| Basic Information | |
|---|---|
| Family ID | F017916 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 238 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VLLFFYRRIVQDKAKVTFREEVPTEPTPEQMALLREEAAVPAD |
| Number of Associated Samples | 195 |
| Number of Associated Scaffolds | 238 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.26 % |
| % of genes near scaffold ends (potentially truncated) | 97.90 % |
| % of genes from short scaffolds (< 2000 bps) | 94.96 % |
| Associated GOLD sequencing projects | 181 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.244 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.008 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.588 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.739 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 238 Family Scaffolds |
|---|---|---|
| PF01266 | DAO | 18.07 |
| PF00582 | Usp | 4.20 |
| PF01614 | IclR | 3.36 |
| PF12730 | ABC2_membrane_4 | 2.52 |
| PF01979 | Amidohydro_1 | 2.10 |
| PF01186 | Lysyl_oxidase | 1.68 |
| PF02771 | Acyl-CoA_dh_N | 1.26 |
| PF09339 | HTH_IclR | 1.26 |
| PF05721 | PhyH | 0.84 |
| PF13732 | DUF4162 | 0.84 |
| PF03741 | TerC | 0.84 |
| PF07729 | FCD | 0.84 |
| PF00009 | GTP_EFTU | 0.42 |
| PF01268 | FTHFS | 0.42 |
| PF13520 | AA_permease_2 | 0.42 |
| PF00871 | Acetate_kinase | 0.42 |
| PF12679 | ABC2_membrane_2 | 0.42 |
| PF03486 | HI0933_like | 0.42 |
| PF04389 | Peptidase_M28 | 0.42 |
| PF00392 | GntR | 0.42 |
| PF13594 | Obsolete Pfam Family | 0.42 |
| PF00486 | Trans_reg_C | 0.42 |
| PF10609 | ParA | 0.42 |
| PF08028 | Acyl-CoA_dh_2 | 0.42 |
| PF04149 | DUF397 | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 238 Family Scaffolds |
|---|---|---|---|
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 3.36 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.68 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.84 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.84 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.84 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.84 |
| COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 0.84 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.42 |
| COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 0.42 |
| COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 0.42 |
| COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 0.42 |
| COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 0.42 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.42 |
| COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 0.42 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.42 |
| COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 0.42 |
| COG2759 | Formyltetrahydrofolate synthetase | Nucleotide transport and metabolism [F] | 0.42 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.42 |
| COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 0.42 |
| COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.24 % |
| All Organisms | root | All Organisms | 40.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig19331 | Not Available | 717 | Open in IMG/M |
| 2170459022|GZEQPF101ECHAM | Not Available | 502 | Open in IMG/M |
| 2189573001|GZR05M101B2TTO | Not Available | 513 | Open in IMG/M |
| 3300001356|JGI12269J14319_10191122 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300002910|JGI25615J43890_1062336 | Not Available | 630 | Open in IMG/M |
| 3300004139|Ga0058897_11082328 | Not Available | 510 | Open in IMG/M |
| 3300004157|Ga0062590_101691165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300004633|Ga0066395_10307457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 869 | Open in IMG/M |
| 3300005162|Ga0066814_10056784 | Not Available | 658 | Open in IMG/M |
| 3300005167|Ga0066672_10149708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1463 | Open in IMG/M |
| 3300005172|Ga0066683_10230309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1147 | Open in IMG/M |
| 3300005179|Ga0066684_11058356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300005186|Ga0066676_11178418 | Not Available | 502 | Open in IMG/M |
| 3300005332|Ga0066388_106260941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 600 | Open in IMG/M |
| 3300005434|Ga0070709_10226495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1336 | Open in IMG/M |
| 3300005434|Ga0070709_11539614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 540 | Open in IMG/M |
| 3300005435|Ga0070714_102031687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 560 | Open in IMG/M |
| 3300005435|Ga0070714_102408590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300005436|Ga0070713_102467396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300005439|Ga0070711_101423549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 603 | Open in IMG/M |
| 3300005447|Ga0066689_10674482 | Not Available | 648 | Open in IMG/M |
| 3300005468|Ga0070707_101647383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 609 | Open in IMG/M |
| 3300005518|Ga0070699_100328208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1376 | Open in IMG/M |
| 3300005518|Ga0070699_102169898 | Not Available | 507 | Open in IMG/M |
| 3300005529|Ga0070741_10695312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
| 3300005537|Ga0070730_10131674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia spinosispora | 1709 | Open in IMG/M |
| 3300005538|Ga0070731_10263266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1144 | Open in IMG/M |
| 3300005545|Ga0070695_101139596 | Not Available | 640 | Open in IMG/M |
| 3300005563|Ga0068855_101173641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
| 3300005569|Ga0066705_10392945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 870 | Open in IMG/M |
| 3300005574|Ga0066694_10223117 | Not Available | 894 | Open in IMG/M |
| 3300005764|Ga0066903_107138776 | Not Available | 578 | Open in IMG/M |
| 3300006028|Ga0070717_10456951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1151 | Open in IMG/M |
| 3300006046|Ga0066652_101478871 | Not Available | 631 | Open in IMG/M |
