| Basic Information | |
|---|---|
| Family ID | F017894 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 238 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQRARANHSQ |
| Number of Associated Samples | 156 |
| Number of Associated Scaffolds | 238 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.42 % |
| % of genes near scaffold ends (potentially truncated) | 99.58 % |
| % of genes from short scaffolds (< 2000 bps) | 92.44 % |
| Associated GOLD sequencing projects | 145 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.580 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (40.756 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.496 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.277 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 238 Family Scaffolds |
|---|---|---|
| PF02666 | PS_Dcarbxylase | 71.01 |
| PF01066 | CDP-OH_P_transf | 13.03 |
| PF04255 | DUF433 | 3.78 |
| PF14534 | DUF4440 | 0.84 |
| PF01118 | Semialdhyde_dh | 0.84 |
| PF02774 | Semialdhyde_dhC | 0.84 |
| PF10282 | Lactonase | 0.42 |
| PF13472 | Lipase_GDSL_2 | 0.42 |
| PF04185 | Phosphoesterase | 0.42 |
| PF04325 | DUF465 | 0.42 |
| PF02129 | Peptidase_S15 | 0.42 |
| PF01850 | PIN | 0.42 |
| PF01649 | Ribosomal_S20p | 0.42 |
| PF04390 | LptE | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 238 Family Scaffolds |
|---|---|---|---|
| COG0688 | Phosphatidylserine decarboxylase | Lipid transport and metabolism [I] | 71.01 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 13.03 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 13.03 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 13.03 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 3.78 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.84 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.84 |
| COG0268 | Ribosomal protein S20 | Translation, ribosomal structure and biogenesis [J] | 0.42 |
| COG2980 | Outer membrane lipoprotein LptE/RlpB (LPS assembly) | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.58 % |
| Unclassified | root | N/A | 0.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_101508037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300001154|JGI12636J13339_1039629 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300001356|JGI12269J14319_10272959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101831709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 508 | Open in IMG/M |
| 3300002914|JGI25617J43924_10057211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1422 | Open in IMG/M |
| 3300004080|Ga0062385_11146539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 529 | Open in IMG/M |
| 3300004091|Ga0062387_100753304 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300004092|Ga0062389_101734466 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300004092|Ga0062389_103979221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 555 | Open in IMG/M |
| 3300004092|Ga0062389_104573472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300004152|Ga0062386_100652170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 862 | Open in IMG/M |
| 3300004635|Ga0062388_100013126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4518 | Open in IMG/M |
| 3300004635|Ga0062388_100303131 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300005180|Ga0066685_10901802 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005434|Ga0070709_10211583 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300005445|Ga0070708_100583024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1054 | Open in IMG/M |
| 3300005537|Ga0070730_10117495 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300005537|Ga0070730_10875480 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005554|Ga0066661_10236725 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300005557|Ga0066704_10056428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2494 | Open in IMG/M |
| 3300005557|Ga0066704_10263166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1170 | Open in IMG/M |
| 3300005712|Ga0070764_10248319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1012 | Open in IMG/M |
| 3300005921|Ga0070766_10231688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1165 | Open in IMG/M |
| 3300005995|Ga0066790_10506047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 516 | Open in IMG/M |
| 3300006047|Ga0075024_100801997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300006162|Ga0075030_101645165 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006173|Ga0070716_100456839 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300006173|Ga0070716_101484898 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300006797|Ga0066659_10515785 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300006914|Ga0075436_101261732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 558 | Open in IMG/M |
| 3300007258|Ga0099793_10044194 | All Organisms → cellular organisms → Bacteria | 1944 | Open in IMG/M |
| 3300007258|Ga0099793_10557420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300007258|Ga0099793_10613205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300007265|Ga0099794_10518042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300007265|Ga0099794_10724398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300009012|Ga0066710_101825036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300009012|Ga0066710_102603476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300009038|Ga0099829_10193056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 1644 | Open in IMG/M |
| 3300009038|Ga0099829_10218237 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300009038|Ga0099829_10979609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300009038|Ga0099829_11191374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300009088|Ga0099830_10010111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5715 | Open in IMG/M |
| 3300009088|Ga0099830_10087249 | All Organisms → cellular organisms → Bacteria | 2303 | Open in IMG/M |
| 3300009088|Ga0099830_10136160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1875 | Open in IMG/M |
| 3300009088|Ga0099830_10290489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1303 | Open in IMG/M |
| 3300009088|Ga0099830_10343492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300009088|Ga0099830_10358667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
| 3300009088|Ga0099830_10755554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300009088|Ga0099830_10932579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300009088|Ga0099830_11407786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300009089|Ga0099828_10511364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1083 | Open in IMG/M |
| 3300009089|Ga0099828_11308746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300009137|Ga0066709_101165792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300009137|Ga0066709_101589760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300009143|Ga0099792_10553524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300009549|Ga0116137_1127630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300009617|Ga0116123_1063909 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300009700|Ga0116217_10053353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2916 | Open in IMG/M |
| 3300010322|Ga0134084_10080948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300010323|Ga0134086_10289493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300010359|Ga0126376_11017446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300010360|Ga0126372_11326662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300010360|Ga0126372_12893029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300010366|Ga0126379_12430438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300010373|Ga0134128_11798786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300010376|Ga0126381_104038146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300011120|Ga0150983_16140500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300011269|Ga0137392_10699510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300011269|Ga0137392_10845446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300011269|Ga0137392_11089041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300011269|Ga0137392_11171982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300011270|Ga0137391_10953417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300011270|Ga0137391_11171074 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300011271|Ga0137393_10189430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1732 | Open in IMG/M |
