKQRMNIVKQLHKKEEL
Ga0307402_1021921923300030653MarineVRHFNKATGYGGEAYVKKTSEAMCDELGPKNDYMNMYVEEAGGTSLCNANKPEAGCSDKQKDFISKWGAKPKDDLQKQVDRLTGMVDKDGASMKAETLTWAKQRLAIVKQLHKKDEL
Ga0307402_1022446423300030653MarineVRHFNKATGYGGEAYKQKTSTAMCDELGPKNDYMQQLVEEAGGTSLCNANNPETGCSDKQKDFIAKWGAKPKDDLQKQVDRLMGMVDKDGASMKPEALTWAKQRLAIVKQLHKKDEL
Ga0307402_1023871813300030653MarineVRHFNKQTGYGGEAYKQKTGDAMCDELGPKTEYMLQHIEEAGGTSLCSISNTESGCSDAQKKFIEKWGAKPKDELQKQLDRLAGLVDHKNGNSMKPEALNWAKQRASIIKQLHAKEEL
Ga0307402_1042077813300030653MarineVRHFNKGTGYGGKEYVKKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTTTGCSDKQKDFIGKWNSKPKDDLQKQMDRLTGMVEKDGASMKPEALTWAKQRLSIVTSLHKGPSKDEL
Ga0307402_1045184213300030653MarineVRHFNKATGYGGAAYVKKTSEAMCDELGPKNDYMNMHVEEAGSTSLCNANQPESGCSDKQKEFISKWGAKPKDDLQKQVDRLTGMVDKDGASMKAEALTWAKQRLSIVKQLHKKDEL
Ga0307401_1012581713300030670MarineVRHFNKATGYGGKEYVKKTEEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTATGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0307401_1022064423300030670MarineVRSFNKASGYGGQAYVQKTGDAMCDELGPKNDYMSMFVEEAGGTSLCNANKPESGCSDKQTEFIAKWGAKPKDELQKQVDRLSGMVDKDGASMKQESLTWAKQRLSIVKQLHKKDEL
Ga0307401_1022791513300030670MarineVRHFNKQTGYGGAKYEQKTKDAMCDELGPKTDYMAMHIEEAGGTSLCNATTEQGCSDEQKKFISKWGGKPQDELQKQLDRLSGMVDKDGGSMKAESLAWAKKRLAIVKQLHKKEEL
Ga0307401_1027206813300030670MarineVRHFNKATGYGGQAYVQKTKDAMCDELGPKNDYMQQFVEEAGGTSLCNANKPETGCSDKQKEFITKWGEKPKDDLQKQVDRLTGMVDKDGASMKAEILTWAKQRLAIVKQLHKKDEL
Ga0307401_1044731813300030670MarineVRHFNKATGYGGVAYSQKTSEAMCDELGPKNDYMNMYVEESGSTSLCNANKPEAGCSDKQKDFISKGGTKPKGDLQKQADRLTGMVDKDGASMKAEALTW
Ga0307403_1026869023300030671MarineVRHFNKETGYGGKAYVQKTETAMCDELGPKTEYMGMHIEEAGGTSLCNVTSKQGCSDQQTKFIAKWGDKAKDELQKQVDRLTGMVDKDGASMKAEALTWAKQRLNIVKKLHAKEEL
Ga0307403_1062106313300030671MarineVRHFNKATGYGGVAYSQKTSEAMCDELGPKNEYMNMYVEESGSTSLCNANKPEAGCSDKQKDFISKWGTKPKDDIQKQVDRLAGMVDKDGASMKAEALTWAKQRLAIVKQLHKKDEL
Ga0307398_1018895123300030699MarineVRHFNKATGYGGAAYAKKTSEAMCDELGPKNDYMSMHVEEAGGTSLCNANQPESGCSDKQKDFISKWGTKPKDDLQKQVDRLTGMVDKDGASMKAEALTWAKQRLAIVKQLHKKDEL
Ga0307398_1036335123300030699MarineVRHFNKATGYGGAPYAKKTGSAMCDELGPKNDYMQQYVEEAGGTSLCNANAVLEGVDSGGCSDKQREFIQKWGAMPKAELQEQVDRLMGMVDKDGESLKPEALTWAKQRLAIVKQLHKKEEL
Ga0307398_1039530123300030699MarineVRHFNTATGYGGVAYTQKTSEAMCDELGPKNDYMNMHVEEAGSTSLCNANQPESGCSDKQKEFISKWGAKPKDDLQKQVDRLTGMVDKDGASMKAEALTWAKQRLSIVKQLHKKDEL
Ga0307398_1082225413300030699MarineHGEAQNPGGGGWPTVRHFNKETGYGGKAYVQKTETAMCDELGPKTEYMGMHIEEAGGTSLCNVTSKQGCSDQQTKFIAKWGDKAKDELQKQVDRLTGMVDKDGASMKAEALTWAKQRLNIVKKLHAKEEL
Ga0307399_1016123723300030702MarineVRHFNKATGYGGKEYVKKTEEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTTTGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0307399_1024825113300030702MarineVRHFNKATGYGGAPYAKKTGGAMCDELGPKNDYMQLYIEEQGASLCSASKPDSGCSDKQKDFISKWGTKPKDELQKQVDRLTGMVDKDGESMKAEALTWAKQRLAIVKQLHKKDEL