| 3300006058|Ga0075432_10110986 | Not Available | 1022 | Open in IMG/M |
| 3300006059|Ga0075017_100246467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces ureilyticus | 1306 | Open in IMG/M |
| 3300006059|Ga0075017_101621810 | Not Available | 511 | Open in IMG/M |
| 3300006102|Ga0075015_100755898 | Not Available | 581 | Open in IMG/M |
| 3300006163|Ga0070715_10592578 | Not Available | 648 | Open in IMG/M |
| 3300006175|Ga0070712_100239198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1446 | Open in IMG/M |
| 3300006175|Ga0070712_100329053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1244 | Open in IMG/M |
| 3300006175|Ga0070712_101611436 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006175|Ga0070712_101992765 | Not Available | 508 | Open in IMG/M |
| 3300006604|Ga0074060_11869589 | Not Available | 938 | Open in IMG/M |
| 3300006605|Ga0074057_10071650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1061 | Open in IMG/M |
| 3300006804|Ga0079221_11287138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300006844|Ga0075428_100563202 | Not Available | 1218 | Open in IMG/M |
| 3300006852|Ga0075433_11142624 | Not Available | 677 | Open in IMG/M |
| 3300006871|Ga0075434_100676666 | Not Available | 1050 | Open in IMG/M |
| 3300006903|Ga0075426_11534026 | Not Available | 507 | Open in IMG/M |
| 3300009162|Ga0075423_11588233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300009523|Ga0116221_1133438 | Not Available | 1086 | Open in IMG/M |
| 3300009672|Ga0116215_1198364 | Not Available | 884 | Open in IMG/M |
| 3300009698|Ga0116216_10668790 | Not Available | 624 | Open in IMG/M |
| 3300010047|Ga0126382_10386135 | Not Available | 1087 | Open in IMG/M |
| 3300010048|Ga0126373_10012223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 6996 | Open in IMG/M |
| 3300010048|Ga0126373_10339046 | Not Available | 1512 | Open in IMG/M |
| 3300010048|Ga0126373_11168357 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300010049|Ga0123356_13845311 | Not Available | 518 | Open in IMG/M |
| 3300010152|Ga0126318_10198488 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010152|Ga0126318_10554880 | Not Available | 609 | Open in IMG/M |
| 3300010154|Ga0127503_10184077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
| 3300010154|Ga0127503_10478503 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300010154|Ga0127503_10760075 | Not Available | 866 | Open in IMG/M |
| 3300010325|Ga0134064_10185185 | Not Available | 739 | Open in IMG/M |
| 3300010358|Ga0126370_11045078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 749 | Open in IMG/M |
| 3300010359|Ga0126376_10664712 | Not Available | 996 | Open in IMG/M |
| 3300010360|Ga0126372_12539406 | Not Available | 564 | Open in IMG/M |
| 3300010361|Ga0126378_10128992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 2546 | Open in IMG/M |
| 3300010361|Ga0126378_12897891 | Not Available | 547 | Open in IMG/M |
| 3300010364|Ga0134066_10234981 | Not Available | 626 | Open in IMG/M |
| 3300010366|Ga0126379_11364274 | Not Available | 815 | Open in IMG/M |
| 3300010366|Ga0126379_12695198 | Not Available | 594 | Open in IMG/M |
| 3300010371|Ga0134125_10853971 | Not Available | 1000 | Open in IMG/M |
| 3300010376|Ga0126381_101511849 | Not Available | 970 | Open in IMG/M |
| 3300010376|Ga0126381_102936059 | Not Available | 678 | Open in IMG/M |
| 3300010376|Ga0126381_104510749 | Not Available | 537 | Open in IMG/M |
| 3300010379|Ga0136449_102164470 | Not Available | 813 | Open in IMG/M |
| 3300010396|Ga0134126_10486419 | Not Available | 1424 | Open in IMG/M |
| 3300010398|Ga0126383_11307051 | Not Available | 815 | Open in IMG/M |
| 3300010398|Ga0126383_11695161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300010398|Ga0126383_13438963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 517 | Open in IMG/M |
| 3300010401|Ga0134121_11396463 | Not Available | 710 | Open in IMG/M |
| 3300011078|Ga0138565_1138229 | Not Available | 973 | Open in IMG/M |
| 3300011270|Ga0137391_10641180 | Not Available | 887 | Open in IMG/M |
| 3300012359|Ga0137385_10269366 | Not Available | 1470 | Open in IMG/M |
| 3300012363|Ga0137390_10547560 | Not Available | 1128 | Open in IMG/M |
| 3300012515|Ga0157338_1004071 | Not Available | 1247 | Open in IMG/M |
| 3300012922|Ga0137394_10654165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 886 | Open in IMG/M |
| 3300012924|Ga0137413_10221050 | Not Available | 1285 | Open in IMG/M |
| 3300012930|Ga0137407_10646777 | Not Available | 994 | Open in IMG/M |
| 3300012957|Ga0164303_10423955 | Not Available | 829 | Open in IMG/M |
| 3300012960|Ga0164301_10135437 | Not Available | 1481 | Open in IMG/M |
| 3300012971|Ga0126369_10735762 | Not Available | 1065 | Open in IMG/M |
| 3300012971|Ga0126369_10780889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1036 | Open in IMG/M |
| 3300012977|Ga0134087_10282944 | Not Available | 771 | Open in IMG/M |
| 3300012985|Ga0164308_10553959 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300012985|Ga0164308_11692041 | Not Available | 587 | Open in IMG/M |
| 3300012985|Ga0164308_11982968 | Not Available | 543 | Open in IMG/M |
| 3300012988|Ga0164306_11130762 | Not Available | 653 | Open in IMG/M |
| 3300012989|Ga0164305_10561566 | Not Available | 910 | Open in IMG/M |
| 3300013297|Ga0157378_11720262 | Not Available | 674 | Open in IMG/M |
| 3300013831|Ga0120126_1027417 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300014165|Ga0181523_10281614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300014166|Ga0134079_10093642 | Not Available | 1136 | Open in IMG/M |
| 3300014745|Ga0157377_11724643 | Not Available | 506 | Open in IMG/M |
| 3300014968|Ga0157379_10008219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 9061 | Open in IMG/M |
| 3300014968|Ga0157379_11379301 | Not Available | 683 | Open in IMG/M |
| 3300015373|Ga0132257_100410844 | Not Available | 1647 | Open in IMG/M |
| 3300016294|Ga0182041_10530078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1026 | Open in IMG/M |