| 3300011271|Ga0137393_10748779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300011271|Ga0137393_10780553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300011271|Ga0137393_10952365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300012096|Ga0137389_11230532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300012096|Ga0137389_11552194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012096|Ga0137389_11674924 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012189|Ga0137388_10328221 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300012189|Ga0137388_10556054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300012189|Ga0137388_10797576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300012198|Ga0137364_10177073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1554 | Open in IMG/M |
| 3300012202|Ga0137363_10673296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300012203|Ga0137399_10150753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1857 | Open in IMG/M |
| 3300012203|Ga0137399_10163631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1786 | Open in IMG/M |
| 3300012203|Ga0137399_11528596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300012205|Ga0137362_10325496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1331 | Open in IMG/M |
| 3300012205|Ga0137362_10953126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300012206|Ga0137380_10214701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1741 | Open in IMG/M |
| 3300012207|Ga0137381_10011369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6809 | Open in IMG/M |
| 3300012209|Ga0137379_11316689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300012209|Ga0137379_11608234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300012356|Ga0137371_10230277 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300012357|Ga0137384_10923812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300012357|Ga0137384_11444048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300012359|Ga0137385_10342390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1281 | Open in IMG/M |
| 3300012361|Ga0137360_10015470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4971 | Open in IMG/M |
| 3300012361|Ga0137360_10313774 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300012361|Ga0137360_10875427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300012361|Ga0137360_11531874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300012362|Ga0137361_10147315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2101 | Open in IMG/M |
| 3300012362|Ga0137361_10384989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1288 | Open in IMG/M |
| 3300012362|Ga0137361_11880804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300012362|Ga0137361_11933466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300012363|Ga0137390_11235892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300012582|Ga0137358_10118459 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300012582|Ga0137358_10607450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300012683|Ga0137398_10206158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1298 | Open in IMG/M |
| 3300012685|Ga0137397_10577127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300012685|Ga0137397_10719245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300012917|Ga0137395_11175450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300012918|Ga0137396_11158859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300012922|Ga0137394_10893480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012925|Ga0137419_10202333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1471 | Open in IMG/M |
| 3300012925|Ga0137419_10594133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300012927|Ga0137416_10414933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300012927|Ga0137416_10463350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300012927|Ga0137416_11300741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300012929|Ga0137404_11628951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300012975|Ga0134110_10096908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1190 | Open in IMG/M |
| 3300014154|Ga0134075_10042005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1878 | Open in IMG/M |
| 3300014200|Ga0181526_10343075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300014501|Ga0182024_10480276 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300015051|Ga0137414_1142666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300015241|Ga0137418_10147285 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300015241|Ga0137418_10237662 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300015241|Ga0137418_10461523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
| 3300015245|Ga0137409_10001867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 22693 | Open in IMG/M |
| 3300016387|Ga0182040_10047749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2642 | Open in IMG/M |
| 3300017927|Ga0187824_10064449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300017930|Ga0187825_10426503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300017942|Ga0187808_10493701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300017955|Ga0187817_10535124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300017995|Ga0187816_10203147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300018006|Ga0187804_10163557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300018012|Ga0187810_10516167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300018062|Ga0187784_10439344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300018090|Ga0187770_10479239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300018482|Ga0066669_10205053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1514 | Open in IMG/M |
| 3300019786|Ga0182025_1213363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300020579|Ga0210407_10265785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300020579|Ga0210407_11045062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300020581|Ga0210399_10878356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300020581|Ga0210399_11207317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300020582|Ga0210395_11137302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300020583|Ga0210401_10600650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300021088|Ga0210404_10171519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1149 | Open in IMG/M |
| 3300021168|Ga0210406_10111184 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
| 3300021170|Ga0210400_10444542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1069 | Open in IMG/M |
| 3300021171|Ga0210405_10130827 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300021171|Ga0210405_10223240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1492 | Open in IMG/M |
| 3300021171|Ga0210405_10414731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
| 3300021171|Ga0210405_11137794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300021181|Ga0210388_11533636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300021401|Ga0210393_10356553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1191 | Open in IMG/M |