Ga0307399_1035020313300030702MarineHGTEQGAGSGGWPTVRHFNKATGYGGQAYAQKTSEAMCDALGPKNDYMQMHVEEAGGTSLCNANNPESGCSDKQKDFISKWGTKPKDDLQKQVDRLTGMVDKDGASMKAEALTWAKQRLAIVKQLHKKDEL
Ga0307399_1035716123300030702MarineVRHFNKATGYGGAPYAKKTSSAMCDELGPKNDYMQQYVEEAGGTSLCNANAVLEGVDSGGCSDKQREFIQKWGAMPKADLQEQVDRLMDMVDKDGESLKPEALTWAKQRLAIVKQLHKKDEL
Ga0307399_1053850123300030702MarineVRHFNKATGYGGQAYAKKTSEAMCDELGPKNDYMNMFVEEAGGTSLCNANKPESGCSDKQKDFISKWGSKAKDDLQKQIDRLSGMVDKDGSSMKAESLTWAKQRLAIVKQLHKKDEL
Ga0307400_1029407213300030709MarineVRHFNKGTGYGGKEYVKKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTATGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0307400_1031930813300030709MarineVRHFNKQTGYGGEAYKQKTGDAMCDELGPKTEYMLQHIEEAGGTSLCSISNTESGCSDAQKKFIEKWGAKPKDELQKQLDRLAGLVDHKNGNSMKPEALNWAKQRASIIKQLHKKEEL
Ga0307400_1038735513300030709MarineVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFITKWGAKPKDELQKQIDRLSGMVDAAASSMKAEALIWAKKRLSIVKQLHKKEEL
Ga0307400_1041631813300030709MarineVRHFNKATGYGGEAYKQKTGEAMCDELGPKNDYMSMFVEEAGGTSLCNANTPESGCSDKQKDFISKWGAKPKDDLQKQVDRLSGMVDKDGASMKPESLTWAKQRLAIVKQLHKKDEL
Ga0307400_1062628413300030709MarineVQKTGEAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQNDFITKWGAKANDDLQKQVDRLTGMVDKDGASMKAETLTWAKQRLAIVKQLHKKDEL
Ga0073968_1195483123300030756MarineMCDELGPKEEYMQMHIEEAGGTSLCSVKNTESGCNDQQKKFIDKWGDKPKDELQKQLDRLTGMVDKDGASMKPEALSWAKQRLSIVKQLHKKDEL
Ga0073965_1157193913300030787MarineVRHFNKATGYGGQAYKQKTSQAMCDELGPKNDYMQQFVEEAGGTSLCNANKPETGCSDKQKDFIAKWGAKPKDELQKQVDRLTGMVDKDGASMKPEALTWAKQRLAIVKQLHKSEL
Ga0073990_1193826013300030856MarineTSSAMCDELGPKEEYMQMHIEEAGGTSLCSVKNTESGCNDQQKKFIEKWGDKPKDELQKQLDRLTGMVDKDGASMKPEALSWAKQRLSIVKQLHKKDEL
Ga0073963_1138046223300030859MarineMCDELGPKEEYMQMHIEEAGGTSLCSVKNTESGCNDQQKKFIEKWGDKPKDELQKQLDRLTGMVDKDGASMKPEALSWAKQRLSIVKQLHKKDEL
Ga0151494_141132123300030871MarineMCDELGPKNEYMHMHIEEAGGTSLCNANKPETGCSDKQKDFITKWGGKSKDDLQKQVERLNGMVDKDGASMKPDALTWAKQRLNIVKQLHKRDEL
Ga0073976_1168403523300030957MarineVRYFNKQTGYGGQQYAKKTDKAMCDELGPKEDYMQMFVEEAGGTSLCNVKNTENGCNDQQKKFISKWGDKEKEELQKQVDRLSGMVEKDGSSMKAEALTWAKQRLNIVKQFKKQKEEL
Ga0073950_1001370813300031459MarineVRHFNKQTGYGGQAYNKKTDKAMCDELGPKEEYMQMFVEEAGGTSLCNVKNTESGCNDQQKKFIEKWGDKAKDELQKQLDRLSGMVDKDGSSMKPEALTWAKQRLAIVKQLHKKDEL
Ga0073954_1094675723300031465MarineKAMCDELGPKEEYMQQYVEELSGASLCDVKAPDTGCSEEQKKFITKWGEKNKEELQKQVDRLGNMVEKDGASMKPDALKWAKQRLAIVKALHAKDEL
Ga0307388_1026941023300031522MarineMCDELGPKTEYMLQFVEDAGGVSQCSVSTPETGCSDQQKKFIEKWGAKPKDDLQKQIDRLAGMVDKDGASMKPDALSWAKQRMNIVKQLHKKEEL
Ga0307388_1054315723300031522MarineVRYFNKGTGYGGKGYEKKTSGAMCDELGPKNEYMQQFIEDAGGVSQCSVATPETGCSEQQKKFIAKWGEKPKDELQKQIDRLAGMVDKDGASMKPDALSWAKQRMNIVKQLHKKEEL