| 3300016371|Ga0182034_11239731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 649 | Open in IMG/M |
| 3300016422|Ga0182039_10547851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1005 | Open in IMG/M |
| 3300017924|Ga0187820_1026900 | Not Available | 1474 | Open in IMG/M |
| 3300017924|Ga0187820_1168541 | Not Available | 669 | Open in IMG/M |
| 3300017926|Ga0187807_1259714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300017970|Ga0187783_10811278 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300017970|Ga0187783_10865920 | Not Available | 651 | Open in IMG/M |
| 3300017970|Ga0187783_11024812 | Not Available | 595 | Open in IMG/M |
| 3300018007|Ga0187805_10277916 | Not Available | 769 | Open in IMG/M |
| 3300018060|Ga0187765_10668238 | Not Available | 678 | Open in IMG/M |
| 3300018062|Ga0187784_10220845 | Not Available | 1545 | Open in IMG/M |
| 3300018482|Ga0066669_10865200 | Not Available | 806 | Open in IMG/M |
| 3300019269|Ga0184644_1556889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
| 3300019789|Ga0137408_1064735 | Not Available | 668 | Open in IMG/M |
| 3300020199|Ga0179592_10342385 | Not Available | 659 | Open in IMG/M |
| 3300020581|Ga0210399_10866873 | Not Available | 734 | Open in IMG/M |
| 3300020583|Ga0210401_11081139 | Not Available | 661 | Open in IMG/M |
| 3300021168|Ga0210406_10845925 | Not Available | 693 | Open in IMG/M |
| 3300021178|Ga0210408_10021686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 5127 | Open in IMG/M |
| 3300021374|Ga0213881_10489892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 557 | Open in IMG/M |
| 3300021404|Ga0210389_10941446 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300021406|Ga0210386_11396066 | Not Available | 587 | Open in IMG/M |
| 3300021476|Ga0187846_10461258 | Not Available | 520 | Open in IMG/M |
| 3300021560|Ga0126371_12185775 | Not Available | 667 | Open in IMG/M |
| 3300021860|Ga0213851_1639101 | Not Available | 693 | Open in IMG/M |
| 3300021861|Ga0213853_10264906 | Not Available | 707 | Open in IMG/M |
| 3300022726|Ga0242654_10210692 | Not Available | 680 | Open in IMG/M |
| 3300024219|Ga0247665_1056198 | Not Available | 554 | Open in IMG/M |
| 3300024222|Ga0247691_1013860 | Not Available | 1304 | Open in IMG/M |
| 3300024290|Ga0247667_1090321 | Not Available | 564 | Open in IMG/M |
| 3300025898|Ga0207692_10940897 | Not Available | 569 | Open in IMG/M |
| 3300025906|Ga0207699_10364764 | Not Available | 1022 | Open in IMG/M |
| 3300025915|Ga0207693_10543311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 906 | Open in IMG/M |
| 3300025915|Ga0207693_10851106 | Not Available | 701 | Open in IMG/M |
| 3300025915|Ga0207693_10943335 | Not Available | 661 | Open in IMG/M |
| 3300025922|Ga0207646_10371009 | Not Available | 1293 | Open in IMG/M |
| 3300025923|Ga0207681_10460453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1036 | Open in IMG/M |
| 3300025925|Ga0207650_11392468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300025927|Ga0207687_10471734 | Not Available | 1044 | Open in IMG/M |
| 3300025929|Ga0207664_11443123 | Not Available | 609 | Open in IMG/M |
| 3300025940|Ga0207691_10026917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 5395 | Open in IMG/M |
| 3300026078|Ga0207702_10886258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 884 | Open in IMG/M |
| 3300026088|Ga0207641_10631122 | Not Available | 1051 | Open in IMG/M |
| 3300026498|Ga0257156_1136531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces ureilyticus | 511 | Open in IMG/M |
| 3300026557|Ga0179587_10213347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1226 | Open in IMG/M |
| 3300026995|Ga0208761_1025863 | Not Available | 577 | Open in IMG/M |
| 3300027018|Ga0208475_1020469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300027163|Ga0209878_1003536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2269 | Open in IMG/M |
| 3300027376|Ga0209004_1049197 | Not Available | 706 | Open in IMG/M |
| 3300027725|Ga0209178_1320950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300027775|Ga0209177_10109613 | Not Available | 888 | Open in IMG/M |
| 3300027787|Ga0209074_10265595 | Not Available | 673 | Open in IMG/M |
| 3300027787|Ga0209074_10572419 | Not Available | 500 | Open in IMG/M |
| 3300027855|Ga0209693_10323862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300027874|Ga0209465_10540735 | Not Available | 580 | Open in IMG/M |
| 3300027882|Ga0209590_10550338 | Not Available | 744 | Open in IMG/M |
| 3300028145|Ga0247663_1057136 | Not Available | 665 | Open in IMG/M |
| 3300028716|Ga0307311_10148288 | Not Available | 674 | Open in IMG/M |
| 3300028784|Ga0307282_10292969 | Not Available | 784 | Open in IMG/M |
| 3300028789|Ga0302232_10324110 | Not Available | 760 | Open in IMG/M |
| 3300028828|Ga0307312_10705927 | Not Available | 668 | Open in IMG/M |
| 3300028881|Ga0307277_10193008 | Not Available | 891 | Open in IMG/M |
| 3300028906|Ga0308309_10075916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 2523 | Open in IMG/M |
| 3300030618|Ga0311354_11077208 | Not Available | 735 | Open in IMG/M |
| 3300031128|Ga0170823_16098983 | Not Available | 653 | Open in IMG/M |
| 3300031231|Ga0170824_111705148 | Not Available | 659 | Open in IMG/M |
| 3300031446|Ga0170820_13778969 | Not Available | 506 | Open in IMG/M |
| 3300031474|Ga0170818_113179919 | Not Available | 906 | Open in IMG/M |
| 3300031543|Ga0318516_10100764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1632 | Open in IMG/M |
| 3300031544|Ga0318534_10123174 | Not Available | 1490 | Open in IMG/M |
| 3300031544|Ga0318534_10408083 | Not Available | 780 | Open in IMG/M |
| 3300031545|Ga0318541_10337114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 842 | Open in IMG/M |
| 3300031564|Ga0318573_10191723 | Not Available | 1082 | Open in IMG/M |
| 3300031640|Ga0318555_10028260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 2709 | Open in IMG/M |
| 3300031640|Ga0318555_10176411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1148 | Open in IMG/M |