Ga0307388_1058386313300031522MarineVRHFNKATGYGGAPYAKKTSSAMCDELGPKNDYMQQYVEEAGGTSLCNANAVLEGVDSGGCSDKQREFIQKWGAEPKADLQKQVDRLMGMVDKDGESLKPEALTWAKQRLAIVKQLHKKEEL
Ga0307388_1078780413300031522MarineQGAGSGGWPTVRHFNKQTVYGGAKYEQKTKDAMCDELGPKTDYMAIHIEEAGGTSLCNATTEQGCSDEQKKFISKWGGKPQDELQKQLDRLSGMVDKDGGSMKAESLAWAKKRLAIVKQLHKKEEL
Ga0307388_1100275313300031522MarineTDEAMCTELGPGKEYMQMHIEEAGGTSLCSVNDTSSGCSDQQKKFIEKWSAKPKDDIQKQVDRLNGMVDKDGASMKPEALTWAKQRLAIVKALHKKEAKEEL
Ga0308132_105947713300031580MarineVRYFNKGTGYGGKGYEKKTSSAMCDELGPKNEYMQQFIEDAGGVSQCIVATPETGCSDQQKKFIAKWGEKPKDELQKQIDRLSGMVDKDGASMKPEALSWAKQRMNIVKQLHKKEEL
Ga0308132_108065613300031580MarineVRHFNKQTGYGGEAYKQKTRDAMCDELGPKTDNMLLHIEEAGGTSLCSISNTESGCSDAQKKFIEKWGAKPKDELQKQLDRLAGMIDKDGNSMKPEALTWAKQRASIVKQLHKKEEL
Ga0307393_111416813300031674MarineNKATGYGGAAYVKKTSEAMCDELGPKNDYMNMHVEEAGSTSLCNANQPESGCSDKQKEFISKWGAKPKDDLQKQVDRLTGMVDKDGASMKAEALTWAKQRLSIVKQLHKKDEL
Ga0307385_1014521213300031709MarineVRHFNKATGYGGTAYVKKTEEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTSTGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0307385_1015540723300031709MarineVRHFNKATGYGGQAYAKKTSEAMCDELGPKNDYMSMYVEEAGGTSLCNANKPESGCSDKQKDFISKWGTKPKDDLQKQVDRLTGMVDKDGASMKAEALTWAKQRLAIVKQLHKKDEL
Ga0307385_1032500513300031709MarineVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFISKWGAKPKDELQKQIDRLSGMVDKDGSSMKAEALTWAKQRLAVVKQLHKKDEL
Ga0307386_1041951823300031710MarineVKKTSEAMCDELGPKNDYMSMFVEEAGGTSLCNANKPESGCSDKQKDFISKWGTKPKDELQKQVDRLTGMVDKDGASMKAEALTWAKQRLAIVKQLHKKD
Ga0307386_1065180913300031710MarineKATGYGGAAYEKKTSSAMCDELGPKNDYMQQYVEAAGGTSLCNANAPDGGCSDKQKEFIVKWGGKPKDDLQKQVDRLIGMVDKDGGSLNPEALTWAKQRLAIVKQLHKKEEL
Ga0307386_1065804613300031710MarineVRHFNKATGYGGQPYAKKTSEAMCDELGPKNDYMQMYVEEAGGTSQCNANKPESGCSDKQKDFISKWGTKPKDDLQKQVDRLTGMVDKDGASMKAEALTWAKQRLAIVKQLHKKDEL
Ga0307386_1079312613300031710MarineGDAMCDELGPKTDYMQMHIEEAGGTSMCNAKNPESGCTDQQKKFIEKWGDKPKDELQKQVDRLAGMVDKDGASMKPEALTWAKQRLAIVKQLHKKDEL
Ga0307396_1027171213300031717MarineVRHFNKATGYGGEAYVKKTSEAMCDELGPKNDYMNMYVEEAGGTSLCNANQPEAGCSDKQKDFISKWGAKPKDDLQKQVDRLTGMVDKDGASMKAETLTWAKQRLAIVKQLHKKDEL
Ga0307396_1031719823300031717MarineVRHFNKATGYGGAPYEKKTSSAMCDELGPKNDYMQQYVEAAGGTSLCNANAPDGGCSDKQKEFIVKWGGKPKDDLQKQVDRLIGMVDKDGGSLNPEALTWAKQRLAIVKQLHK
Ga0307396_1040801513300031717MarinePTVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFITKWGAKPKDELQKQIDRLSGMVDAAASSMKAEALTWAKKRLSIVKQLHKKEEL
Ga0307396_1045013913300031717MarinePTVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVVEAGGTSLCNANKPDSGCSDKQKEFISKWGTKPKDELQKQVDRLSGMVDKDGSSMKAEALTWAKQRLAIVKQLHKKDEL
Ga0307396_1051032613300031717MarineKKTSEAMCDELGPKNDYMNMFVEEAGGTSLCNANKPESGCSDKQKDFISKWGSKAKDDLQKQIDRLSGMVDKDGSSMKADSLTWAKQRLAMVKQLHKRDEL
Ga0307381_1007475723300031725MarineVRHFNKATGYGGTAYVKKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTSTGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0307381_1018383923300031725MarineVRHFNKATSYGGAPYAKKTSSAMCDELGPKNDYMNMFVEEAGGTSLCNANKPESGWSDKQEDFISKWGTKPKDDLQTQIDRLSGMVDKDGSSLKAESLTWAKQRLAMVKQLHKKDEL
Ga0307391_1029363023300031729MarineVRHFNKATGYGGQAYVQKTSTAMCDELGPKNDYMQQHVEEAGGTSLCNANKPESGCSDKQKDFITKWGEKPKDDLQKQVERLTGMVDKDGASMKAESLTWAKQRLAIVKQLHKKDEL
Ga0307391_1035810413300031729MarineVRFFNKGTGLGGEAYKQKTSTAMCDELGPKTEYMLQFVEDAGGVSQCSVSTPETGCSDQQKKFIAKWGEKPKDELQKQIDRLAGMVDKDGASMKPDALSWAKQRMNIVKQLHKKEEL
Ga0307391_1037361413300031729MarineVRHFNKATGYGGAPYAKKTSSAMCDELGPKNDYMQQYVEEAGGTSLCNANAVLEGVDSGGCSDKQREFIQKWGAKPKADLQEQVDRLMVMVDKDGESLKPEALTWAKQRLAIVKQLHKKEEL
Ga0307391_1046205313300031729MarineTIHGTAQSPGSGGWPTVRHFNKATGYGGEAYVQKTSEAMCDELGPKNDYMQKLVEEAGGTSLCNANKPETGCSDKQNDFITKWGAKANDDLQKQVDRLTGMVDKDGASMKAETLTWAKQRLAIVKQLHKKDEL
Ga0307391_1054297223300031729MarineVRHFNKATGYGGVAYSQKTSEAMCDELGPKNDYMNMYVEESGSTSLCNANKPEAGCSDKQKDFISKWGTKPKDDLQKQADRLTGMVDKDGASMKAEVLTWAKQRLAIVKQLHKKDEL
Ga0307391_1072094413300031729MarineVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFITKWGAKPKDELQKQIDRLSGMVDAAASSMKAEALTWAKKRLSIVKQLHKK
Ga0307391_1089049213300031729MarineVRHFNKQTGYGGEAYKQKTGDAMCDELGPKTEYMLQHIEEAGGTSLCSISNTESGCSDAQKKFIEKWGAKPKDELQKQLDRLAGLVDHKNGNSMKPEALSWAKQ
Ga0307397_1014886423300031734MarineVRHFNKATGYGGEAYVKKTSEAMCDELGPKNDYMNMYVEEAGATSLCNANKPEAGCSDQQKGFISKWGAKPKDDLQKQVDRLTGMVDKDGASMKAEALTWAKQRLAIVKQLHKKDEL
Ga0307397_1020233623300031734MarineVRHFNKATGYGGAPYAKKTGSAMCDELGPKNDYMQQYVEEAGGTSLCNANAVLEGVDSGGCSDKQREFIQKWGAMPKADLQEQVDRLMGMVDKDGESLKPEALTWAKQRLAIVKQLHKKEEL
Ga0307397_1020515323300031734MarineVRHFNKATGYGGQAYAQKTSEAMCDELGPKNDYMQMHVEEAGGTSLCNANKPESGCSDKQKDFISKWGTKPKDDLQKQVDRLTGMVDKDGASMKAEALTWAKQRLAIVKQLHKKDEL
Ga0307397_1032122223300031734MarineVRHFNKATGYGGQAYVQKTSTAMCDELGPKNDYMQQHVEEAGGTSLCNANKPESGCSDKQKDFITKWGEKPKDDLQKQVERLTGMVDKDGASMKAESL
Ga0307397_1045745913300031734MarineQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPDSGCSDKQKEFISKWGTKPKDELQKQVDRLSGMVDKDGSSMKAEALTWAKQRLAIVKQLHKKDEL
Ga0307397_1045796813300031734MarineQGAGGGGWPTVRHFNKATGYGGTAYVKKTEEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTTTGCSDKQKDFIGKWNSKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLSIVTSLHKGPSKDEL
Ga0307394_1012094923300031735MarineMCDELGPKTEYMLQFVEDAGGVSQCSVSTPETGCSDQQKKFIAKWGEKPKDELQKQIDRLAGMVDKDGASMKPDALSWAKQRMNIVKQLHKKEEL
Ga0307394_1019759413300031735MarineVRHFNKATGYGGEAYVKKTSEAMCDELGPKNDYMNMYVEEAGGTSLCNANQPEAGCSDKQKDFISKWGAKPKDDLQKQVDRLTGMVDKDGASMKAEALTWAKQRLAIVKQLHKKDEL