| 3300031679|Ga0318561_10001858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 7668 | Open in IMG/M |
| 3300031679|Ga0318561_10287829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 898 | Open in IMG/M |
| 3300031679|Ga0318561_10821984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300031681|Ga0318572_10279259 | Not Available | 985 | Open in IMG/M |
| 3300031713|Ga0318496_10126147 | Not Available | 1387 | Open in IMG/M |
| 3300031719|Ga0306917_10818402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
| 3300031723|Ga0318493_10688197 | Not Available | 573 | Open in IMG/M |
| 3300031748|Ga0318492_10313020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 818 | Open in IMG/M |
| 3300031751|Ga0318494_10736143 | Not Available | 577 | Open in IMG/M |
| 3300031768|Ga0318509_10168996 | Not Available | 1211 | Open in IMG/M |
| 3300031768|Ga0318509_10289837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 915 | Open in IMG/M |
| 3300031779|Ga0318566_10109025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1362 | Open in IMG/M |
| 3300031792|Ga0318529_10239399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
| 3300031793|Ga0318548_10372289 | Not Available | 701 | Open in IMG/M |
| 3300031796|Ga0318576_10161268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1048 | Open in IMG/M |
| 3300031805|Ga0318497_10108860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1492 | Open in IMG/M |
| 3300031805|Ga0318497_10826042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300031823|Ga0307478_10746374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 820 | Open in IMG/M |
| 3300031835|Ga0318517_10584203 | Not Available | 502 | Open in IMG/M |
| 3300031879|Ga0306919_10843195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300031890|Ga0306925_10012949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora | 8103 | Open in IMG/M |
| 3300031890|Ga0306925_11180373 | Not Available | 768 | Open in IMG/M |
| 3300031896|Ga0318551_10318036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 877 | Open in IMG/M |
| 3300031897|Ga0318520_10051893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2158 | Open in IMG/M |
| 3300031897|Ga0318520_10236268 | Not Available | 1087 | Open in IMG/M |
| 3300031910|Ga0306923_10646748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1182 | Open in IMG/M |
| 3300031945|Ga0310913_11109263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300031946|Ga0310910_10270912 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300031947|Ga0310909_11177647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 620 | Open in IMG/M |
| 3300032001|Ga0306922_12090163 | Not Available | 549 | Open in IMG/M |
| 3300032001|Ga0306922_12121421 | Not Available | 544 | Open in IMG/M |
| 3300032009|Ga0318563_10273653 | Not Available | 913 | Open in IMG/M |
| 3300032039|Ga0318559_10380472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300032042|Ga0318545_10353411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300032052|Ga0318506_10082044 | Not Available | 1355 | Open in IMG/M |
| 3300032055|Ga0318575_10437779 | Not Available | 664 | Open in IMG/M |
| 3300032076|Ga0306924_12376294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300032091|Ga0318577_10564775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300032160|Ga0311301_11093405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
| 3300032180|Ga0307471_100616774 | Not Available | 1245 | Open in IMG/M |
| 3300032180|Ga0307471_101795828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
| 3300032180|Ga0307471_102490252 | Not Available | 655 | Open in IMG/M |
| 3300032782|Ga0335082_10905797 | Not Available | 745 | Open in IMG/M |
| 3300032828|Ga0335080_11118949 | Not Available | 796 | Open in IMG/M |
| 3300032895|Ga0335074_10981061 | Not Available | 749 | Open in IMG/M |
| 3300032895|Ga0335074_11071713 | Not Available | 699 | Open in IMG/M |
| 3300032896|Ga0335075_10575223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1124 | Open in IMG/M |
| 3300032896|Ga0335075_10654188 | Not Available | 1023 | Open in IMG/M |
| 3300032896|Ga0335075_11170284 | Not Available | 670 | Open in IMG/M |
| 3300033004|Ga0335084_10357453 | Not Available | 1507 | Open in IMG/M |
| 3300033158|Ga0335077_10038726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 5885 | Open in IMG/M |
| 3300033289|Ga0310914_10161382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1984 | Open in IMG/M |
| 3300033289|Ga0310914_10526302 | Not Available | 1069 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.36% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.94% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.10% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.10% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.26% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.26% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.26% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.84% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.84% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.42% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.42% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.42% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.42% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.42% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.42% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 2170459022 | Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition) | Environmental | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013831 | Permafrost microbial communities from Nunavut, Canada - A21_5cm_6M | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00675620 | 2166559006 | Grass Soil | VGSVVLFLFRRIVQDKQPVRFREEVPTEPSAQQMALLTQEAAVAVD |
| FA2_00845890 | 2170459022 | Grass Soil | VASVLLYFYRRIVQDKQKVTFREEVPAEPSPEQMALLREEEAPVAVD |
| FD2_04683590 | 2189573001 | Grass Soil | VQDKAKITFREEVPAEPTAEQMALLRQEQDVVPAS |
| JGI12269J14319_101911221 | 3300001356 | Peatlands Soil | GTWTDMFIGVGVLVASVLLYFYRRIVQDKQKVTFRDEVPKMPSAEQMALLRQEEAVVAAD |