Ga0307394_1020423413300031735MarineVRHFNKATGYGGTAYVKKTEEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTATGCSDQQKNFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0307394_1029504913300031735MarineVRSFNKASGYGGQAYVQKTSEAMCDELGPKNDYMSMFVEEAGGTSLCNANKPESGCSDKQTEFITKWGAKPKDELQKQVDRLSGMVDKDGASMKQESLTWAKQRLSIVKQLHKKDEL
Ga0307394_1029924013300031735MarineVRHFNKATGYGGEAYKKKTSEAMCDELGPKNDYMNMYVEESGGTSLCNANKPDTGCSEKQIEFIGKWGTKPKDDLQKQVDRLTGMVEKDGSSMKAEALTWAKQRLAIVKQLHKKDNKDEL
Ga0307387_1024448323300031737MarineVRHFNKATGYGGEAYKQKTSTAMCDELGPKNDYMQQLVEEAGGTSLCNANNPETGCSDKQKDFIAKWGTKPKDDLQKQVDRLMGMVDKDGASMKPEALTWAKQRLAIVKQLHKKDEL
Ga0307387_1025677623300031737MarineVRHFNKQTGYGGEAYKQKTGDAMCDELGPNTEYMLQHIEEAGGTSLCSISNTESGCSDAQKKFIEKWGAKPKDELQKQLDRLAGLVDHKNGNSMKPEALNWAKQRASIIKQLHAKEEL
Ga0307387_1036908013300031737MarineVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFISKWGAKPKDELQKQIDRLSGMVDAAASSMKAEALTWAKKRLSIVKQLHKKDEL
Ga0307387_1038453913300031737MarineVRSFNKASGYGGQAYVQKTGDAMCDELGPKNDYMSMFVEEAGGTSLCNANKPESGCSDKQTEFITKWGAKPKDELQKQVDRLSGMVDKDGASMKQESLTWAKQRLSIVKQLHKKDEL
Ga0307387_1044442723300031737MarineVRHFNKATGYGGKAYEQKTSTAMCDELGPKTDYMQLHVEEAGGTSLCNASKPDSGCSDQQKKFIAKWGDKPKDELQKQVDRLAGMVEKDGASMKPEALTWAKQRLAIVKSLHKKDEL
Ga0307387_1060208413300031737MarineVRHFNKATGYGGAPYAKKTSSAMCDELGPKNDYMQQYVEEAGGTSLCNANAVLEGVDSGGCSDKQREFIQKWGAKPKADLQEQVDRLMVMVDKDGESLKPEALTWAKQRLAIVKQL
Ga0307387_1075811813300031737MarineAMCTELGPGKEYMQMHIEEAGGTSLCSVNDTSSGCSDQQKKFIEKWSAKPKDDIQKQVDRLNGMVDKDGASMKPEALTWAKQRLAIVKALHKKEAKEEL
Ga0307387_1077945713300031737MarineVRFFNKKTGYGGEAYKQKTDKGMCDELGPKEDYMQMFVEEAGGVSLCGVNKSDQGCTDQQKKFIAKWGDKDKDELQKQIDRLSVMVEKDADSMKADALTWVKQRLNLVKQFKKIKDEL
Ga0307387_1082953113300031737MarineVRHFNKATGYGGQAYVKKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFISKWGAKAKDDLQKQVDRLTGMVDKDGASMKPEAL
Ga0307387_1097266513300031737MarineNKATGYGGKAYEQKTKTAMCDELGPNTDYMQQLVEEAAGTSLCNAKEPGAGCTEKQTTFIEKWGSKGEAELLKQLERLSGMVEKDGSSMKPEVFAWAKQRLSIFKQLTKKDEL
Ga0307384_1029360513300031738MarineVRHFNKATGYGGTAYVKKTEEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTATGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVK
Ga0307384_1032052113300031738MarineVRHFNKQTGYGGKKYEQKTSQAMCDELGPKTEYMLQHIEEAAGTSQCNLATSEGCSDQQKKFIEKWNGKPKDELQKQVDRLGGMVDKDGASMKPDALTWAKQRLNIVKALHKKDEL
Ga0307384_1046023323300031738MarineQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPVTGCSDKQKDFITKWGAKPKDELQKQIDRLSGMVDAAASSMKAEALTWAKQRLAMVKQLHKKDEL
Ga0307384_1050611913300031738MarineKTSEAMCDELGPKNDYMNMYVEEAGGTSLCNANKPEAGCSDKQKDFISKWGAKPKDDLQKQVDRLTGMVDKDGASMKAETLTWAKQRLAIVKQLHKKDEL
Ga0307383_1014503013300031739MarineVRHFNKATGYGGTAYVKKTEEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTATGCSDKQKDFIGKWNSKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0307383_1015596713300031739MarineVRQFNKATGYGGQAYVQKTGEAMCDELGPKNDYMNMFVEEAGGTSLCNANKPDSGCSDKQKEFISKWGTKPKDELQKQVDRLSGMVDKDGSSIKAEALTWAKQRLAIVKQLHKKDEL
Ga0307395_1016990623300031742MarineVRHFNKATGYGGTAYVKKTEEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTTTGCSDKQKDFIGKWNSKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGPSKDEL
Ga0307395_1036403023300031742MarineVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFITKWGAKPKDELQKQIDRLSGMVDAAASSMKAEALTWAKKRLSIVKQLHKKQEL
Ga0307395_1042467213300031742MarineVRHFNKNTGYGGKAYEKKTGAAMCDELGPKNDYMEMHIKAAGGASLCNIDNTEHGCSDQQKKFIEFWGYKAKDELQKQVDRLTVMVDKDGASMKAEALTWAKQRLAIVKELRTKDEL
Ga0307395_1048281313300031742MarineTSEAMCDELGPKNDYMNMYVEESGGTSLCNANKPDTGCSEKQIEFIGKWGTKPKDDLQKQVDRLTGMVEKDGSSMKAEALTWAKQRLAIVKQLHKKDNKDEL
Ga0307382_1030341413300031743MarineVRHFNKATGYGGKAYEQKTSTAMCDELGPKTDYMQLHVEEAGGTSLCNASKPDSGCSDQQKKFIAKWGDKPKDELQKQVDRLAGMVEKDGASMKPEAL
Ga0307382_1042457023300031743MarineVRHFNKATGYGGQAYVQKTGEAMCDELGPKNDYMNMFVEEAGGTSLCNANKPDSGCSDKQKEFISKWGTKPKDELQKQVDRLSGMVDKDGSSMKAEALTWAKQRLAIVKQLHKKDE
Ga0307389_1033217813300031750MarineMCDELGPKTEYMLQHIEEAGGTSLCSISNTESGCSDAQKKFIEKWGAKPKDELQKQLDRLAGLVDHKNGNSMKPEALNWAKQRASIIKQLHKKEEL
Ga0307389_1040189113300031750MarineVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEDAGGTSLCNANKPETGCSDKQKDFITKWGAKPKDELQKQIDRLSGMVDAAASSMKAEALTWAKKRLSIVKQLHKKEEL
Ga0307389_1065647223300031750MarineVRHFNKATGYGGQAYAQKTKEAMCDELGPKNDYMQQLVEEAGGTSLCNAKKPEAGCSDKQKDFITKWDAKPKGDLQKQVERLTGMVDKDGASMKPEALTWAKQRLAIVKQLHKDEL
Ga0307389_1081617913300031750MarineCTELGPGKEYMQMHIEEAGGTSLCNVNDTSNGCSDQQKKFIEKWNAKPKDDIQKQVDRLLGMVDKDGASMKPEALTWAKQRLAIVKALHKKEAKEEL
Ga0307389_1083977113300031750MarineTVRHFNKATGYGGQAYVQKTSTAMCDELGPKNDYMQQHVEEAAGTSLCNAIKPESGCSDKQKDFITKWGEKPKDDLQKQVERLTGMVDKDGASMKAESLTWAKQRLAIVKQLHKKDEL
Ga0307404_1026656023300031752MarineVRSFNKASGYGGQAYVQKTGDAMCDELGPKNDYMSMFVEEAGGTSLCNAIKPESGCSDKQQEFISKWGAKPKDELQKQVDRLSGMVDKDGASMKAESLTWAKQ
Ga0307404_1027636813300031752MarineVRHFNKATGYGGAPYAKKTGSAMCDELGPKNDYMQQYVEEFGSSLCNANTPDSGCSDKQKEFIAKWGAKPKADLQKQVDRLIGMVDKDGGSLNPEALTWAKQR
Ga0307404_1035174913300031752MarineAQGAGSGGWPTVRHFNKQTGYGGEAYKQKTGDAMCDELGPKTEYMLQHIEEAGGTSLCSISNTESGCSDAQKKFIEKWGAKPKDELQKQLDRLAGLVDHKNGNSMKPEALNWAKQRASIIKQLHAKEEL
Ga0307404_1039817813300031752MarineVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNANKPETGCSDKQKDFISKWGAKPKDELQKQIDRLSGMVDKDGSSLKAESLTWAKQRLAMVKQLHKRDEL
Ga0073946_105489413300032153MarineVRHFNKQTGYGGQAYNKKTDKAMCDELGPKEEYMQMFVEEAGGTSLCNVKNTESGCNDQQKKFIEKWGDKAKDELQKQLDRLSGMVDKDGSSMKPEALTWAKQRLAIVKQ