| JGI25615J43890_10623362 | 3300002910 | Grasslands Soil | FLYRRIVQDKQRVTFREEVPTEPSPEQMALLREEASVAVD* |
| Ga0058897_110823281 | 3300004139 | Forest Soil | FYRRIVQDKQKVTFREEVPAEPSPEQMALLREEEAPVAVD* |
| Ga0062590_1016911652 | 3300004157 | Soil | VLVVAVLLFFYRRIVQDKKKVTFRDRDVPTMPNEAQMRLLIEEGART* |
| Ga0066395_103074572 | 3300004633 | Tropical Forest Soil | VLYFYRRIVQDKAKVTFREQVSAEPTPEQMALLREEAAVTAD* |
| Ga0066814_100567842 | 3300005162 | Soil | VLLFFYRRIVQDKSRITFREQVPTEPSPEQMALLREEETVTAE* |
| Ga0066672_101497082 | 3300005167 | Soil | LVASVLLFFYRRIVQDKSKVTFREDVPQMPSAEQMALLREEAAAVAD* |
| Ga0066683_102303092 | 3300005172 | Soil | RTLLLGIGVLVVAVLLYFYRRIVQDKSRITFREEVPTEPSPEQMALLREEETVTAE* |
| Ga0066684_110583562 | 3300005179 | Soil | ASVLLFFYRRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD* |
| Ga0066676_111784182 | 3300005186 | Soil | FYRRIVQDKSKVTFREDVPVMPSAEQMALLREEEAVVAD* |
| Ga0066388_1062609412 | 3300005332 | Tropical Forest Soil | LVGSVVLYFYRRIVQDKAKVTFREEVPTEPTPEQMALLREEAAPALTSD* |
| Ga0070709_102264952 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GVGVLVGSVLLFFYRRIVQDKQRVTFREEVPAEPSAEQMALLTQEAVVAVD* |
| Ga0070709_115396142 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | YGTWTDMFIGVGVLIASVLLFFYRRIVQDKEKVTFREQVPEMPSAEQMALLREEAAVPAAD* |
| Ga0070714_1020316872 | 3300005435 | Agricultural Soil | YGTWTDMFIGVGVLIASVLLFFYRRIVQDKSKVTFREQVPEMPSAEQMALLREEAAVPAD |
| Ga0070714_1024085901 | 3300005435 | Agricultural Soil | SVLLYFYRRIVQDKQKVTFREQVPAMPNPEQMALLRQEEAVAAD* |
| Ga0070713_1024673962 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | FIGVGVLIASVLLFFYRRIVQDKEKVTFREQVPEMPSAEQMALLRQEEAVVTAD* |
| Ga0070711_1014235492 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TDMFIGVGVLIASVLLFFYRRIVQDKSKVTFREQVPEMPSAEQMALLREEAAVPAD* |
| Ga0066689_106744822 | 3300005447 | Soil | VLLYFYRRIVQDKSRITFREEVPTEPTPEQMALLREEEAVPAE* |
| Ga0070707_1016473832 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVIFGITNPTLTGYGTWTDMGIGVGVLVGSVLLFLFRRMVQDKSKVTFREQVPDMPSPEQMALLTEEAAVAAD* |
| Ga0070699_1003282081 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GIAVLVVAVLLYFYRRLVQDKSRIVFREQVPTEPSPEQMALLGEEATV* |
| Ga0070699_1021698982 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SVLLFFYRRIVQDKQRVTFREEVPTEPSAEQMALLREEVVVAD* |
| Ga0070741_106953121 | 3300005529 | Surface Soil | SVLLFFYRRIVQDKQKVTFREQVPEMPSAEQMALLRQETAVVVD* |
| Ga0070730_101316743 | 3300005537 | Surface Soil | FRRIVQDKQRVTFREEVPTEPSAEQMRLLREEATVAD* |
| Ga0070731_102632662 | 3300005538 | Surface Soil | TWTDMFIGVGVLVASVLLYFYRRIVQDKVKVTFRDEVPTMPSPEQMALLREESAVTAS* |
| Ga0070695_1011395962 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | FYRRIVQDKSKVTFREDVPQMPSAEQMALLRQEEAVVAD* |
| Ga0068855_1011736411 | 3300005563 | Corn Rhizosphere | VLLYFYRRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD* |
| Ga0066705_103929451 | 3300005569 | Soil | LGVGVLVVAVLLYFYRRIVQDKSRITFREEVPTEPSPEQMALLREEQTVTAE* |
| Ga0066694_102231171 | 3300005574 | Soil | FYRRIVQDKSKVTFREDVPEMPSAEQMALLRQEEAVVAD* |
| Ga0066903_1071387762 | 3300005764 | Tropical Forest Soil | MWIGVGVLVGSVVLYFIRRIVQDKERVTFREQVPTEPSAEQMALLREEAAVAD* |
| Ga0070717_104569511 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVVIGVGVLVVAVLLFFYRRVIQDKSRITFREEVPTEPNAEQMALLREEAPASAK* |
| Ga0066652_1014788712 | 3300006046 | Soil | LFFYRRIVQDKAKVTFREQVPTEPTPEQMALLREETAVPVD* |
| Ga0075432_101109862 | 3300006058 | Populus Rhizosphere | YFYRRIVQDKSRITFREQVPTEPSAEQMALLREEDAVPAE* |
| Ga0075017_1002464672 | 3300006059 | Watersheds | MVQDEAQIKFREDVPDMPSAEQMALLRQEATIAAD* |
| Ga0075017_1016218101 | 3300006059 | Watersheds | RIVQDKKPVTWREEVNVMPTTEQMALLQEELVHEP* |
| Ga0075015_1007558981 | 3300006102 | Watersheds | VQDKSKITFREEVPTEPSAEQMALLREEAAVPVD* |
| Ga0070715_105925781 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD* |
| Ga0070712_1002391983 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LFFYRRIVQDKAKVTFREEVPAEPSAEQMALLREEATVTAD* |
| Ga0070712_1003290533 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IASVLLFFYRRIVQDKSKVTFREQVPDMPSAEQMALLREEAAVPAD* |
| Ga0070712_1016114362 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VVLYAYRRIVQDKSRITWREKVPQMPTAEQMVLLNQEEAVAAD* |
| Ga0070712_1019927652 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LFFYRRIVQDKQRVTFREEVPDMPSAEQMALLREEATVAAD* |
| Ga0074060_118695892 | 3300006604 | Soil | SVLLFFYRRIVQDKSRITFREEVPTEPSAEQMALLREEAPASAK* |
| Ga0074057_100716501 | 3300006605 | Soil | DMFIGVGVLVASVLLFFYRRIVQDKSKVTFREDVPEMPSAAQMALLREEETVVAD* |
| Ga0079221_112871381 | 3300006804 | Agricultural Soil | SVLLFFYRRIVQDKEKVTFREQVPEMPSAEQMALLRQEEAVVTAD* |
| Ga0075428_1005632022 | 3300006844 | Populus Rhizosphere | VLLYFYRRIVQDKSRITFREQVPTEPSAEQMALLREEDAVPAE* |
| Ga0075433_111426241 | 3300006852 | Populus Rhizosphere | VAVLLYFYRRIVQDKSRITFREEVPTEPSPEQMALLREEETVTAE* |
| Ga0075434_1006766661 | 3300006871 | Populus Rhizosphere | VAVLLFFYRRVVQDKSRITFREEVPTEPSAEQMALLREEAPASAK* |
| Ga0075426_115340262 | 3300006903 | Populus Rhizosphere | YRRIVQDKQRVTFREEVPTEPSAEQLALLTQEAAVAVD* |
| Ga0075423_115882332 | 3300009162 | Populus Rhizosphere | VLLFFYRRIVQDKLKVTFREEVPTEPSPEQMALLRQEATVAAD* |
| Ga0116221_11334382 | 3300009523 | Peatlands Soil | LLYFYRRIVQDKAKITFRDEVPKMPNAEQMALLRQEAAVAAE* |
| Ga0116215_11983642 | 3300009672 | Peatlands Soil | IGVGVLVASVLLYFYRRIVQDKAKVTFRDEVPKMPNAEQMALLRQEAAVAAE* |
| Ga0116216_106687902 | 3300009698 | Peatlands Soil | VLFFYRRLVQDKAKVTFREEVPTEPTPEQMALLREEEAVPVD* |
| Ga0126382_103861352 | 3300010047 | Tropical Forest Soil | LGIGVLVVAVLLYFYRRIVQDKSRVTFREEVPTEPSPEQMALLREEEAVTTE* |
| Ga0126373_100122231 | 3300010048 | Tropical Forest Soil | RLVQDKEKITFREEVPTEPTAEQMALLRQEQDVVPAS* |
| Ga0126373_103390462 | 3300010048 | Tropical Forest Soil | VGVLVASVLLFFYRRIVQDKAKVTFREDVPTEPTPEQMALLRQESSPALAAD* |
| Ga0126373_111683571 | 3300010048 | Tropical Forest Soil | SVLLFFFRRLVQDKEKITFREEVPTEPSAEQMALLREEAAPALTSD* |
| Ga0123356_138453112 | 3300010049 | Termite Gut | FFYRRMVQDKQKVVFREEVPAEPSPEQMALLREESSPAATATS* |