Ga0314684_1022353513300032463SeawaterVRHFNKATGYGGEAYKQKTSTAMCDELGPKNDYMQQFVEEAGGTSLCNANKPETGCSDKQKDFIAKWGAKPKDDLQKQVDRLMGMVDKDGASMKPEALTWAKQRLAMVKQLHKKDEL
Ga0314684_1082134023300032463SeawaterVRHFNKATGYGGQAYIQKTSTAMCDELGPKNDYMQQYVEEAAGTSLCNANKPDTGCSDKQTDFIAKWGAKPKDELQKQVDRLMGMVDKDGASMK
Ga0314675_1061618713300032491SeawaterVRHFNKATGYGGEAYKQKTSTAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQKDFIGKWGAKPKDELQKQVDRLTGMVDKDGASMKPESLTWAKQRLAIVKQLHKKDEL
Ga0314679_1012753223300032492SeawaterVRHFNKATGYGGAPYAKKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTAKGCSDKQKDFIGKWNEKSKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKKDEL
Ga0314688_1050031913300032517SeawaterVRHFNKATGYGGAPYAKKTDEAMCDELGPKHDYMQLHIEEAGGTSLCNVNDTTTGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGLSKDEL
Ga0314688_1053061613300032517SeawaterVRHFNKATGYGGQAYSQKTSQAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQKDFISKWGSKPKGDLQKQVDRLTGMVDKDGSSMKPEALTWAKQRLAIVKQLHKKDEL
Ga0314689_1031126313300032518SeawaterVRHFNKATGYGGQAYSQKTSQAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQKDFISKWGSKPKGDLQKQVDRLTGMVDKDGSSMKPEALTWAKQRLAIVKQLHKKEEL
Ga0314676_1077784613300032519SeawaterGWPTVRHFNKATGYGGAPYAKKTDEAMCDELGPKHDYMQLHIEEAGGTSLCNVNDTTTGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGLSKDEL
Ga0314680_1085859313300032521SeawaterGWPTVRHFNKGTGYGGKAYEQKTQTAMCDELGPKTEYMHMHVEEAGGTSLCSINDTSSGCTDKQKDFISKWSGKPKDELQKQLDRLTGMVDKDGASMKPEARTWAKQRLTIVKQLHKKDE
Ga0314682_1039184223300032540SeawaterVRHFNKATGYGGEAYKQKTSTAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQKDFIAKWGAKAKDELQKQVDRLTGMVDKDGASMKPEALTWAKQRLAMVKQLHKKDEL
Ga0314682_1049670113300032540SeawaterMRYFNKETGYGGKAYVQKTQTAMCDELGPKTEYMGMHIEEAAGTSLCNVTTKQGCSDQQTKFIAKWGDKAKDELQKQVDRLTGMVDKDGASMKAEALTWAKQRLNIVKKLHAKEEL
Ga0314674_1058144013300032615SeawaterVRHFNKATGYGGAPYAKKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTAKGCSDKQKDFIGKWNEKSKDDLQKQVDRLTGMVEKDGASMKPE
Ga0314685_1032444613300032651SeawaterVRHFNKATGYGGQAYAQKTSTAMCDELGPKNDYMQQYVEEAGGTSLCNANKPEAGCSDKQKDFIAKWGAKPKDELQKQVDRLTGMVDKDGASMKPESLTWAKQRLAIVKQLHKKEEL
Ga0314687_1015770513300032707SeawaterVRHFNKATGYGGAPYAKKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTAKGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKKDEL
Ga0314681_1044622023300032711SeawaterVRHFNKATGYGGAPYAKKTDEAMCDELGPKHDYMQLHIEEAGGTSLCNVNDTTTGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPE
Ga0314681_1057871813300032711SeawaterVRHFNKATGYGGAPYAKKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTAKGCSDKQKDFIGKWNEKSKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGLSKDEL
Ga0314690_1033728613300032713SeawaterVRHFNKATGYGGAPYAKKTDEAMCDELGPKHDYMQLHIEEAGGTSLCNVNDTTTGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGRVEKDGASMKPEALTWAKHRLALVKSLHKKED