| Ga0126318_101984882 | 3300010152 | Soil | LFFYRRIVQDKQKVTFREQVPEMPSAEQMALLREEAAVPAD* |
| Ga0126318_105548802 | 3300010152 | Soil | FYRRLVQDKSKVTFREDVPQMPSAEQMALLRQEEAVVAD* |
| Ga0127503_101840772 | 3300010154 | Soil | FYRRIVRDKAQIKFREDVPDMPSAEQMALLRQEATIAAD* |
| Ga0127503_104785032 | 3300010154 | Soil | MFIGVGVLVGSVLLFFYRRIVQDKQRVTFREEVPDMPSAEQMALLREEATLAAD* |
| Ga0127503_107600752 | 3300010154 | Soil | WTDMFIGVGVLVASVLLYFYRRIVQDKQKVTFREEVPAEPSPEQMALLREEEAPVAVD* |
| Ga0134064_101851851 | 3300010325 | Grasslands Soil | TDMFIGVGVLVASVLLFFYRRLVQDKSKVTFREDVPQMPSAEQMALLRQEEAVVAD* |
| Ga0126370_110450781 | 3300010358 | Tropical Forest Soil | VLVGSVLLFLFRRIVQDRSHVTFREQVPDMPSAEQMRLLTEEAAVAAD* |
| Ga0126376_106647122 | 3300010359 | Tropical Forest Soil | LVGSVVLFVIRRVGQDRQRITFREVVPTEPSPEQMALLRAEAAVAD* |
| Ga0126372_125394061 | 3300010360 | Tropical Forest Soil | GVLVVAVLLYFYRRIVQDKSRITFREEVPTEPSPEQMALLREEESVPAE* |
| Ga0126378_101289923 | 3300010361 | Tropical Forest Soil | VLVGSVLLYFYRRIVQDKQKVTFHEEVPEMPSAEQMALLREEAAVPAD* |
| Ga0126378_128978911 | 3300010361 | Tropical Forest Soil | GSVLLFFFRRLVQDRSRITFREQVPVMPSAEQMRLLTEEAAVAAD* |
| Ga0134066_102349812 | 3300010364 | Grasslands Soil | YGTWTDMFIGVGVLVASVLLFFYRRLVQDKSKVTFREEVPQMPSAAQMALLREEEAVVAD |
| Ga0126379_113642742 | 3300010366 | Tropical Forest Soil | YRRIVQDKQRVTFREEVPDMPSAEQMALLREEATVAAD* |
| Ga0126379_126951982 | 3300010366 | Tropical Forest Soil | FFFRRLVQDRSRITFREQVPVMPSAEQMRLLTEEAAVAAD* |
| Ga0134125_108539711 | 3300010371 | Terrestrial Soil | LIASVLLYFYRRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD* |
| Ga0126381_1015118491 | 3300010376 | Tropical Forest Soil | GVGVLIGSVLLFVFRRVVQDRAKVTFREEVPTEPSPEQLALLREEAVVPTS* |
| Ga0126381_1029360591 | 3300010376 | Tropical Forest Soil | VLVASVLLFFYRRIVQDKAKVTFREEVPTEPTPEQMALLRQESSPALAAD* |
| Ga0126381_1045107491 | 3300010376 | Tropical Forest Soil | RTVILGIGVLVVAVLLYFYRRLVQDKSRIVFREEVPTEPSPEQMALLREEETVTAE* |
| Ga0136449_1021644701 | 3300010379 | Peatlands Soil | GSVVLFFYRRLVQDKAKVTFREEVPTEPTPEQMALLREEEAVPVD* |
| Ga0134126_104864192 | 3300010396 | Terrestrial Soil | DMWIGVAVLVGSVVLYFYRRIVQDKQKVTFREEVPAEPSAEQMALLREESAVSAD* |
| Ga0126383_113070512 | 3300010398 | Tropical Forest Soil | FFYRRIVQDKQKVTFREEVPTEPSPEQMALLREEATVAAD* |
| Ga0126383_116951612 | 3300010398 | Tropical Forest Soil | FFYRRIVQDKAKVTFREQVSAEPTPEQMALLREEASPALTSD* |
| Ga0126383_134389632 | 3300010398 | Tropical Forest Soil | SVLLFLFRRIVQDRSKVTFREQVPDMPSAEQMRLLAEEAAVAAD* |
| Ga0134121_113964632 | 3300010401 | Terrestrial Soil | YFYRRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD* |
| Ga0138565_11382292 | 3300011078 | Peatlands Soil | GVLVASVLLFFYRRIVQDKQKVTFRDEVPKMPSAEQMALLRQEAAVAAD* |
| Ga0137391_106411802 | 3300011270 | Vadose Zone Soil | VGSVLLFFYRRIVQDKQKVTFREQVPAMPSAEQMALLRQEAAVVAD* |
| Ga0137385_102693661 | 3300012359 | Vadose Zone Soil | LLFFYRRIVQDKQKVTFREQVPEMPSAEQMALLREEEAVVAD* |
| Ga0137390_105475602 | 3300012363 | Vadose Zone Soil | VLVGSVVLFFYRRIVQDKQRVTFREEVPSEPSPEQMALLRDEAVVVD* |
| Ga0157338_10040712 | 3300012515 | Arabidopsis Rhizosphere | GVGVLIASVLLYFYRRIVQDKSTVTFREEVPQMPSPEQMALLREEEAVVAD* |
| Ga0137394_106541651 | 3300012922 | Vadose Zone Soil | IGVGVLVVAVLLFFYRRVVQDKSRITFREEVPTEPNAEQMALLREEAPAPAK* |
| Ga0137413_102210502 | 3300012924 | Vadose Zone Soil | LFFYRRIVQDKQKVTFREEVPEMPSAEQMALLRQEEAVAAD* |
| Ga0137407_106467772 | 3300012930 | Vadose Zone Soil | VQDKSRITFREEVPTEPNAEQMALLREEAPAPAK* |
| Ga0164303_104239551 | 3300012957 | Soil | RIVQDKRKVTFREEVPDMPSAEQMALLREESAVTAD* |
| Ga0164301_101354371 | 3300012960 | Soil | WTDMFIGVGVLIASVLLYFYRRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD* |
| Ga0126369_107357621 | 3300012971 | Tropical Forest Soil | IGVGVLVGSVLLFLFRRIVQDRSKVTFREQVPDMPSAEQMRLLTEEAAVAAD* |
| Ga0126369_107808891 | 3300012971 | Tropical Forest Soil | FFYRRIVQDKAKVTFREQVSAEPTPEQMALLREEAAVTAD* |
| Ga0134087_102829441 | 3300012977 | Grasslands Soil | LLGVGVLVVAVLLYFYRRLVQDKSRITFREQVPTEPSPEQMALLREEEAVTAE* |
| Ga0164308_105539593 | 3300012985 | Soil | FYRRIVQDKSKVSFREEVPQMPSAEQMALLREEAAVPAE* |
| Ga0164308_116920412 | 3300012985 | Soil | LVASVLLFFYRRIVQDKAQVTFREEVPDMPSPEQMALLREESAVTAD* |
| Ga0164308_119829681 | 3300012985 | Soil | GVGVLVASVLLFFYRRIVQDKRKVTFREEVPDMPSAEQMALLREESAVTAD* |
| Ga0164306_111307622 | 3300012988 | Soil | FFYRRIVQDKSKVTFREEVPQMPSPEQMALLREEEAVVAD* |
| Ga0164305_105615661 | 3300012989 | Soil | FYRRIVQDKSRITFREEVPTEPSAEQMALLREEAPASAK* |
| Ga0157378_117202621 | 3300013297 | Miscanthus Rhizosphere | RIVQDKQKVTFREEVPAEPSAEQMALLREESAVSAD* |
| Ga0120126_10274171 | 3300013831 | Permafrost | LGVLVVAVLLFFYRRIVQDKSRITFREEVPDMPSAAQMALLKEETVAAD* |
| Ga0181523_102816141 | 3300014165 | Bog | TTTDLLIGVGVLLVSVLLFLFRRVVQDKQPITLREEAATMPTPEQMALLEQEVAHT* |
| Ga0134079_100936421 | 3300014166 | Grasslands Soil | IASVLLFFYRRLVQDKSKVTFREDVPQMPSAEQMALLRQEEAVVAD* |
| Ga0157377_117246432 | 3300014745 | Miscanthus Rhizosphere | GVLVASVLLYFYRRIVQDKSKVTFREEVPQMPSAEQMALLREEEAVVAD* |
| Ga0157379_100082197 | 3300014968 | Switchgrass Rhizosphere | SVVLYFYRRIVQDKQKVTFREEVPDMPSAEQMALLREESALSAD* |
| Ga0157379_113793012 | 3300014968 | Switchgrass Rhizosphere | IVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD* |
| Ga0132257_1004108441 | 3300015373 | Arabidopsis Rhizosphere | WTDMFIGVGVLIASVLLYFYRRIVQDKSKVTFREEVPQMPSPEQMALLREEEAVVAD* |
| Ga0182041_105300781 | 3300016294 | Soil | GVAVLVGSVVLYFYRRIVQDKAKVTFREQVSAEPTPEQMALLREEAAVTAD |
| Ga0182034_112397312 | 3300016371 | Soil | LVGSVVLFFYRRIVQDKAKVTFREEVPTEPTPEQMSLLREEAAVTAD |
| Ga0182039_105478512 | 3300016422 | Soil | GVGVLVGSVVLFFYRRIVQDKKKVTFHEEVSTEPSAEQMALLREEAAVTAD |
| Ga0187820_10269001 | 3300017924 | Freshwater Sediment | TWTDMFIGVGVLVASVLLYFYRRIVQDKAKVTFRDEVPKMPNAEQMALLRQEAAVAAD |
| Ga0187820_11685411 | 3300017924 | Freshwater Sediment | IVQDKQKVTFREDVPTEPSPEQMALLRAEETPASAN |
| Ga0187807_12597142 | 3300017926 | Freshwater Sediment | MGIGVGVLIGSVLLFFYRRIVQDKSQVTFREQVPDMPSPEQMALLSQEAAVAAD |
| Ga0187783_108112783 | 3300017970 | Tropical Peatland | VLLFFYRRIVQDKAHITFREQVPAEPTAEQMALLTQEATVAAD |
| Ga0187783_108659201 | 3300017970 | Tropical Peatland | RIVQDKSHVTFREQVPDMPSPEQMALLGEEAAVAAD |
| Ga0187783_110248121 | 3300017970 | Tropical Peatland | SVLLFLYRRIVQDKQKVTFREEIPAEPSPEQLALLREEATVTPS |
| Ga0187805_102779162 | 3300018007 | Freshwater Sediment | GVLVASVLLFFFRRLVQDKSRITFREEVPTEPTAEQMALLRQEQDVVPAS |
| Ga0187765_106682382 | 3300018060 | Tropical Peatland | LVGSVLLYFYRRIVQDKQKVTFREEVSTEPSPEQMALLREEAEVVPAE |
| Ga0187784_102208451 | 3300018062 | Tropical Peatland | TDMFIGVGVLVASVLLYFYRRIVQDKQKVTFRDEVPTMPSEEQMALLRQEAVVAAD |
| Ga0066669_108652002 | 3300018482 | Grasslands Soil | YRRIVQDKSRITFREEVPTEPSPEQMALLREEETVTAE |
| Ga0184644_15568892 | 3300019269 | Groundwater Sediment | SVLLFFYRRIVQDKSKVTFREDVPEMPSAEQMALLREESLA |
| Ga0137408_10647352 | 3300019789 | Vadose Zone Soil | YGTWTDMFIGVGVLIASVLLFFYRRIVQDKQKVTFREDVPKMPSAEQMALLREEEAVVAD |
| Ga0179592_103423851 | 3300020199 | Vadose Zone Soil | RIVQDKRKVTFREEVPAEPSPEQMALLREEAAPVAVD |
| Ga0210399_108668731 | 3300020581 | Soil | GVLVASVLLFFYRRIVQDHSKVTFREEVPTEPSPEQMALLRQESSPALASD |
| Ga0210401_110811392 | 3300020583 | Soil | IGVGVLIASVLLFFYRRIVQDKSKVTFREQVPEMPSAEQMALLREEEAVVAD |
| Ga0210406_108459252 | 3300021168 | Soil | VVLYAYRRIVQDKSRITWREKVPQMPTAEQMVLLNQEEAVAAD |
| Ga0210408_100216866 | 3300021178 | Soil | TWTDMFIGVGVLIASVLLYFYRRIVQDKSKVTFREQVPTMPSAEQMALLREEEATVAAD |
| Ga0213881_104898922 | 3300021374 | Exposed Rock | RRIVQDRAKVTFREQIPQMPSPEQMALLAQEEAAVAAD |
| Ga0210389_109414461 | 3300021404 | Soil | KTDMFIGIGVLAASVLLFFFRRLVQDKTKITFRETVPAEPTAEQMALLRQEEDVVPAS |
| Ga0210386_113960662 | 3300021406 | Soil | FIGVGVLIASVLLFFYRRIVQDKQKVTFREQVPEMPSAEQMALLREEEAVVAD |
| Ga0187846_104612581 | 3300021476 | Biofilm | LFRRIVQDKAKVTFREEVPSEPTPEQMALLRQEEQVVAAS |
| Ga0126371_121857752 | 3300021560 | Tropical Forest Soil | TFAATWADMWIGVGVLVGSVVLFFIRRIFQDKQRVTFREHVPAEPSAEQMALLREEAAVA |
| Ga0213851_16391011 | 3300021860 | Watersheds | MFIGVGVLVASVLLFFYRRIVQDKRKVTFREDVPAEPSPEQMALLREEAEPVAVD |
| Ga0213853_102649062 | 3300021861 | Watersheds | DMFIGVGVLVASVLLYFYRRIVQDKAKVTFRDEVPTMPSAEQMALLRQEATVAAD |
| Ga0242654_102106922 | 3300022726 | Soil | VLVASVLLFFYRRIVQDKQKVTFREEVPAEPSPEQMALLREEEAPVAVD |
| Ga0247665_10561981 | 3300024219 | Soil | WIGVAVLVGSVVLYFYRRIVQDKQKVTFREEVPAEPSAEQMALLREESAVTAD |
| Ga0247691_10138602 | 3300024222 | Soil | FFYRRIVQDKSKVTFREDVPEMPSAEQMALLREEEAVVAD |
| Ga0247667_10903212 | 3300024290 | Soil | MWIGVAVLVGSVVLYFYRRIVQDKQKVTFREEVPAEPSAEQMALLREEAAVPAD |
| Ga0207692_109408971 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LLYFYRRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD |
| Ga0207699_103647642 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GVGVLVVAVLLFFYRRVIQDKSRITFREEVPTEPNAEQMALLREEAPASAK |
| Ga0207693_105433112 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LFFYRRIVQDKAKVTFREEVPAEPSAEQMALLREEATVTAD |
| Ga0207693_108511062 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLFFYRRIVQDKQTVTFREQVPEMPSAEQMALLREEEAVVAD |
| Ga0207693_109433351 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SVLLYFYRRIVQDKQKVTFREEVPAEPSPEQMALLREEEAPVAVD |
| Ga0207646_103710092 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SVLLFFYRRIVQDKQKVTFREPVPEMPSAEQMALLRQEEAVVAD |
| Ga0207681_104604533 | 3300025923 | Switchgrass Rhizosphere | RRIVQDKSKVTFREEVPQMPSAEQMALLREEEAVVAD |
| Ga0207650_113924681 | 3300025925 | Switchgrass Rhizosphere | LFLGLGVLVASVLLFFYRRVVQDKSRITFRDRDVTTMPNEEQMALLREESLA |
| Ga0207687_104717342 | 3300025927 | Miscanthus Rhizosphere | VLIASVLLYFYRRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD |
| Ga0207664_114431232 | 3300025929 | Agricultural Soil | IVQDKQRVTFREEVPDMPSAEQMALLREEATVATD |
| Ga0207691_100269171 | 3300025940 | Miscanthus Rhizosphere | SVLLYFYRRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD |
| Ga0207702_108862582 | 3300026078 | Corn Rhizosphere | LIASVLLFFYRRIVQDKEKVTFREQVPEMPSAEQMALLREEAAVPAAD |
| Ga0207641_106311222 | 3300026088 | Switchgrass Rhizosphere | YGTWTDMFIGVGVLVASVLLFFYRRIVQDKRKVTFREEVPDMPSAEQMALLREESAVTAD |
| Ga0257156_11365312 | 3300026498 | Soil | NPMLTGYGTWTDMFIGVGVLVASVLLFFYRRIVRDKVQIKFRQDVPDMPSAEQMALLRQEATIAAD |
| Ga0179587_102133472 | 3300026557 | Vadose Zone Soil | TRTVILGVGVLVVAVLLYFYRRIVQDKARITFREQVPQMPSAEQMVLLGEEATVAAD |
| Ga0208761_10258632 | 3300026995 | Soil | TDMFIGVGVLVASVLLFFYRRIVQDKSKVTFREDVPEMPSAEQMALLREEETVVAD |
| Ga0208475_10204691 | 3300027018 | Soil | AVLLYFYRRLVQDKSRIVFREQVPTEPSPEQMALLREEEAVPAE |
| Ga0209878_10035363 | 3300027163 | Groundwater Sand | LGVLVASVLLFFYRRVVQDKAKITFRDRDVPTMPNAEQMRLLQEEVVPS |
| Ga0209004_10491972 | 3300027376 | Forest Soil | FIGVGVLVASVLLFFFRRLVQDKSRITFREEVPTEPTAEQMALLRQEEDVVPAS |
| Ga0209178_13209502 | 3300027725 | Agricultural Soil | SVLLFFYRRIVQDKEKVTFREQVPEMPSAEQMALLRQEEAVVTAD |
| Ga0209177_101096131 | 3300027775 | Agricultural Soil | VLIASVVLFFYRRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD |
| Ga0209074_102655951 | 3300027787 | Agricultural Soil | RIVQDKSKVTFREQVPTMPSPEQMALLREEEAVVAD |
| Ga0209074_105724192 | 3300027787 | Agricultural Soil | FYRRIVQDKSKVTFREEVPEMPSAEQMALLREEEAVVAD |
| Ga0209693_103238621 | 3300027855 | Soil | RRIVQDKQKVTFHEEVPTEPSPEQMALLSEEAAPAGVD |
| Ga0209465_105407352 | 3300027874 | Tropical Forest Soil | ALTVVIGVGVLVVAVLLFFYRRVVQDKSRITFREEVPTEPSPEQMALLREEETVTAE |
| Ga0209590_105503382 | 3300027882 | Vadose Zone Soil | LGVLVVAVLLFFYRRIVQDKSRITFREEVPAMPTPEQMALLQEETVAAAD |
| Ga0247663_10571361 | 3300028145 | Soil | FYRRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD |
| Ga0307311_101482881 | 3300028716 | Soil | YRRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD |
| Ga0307282_102929692 | 3300028784 | Soil | VGVLVVAVLLYFYRRLVQDKSRITFREQVPTEPSPEQMELLREEEAVTAE |
| Ga0302232_103241101 | 3300028789 | Palsa | SVLLFFYRRVVQDKSRITFREQVPAMPSAEQMALLTQEATVAAD |
| Ga0307312_107059271 | 3300028828 | Soil | VAVLLYFYRRIVQDKSRITFREEVPTEPTAEQMALLREEEAVPAE |
| Ga0307277_101930081 | 3300028881 | Soil | DMFIGVGVLVASVLLFFYRRIVQDKSKVTFREDVPQMPSAEQMALLREEEAVVAD |
| Ga0308309_100759161 | 3300028906 | Soil | GVGVLVASVLLFFYRRIVQDKQKVTFHEEVPTEPSPEQMALLSEEAAPAAVD |