Ga0314686_1018164013300032714SeawaterVRHFNKATGYGGEAYKQKTSTAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQKDFIAKWGAKAKDELQKQVDRLTGMVDKDGASMKPETLTWAKQRLAIVKQLQKKEEL
Ga0314703_1033506813300032723SeawaterGYGGKAYVQKTQTAMCDELGPKTEYMGMHIEEAGGTSLCNVTTKQGCSDQQTKFIAKWGDKAKDELQKQVDRLTGMVDKDGASMKAEALTWAKQRLNIVKKLHAKEEL
Ga0314693_1047371313300032727SeawaterFNKATGSGGAPYAKKTDEAMCDELGPKHDYMHLHIEEAGGTSLCNVNDTAKGCSDKQKDFIGKWNEKSKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKKDEL
Ga0314714_1067922613300032733SeawaterRHFNKATGYGGAPYAKKTDEAMCDELGPKHDYMQLHIEEAGGTSLCNVNDTTTGCSDKQKDFIGKWNAKPKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKGLSKD
Ga0314714_1075809013300032733SeawaterVRHFNKATGYGGQAYKQKTSQAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQKDFIGKWGAKPKDDLQKQVDRLMGMVDKDGASMKP
Ga0314707_1012489713300032743SeawaterMCDELGPKHDYMHLHIEEAGGTSLCNVNDTAKGCSDKQKDFIGKWNEKSKDDLQKQVDRLTGMVEKDGASMKPEALTWAKQRLAIVKSLHKKDEL
Ga0314707_1030726013300032743SeawaterVRHFNKATGYGGEAYKQKTSTAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQKDFIGKWGAKPKDDLQKQVDRLMGMVDKDGASMKPEALTWAKQRLAIVKQIHKKDEL
Ga0314705_1066860523300032744SeawaterVRHFNKATGYGGQAYAQKTSTAMCDELGPKNDYMQQYVEEAGGTSLCNANKPEAGCSDKQKDFIAKWGAKPKDELQKQVDRLTGMVDKDGASMK
Ga0314704_1044897213300032745SeawaterVRHFNKATGYGGEAYKQKTSTAMCDELGPKNDYMQQFVEEAGGTSLCNANKPETGCSDKQKDFIAKWDAKPKDELQKQVDRLPGMVDKDGASMKPEALTWAKQRLAMVKQLHKKDEL
Ga0314713_1043520613300032748SeawaterVRHFNKATGYGGEAYKQKTSTAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQKDFIAKWGAKPKDELQKQVDRLTGMVDKDGASMKPESLTWAKQRLAIVKQLHKKDEL
Ga0314700_1057023813300032752SeawaterGWPTVRHFNKATGYGGEAYKQKTSTAMCDELGPKNDYMQQLVEEAGGTSLCNANKPETGCSDKQKDFIGKWGAKPKDDLQKQVDRLMGMVDKDGASMKPEALTWAKQRLAIVKQIHKKDE
Ga0307390_1039208413300033572MarineVRQFNKATGYGGQAYVQKTSEAMCDELGPKNDYMTMFVEEAGGTSLCNVNKQETGCSDKQKDFISKWGAKPKDELQKQIDRLSGMVDKDGSSLKAESLTWAKQRLAMVKQLHKKDEL
Ga0307390_1043804823300033572MarineVRHFNKATGYGGEAYKKKTSEAMCDELGPKNDYMNMYVEESGGTSLCNANKPDTGCSEKQIEFIGKWGTKPQDDLQKQVDRLTGMVEKDGSSMKAEALTWAKQRLAIVKQLHKKDNKDEL
Ga0307390_1058041613300033572MarineVRHFNKATGYGGAPYAKKTSSAMCDELGPKNDYMQQYVEEAGGTSLCNANAVSEGVDSGGCSDKQREFIQKWGAEPKADLQKQVDRLMGMVDKDGESLKPEALTWAKQRLAIVKQLHKKDEL
Ga0307390_1061567413300033572MarineVRHFNKATGYGGQAYAKKTSEAMCDELGPKNDYMNMFVEEAGGTSLCNANKPESGCSDKQKDFISKWGSKAKDDLQKQIDRLSGMVDKDGSSMKAD
Ga0307390_1091913413300033572MarineVRHFNTATGYGGVAYTQKTSEAMCDELGPKNDYMNMYVEESGSTSLCNANKPEAGCSDKQKDFISKWGTKPKDDLQKQADRLTGMVDKDGASMKAEVLTWAKQRLAIVKQLHKKDEL
Ga0307390_1098680413300033572MarineVRHFNKATGYGGAPYEKKTSSAMCDELGPKNDYMQQYVEAAGGTSLCNANAPDGGCSDKQKEFIVKWGGKPKDDLQKQVDRLIGMVDKDGGSLNPEALTWAKQRLAIVKQLHKKDEL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.