| Ga0311354_110772082 | 3300030618 | Palsa | YRRVVQDKSRITFREQVPAMPSAEQMALLTQEATVAAD |
| Ga0170823_160989831 | 3300031128 | Forest Soil | ILGVGVLVVAVLLFFYRRIVQDKTRITFREEVPAEPTAEQMALLSQEEAPVAAD |
| Ga0170824_1117051481 | 3300031231 | Forest Soil | RRIVQDKARITFREEVPTEPSAEQMALLSQEEAAVAAD |
| Ga0170820_137789691 | 3300031446 | Forest Soil | GVGVLVVAVLLFFYRRIVQDKARITFREEVPAEPSAEQMALLSQEEAAVASD |
| Ga0170818_1131799192 | 3300031474 | Forest Soil | RLVQDKAKITFREEVPAEPTAEQMALLRQEQDVVPAS |
| Ga0318516_101007641 | 3300031543 | Soil | LFFYRRIVQDKAKVTFREEVPTEPTPEQMALLREEAAVTAD |
| Ga0318534_101231742 | 3300031544 | Soil | VLLFFYRRIVQDKAKVTFREEVPTEPTPEQMALLREEAAVPAD |
| Ga0318534_104080831 | 3300031544 | Soil | VQDKEKVTFREEVPTEPSPEQMALLREEASPAPAAN |
| Ga0318541_103371141 | 3300031545 | Soil | MWIGVGVLVGSVVLFFYRRIVQDKKKVTFREEVSTEPSAEQMALLREEAAVTAD |
| Ga0318573_101917232 | 3300031564 | Soil | VLLFFYRRIVQDKAKVTFREEVPTEPTPEQMALLREEAAVPVD |
| Ga0318555_100282601 | 3300031640 | Soil | VGSVVLYFYRRIVQDKAKVTFREQVPAEPTPEQMALLREEAAVTAD |
| Ga0318555_101764112 | 3300031640 | Soil | GVLVGSVLLYFYRRIVQDKAKVTFRDQVSTEPTPEQMALLREEAAVTAD |
| Ga0318561_100018588 | 3300031679 | Soil | LVASVLLFFYRRIVQDKAKVTFREEVPTEPTPEQMALLREEAAVPAD |
| Ga0318561_102878292 | 3300031679 | Soil | FFYRRIVQDKQKITFREEVPTEPSAEQMALLREEAAVTAD |
| Ga0318561_108219842 | 3300031679 | Soil | FFYRRIVQDKAKVTFREEVPTEPTPEQMALLREEAAVTAD |
| Ga0318572_102792592 | 3300031681 | Soil | YFYRRIVQDKAKVTFREEVPAEPSPEQMRLLREEEAVPAK |
| Ga0318496_101261472 | 3300031713 | Soil | LVASVLLFFYRRIVQDKAKVTFREETPTEPTPEQMALLREEAAVPVD |
| Ga0306917_108184022 | 3300031719 | Soil | FFYRRIVQDKAKVTFREEVPTEPTPEQMALLREEAAVAAD |
| Ga0318493_106881972 | 3300031723 | Soil | VGSVLLYFYRRIVQDKQKVTFREEVSAEPSPEQMALLREEEAVPAK |
| Ga0318492_103130202 | 3300031748 | Soil | GVLVGSVVLFFYRRIVQDKKKVTFREEVSTEPSAEQMALLREEAAVTAD |
| Ga0318494_107361431 | 3300031751 | Soil | LLFFYRRIVQDKAKVTFREEVPTEPTPEQMALLREEAAVPAD |
| Ga0318509_101689962 | 3300031768 | Soil | TDMWIGVGVLVGSVVLFFYRRIVQDKAKVTFREQVSTEPTPEQMALLREEAAVPVE |
| Ga0318509_102898372 | 3300031768 | Soil | TFADMWIGVGVLVGSVVLYFYRRIVQDKAKVTFREQVSAEPTPEQMALLREEAAVTAD |
| Ga0318566_101090251 | 3300031779 | Soil | IVQDKQKVTFREEVPTEPSPEQMALLREEATVAAD |
| Ga0318529_102393991 | 3300031792 | Soil | YGTFADMWIGVAVLVGSVVLYFYRRIVQDKAKVTFREQVSAEPTPEQMALLREEAAVTAD |
| Ga0318548_103722891 | 3300031793 | Soil | FYRRIVQDKQKVTFREEVPTEPTPEQLALLRQESSPALATD |
| Ga0318576_101612682 | 3300031796 | Soil | VVLYFYRRIVQDKAKVTFREEVPTEPSPEQMALLREEATVSAD |
| Ga0318497_101088603 | 3300031805 | Soil | VGVLVGSVVLFFYRRIVQDKKKVTFREEVSTEPSAEQMALLREEAAVTAD |
| Ga0318497_108260422 | 3300031805 | Soil | LYRRIVQDKQKVTFREVVPTEPSAEQMALLREEAAVTAD |
| Ga0307478_107463741 | 3300031823 | Hardwood Forest Soil | TDMFIGVGVLIGSVLLFFYRRIVQDKSHVTFREQVPDMPSPEQMALLSQESAVAAD |
| Ga0318517_105842031 | 3300031835 | Soil | IVQDKAKVTFREEVPTEPTPEQMALLRAEASPASMATD |
| Ga0306919_108431951 | 3300031879 | Soil | VGVLVGSVVLYFYRRIVQDKAKVTFREEVPTEPSPEQMALLREEATVSAD |
| Ga0306925_100129499 | 3300031890 | Soil | FYRRIVQDKAKVTFREQVSAEPTPEQMALLREEAAVTAD |
| Ga0306925_111803732 | 3300031890 | Soil | GVGVLVASVLLFFYRRIVQDKSKVTFREEVPTEPTPEQMALLRAEASPASMATD |
| Ga0318551_103180361 | 3300031896 | Soil | RIVQDKAKVTFREQVSAEPTPEQMALLREEAAVTAD |
| Ga0318520_100518933 | 3300031897 | Soil | RIVQDKKKVTFREEVSTEPSAEQMALLREEAAVTAD |
| Ga0318520_102362681 | 3300031897 | Soil | RIVQDKSKVTFREEVPTEPTPEQMALLRAEASPASMATD |
| Ga0306923_106467482 | 3300031910 | Soil | RRIVQDKQKVTFREEVSTEPSAEQMALLREEAAATAD |
| Ga0310913_111092631 | 3300031945 | Soil | DMWIGVGVLVGSVVLYFYRRIVQDKAKVTFREQVSAEPTPEQMALLREEAAVTAD |
| Ga0310910_102709121 | 3300031946 | Soil | GSVVLYFYRRIVQDKAKVTFREEVPTEPSPEQMALLREEATVSAD |
| Ga0310909_111776472 | 3300031947 | Soil | RRIVQDKQKVTFREEVSTEPTAEQMALLREEAAATAD |
| Ga0306922_120901631 | 3300032001 | Soil | LVGSVVLYFYRRIVQDKAKVTFRDQVPAEPTPEQMALLREEAAAPVD |
| Ga0306922_121214212 | 3300032001 | Soil | SVLVGSVLLYFYRRIVQDKAKVTFREKVPTEPSPEQMALLREEEAVPAK |
| Ga0318563_102736532 | 3300032009 | Soil | SVLLFFYRRIVQDKAKVTFREETPTEPTPEQMALLREEAAVPVD |
| Ga0318559_103804721 | 3300032039 | Soil | RRIVQDKAKVTFREQVSAEPTPEQMALLREEAAVTAD |
| Ga0318545_103534112 | 3300032042 | Soil | VLYFYRRIVQDKAKVTFREQVSAEPTPEQMALLREEAAVTAD |
| Ga0318506_100820442 | 3300032052 | Soil | YRRIVQDKEKVTFREEVPTEPSPEQLALLREEEAVPAK |
| Ga0318575_104377792 | 3300032055 | Soil | MWIGVAVLVGSVVLYFYRRIVQDKAKVTFREQVPAEPTPEQMALLREEAAAPVD |
| Ga0306924_123762941 | 3300032076 | Soil | DMWIGVAVLVGSVVLYFYRRIVQDKAKVTFREQVPAEPTPEQMALLREEAAVTAD |
| Ga0318577_105647751 | 3300032091 | Soil | RRIVQDKAKVTFREEVPTEPTPEQMALLREEAAVTAD |
| Ga0311301_110934051 | 3300032160 | Peatlands Soil | GSVLLFVFRRLVQDKKPITFREETPNMPSPDQMALLEQEVVQTNA |
| Ga0307471_1006167741 | 3300032180 | Hardwood Forest Soil | LYFYRRIVQDKSKVTFREEVPTEPTPEQMALLRAESSPASMGAD |
| Ga0307471_1017958281 | 3300032180 | Hardwood Forest Soil | FFYRRIVQDKQRVTFREEVPDMPSAEQMALLREEATVAAD |
| Ga0307471_1024902522 | 3300032180 | Hardwood Forest Soil | FYRRIVQDKSKVTFREEVPTQPTPEQMALLRQESSPALAD |
| Ga0335082_109057971 | 3300032782 | Soil | LFFYRRIVQDKQKVTFREQVPTMPSAEQMALLRQEEAVAAD |
| Ga0335080_111189492 | 3300032828 | Soil | ATLTPVRTVLLGVGVLVVAVLLYFYRRIVQDKSRITFREEVPTEPSPEQMALLREEEAVPAE |
| Ga0335074_109810611 | 3300032895 | Soil | VGVLIGSVLLFFYRRIVQDKSHVTFREQVPDMPSPEQMALLTEEAAVTAD |
| Ga0335074_110717132 | 3300032895 | Soil | MFIGVGVLVASVLLFFFRRLVQDKSRITFREEVPTEPTAEQMALLRQEQDVVPAN |
| Ga0335075_105752233 | 3300032896 | Soil | CVGVLIGSVLLFFYRRIVQDKSHVTFREQVPDMPSAEQMALLSEEAAVAAD |
| Ga0335075_106541882 | 3300032896 | Soil | VGSVVLFFFRRIAQDHSKVTLREAVPTEPSPEQMALLRQEGEVVAAN |
| Ga0335075_111702841 | 3300032896 | Soil | RLVQDKSRITFREEVPTEPTAEQMALLRQEQDVVPAN |
| Ga0335084_103574532 | 3300033004 | Soil | LLFFYRRLVQDKSKVTFREEVPLMPSAAQMALLREEEAVVAD |
| Ga0335077_100387261 | 3300033158 | Soil | LYFYRRIVQDKQKVNFREDVPTEPSPEQLALLREEEAVPAK |
| Ga0310914_101613821 | 3300033289 | Soil | LVGSVVLYFYRRIVQDKQKVTFREDVPTEPSPEQMALLREEATVAAD |
| Ga0310914_105263021 | 3300033289 | Soil | RIVQDKAKVTFREEVPTEPTPEQMALLREEAAVPVD |
| ⦗Top⦘ |