| 3300021403|Ga0210397_10198067 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300021404|Ga0210389_10855204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300021405|Ga0210387_10853258 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300021405|Ga0210387_11655729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300021420|Ga0210394_10087403 | All Organisms → cellular organisms → Bacteria | 2692 | Open in IMG/M |
| 3300021433|Ga0210391_11528747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300021477|Ga0210398_10280051 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300021478|Ga0210402_10862617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300021559|Ga0210409_10062696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3470 | Open in IMG/M |
| 3300021559|Ga0210409_10173075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1973 | Open in IMG/M |
| 3300021559|Ga0210409_10873501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300021559|Ga0210409_11570251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300021560|Ga0126371_10526820 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300024182|Ga0247669_1093132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300024186|Ga0247688_1048842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300024288|Ga0179589_10092477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1223 | Open in IMG/M |
| 3300025927|Ga0207687_11882106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300026304|Ga0209240_1121081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300026323|Ga0209472_1189088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300026532|Ga0209160_1112588 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300026557|Ga0179587_10157129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1420 | Open in IMG/M |
| 3300026839|Ga0207764_124714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300027288|Ga0208525_1043148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300027326|Ga0209731_1058107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300027512|Ga0209179_1105337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300027587|Ga0209220_1121481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300027643|Ga0209076_1091125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300027643|Ga0209076_1092764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300027765|Ga0209073_10099396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300027795|Ga0209139_10211141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300027846|Ga0209180_10315164 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300027862|Ga0209701_10122813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1607 | Open in IMG/M |
| 3300027862|Ga0209701_10265619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300027875|Ga0209283_10090088 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300027875|Ga0209283_10344516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300027875|Ga0209283_10497344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300027875|Ga0209283_10689785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300027884|Ga0209275_10106078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1445 | Open in IMG/M |
| 3300027894|Ga0209068_10149971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1261 | Open in IMG/M |
| 3300027895|Ga0209624_10140893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1591 | Open in IMG/M |
| 3300027903|Ga0209488_10313270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
| 3300027903|Ga0209488_10316630 | Not Available | 1163 | Open in IMG/M |
| 3300027903|Ga0209488_11034854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300028016|Ga0265354_1017882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300028047|Ga0209526_10857916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 556 | Open in IMG/M |
| 3300028145|Ga0247663_1069694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300028536|Ga0137415_10440775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300028536|Ga0137415_10575406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300028906|Ga0308309_10030183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3707 | Open in IMG/M |
| 3300029636|Ga0222749_10214250 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300029636|Ga0222749_10632930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300030937|Ga0138302_1258504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300031680|Ga0318574_10125725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1442 | Open in IMG/M |
| 3300031708|Ga0310686_101708614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300031720|Ga0307469_11534881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300031754|Ga0307475_10157640 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
| 3300031754|Ga0307475_10388943 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300031754|Ga0307475_11032521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300031754|Ga0307475_11275450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300031890|Ga0306925_11264688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300031896|Ga0318551_10675369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300031910|Ga0306923_10192551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2330 | Open in IMG/M |
| 3300031942|Ga0310916_10850563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300031942|Ga0310916_11335125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300031954|Ga0306926_12197645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300031962|Ga0307479_10006129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11031 | Open in IMG/M |
| 3300031962|Ga0307479_10398881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1360 | Open in IMG/M |
| 3300031962|Ga0307479_10589762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1093 | Open in IMG/M |
| 3300031962|Ga0307479_10628474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
| 3300031962|Ga0307479_11668244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300031981|Ga0318531_10012123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3269 | Open in IMG/M |
| 3300032043|Ga0318556_10719276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300032059|Ga0318533_10640559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300032068|Ga0318553_10776608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300032174|Ga0307470_10687141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300032180|Ga0307471_100388461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1519 | Open in IMG/M |
| 3300032180|Ga0307471_100462704 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300032180|Ga0307471_101349922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300032180|Ga0307471_103077489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300032805|Ga0335078_11885632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300033805|Ga0314864_0035476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1099 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 40.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.30% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.26% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.84% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.84% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.84% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.84% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.42% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1015080372 | 3300000955 | Soil | SEDLLEEIKLKKLKLHCKDEMERIASRIQRARAQHA* |
| JGI12636J13339_10396292 | 3300001154 | Forest Soil | SKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRASASYSQ* |
| JGI12269J14319_102729591 | 3300001356 | Peatlands Soil | EDLLEEIKLKKMKLHCKDEMERIALRIQSVRAHRTQ* |
| JGIcombinedJ26739_1018317091 | 3300002245 | Forest Soil | ATPYLNSEDLLEEIKLKKMKLYCKDEMERIAARVHRARSHSQ* |
| JGI25617J43924_100572111 | 3300002914 | Grasslands Soil | LSATPYLNSEDLLEEIKLKKMKLYCKDEMERIAARIHRARAHSQ* |
| Ga0062385_111465392 | 3300004080 | Bog Forest Soil | SSSPYLNSEVLLEEIKLKKMKLHCKDEMERIALRIQRARAQFTQ* |
| Ga0062387_1007533042 | 3300004091 | Bog Forest Soil | LSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ* |
| Ga0062389_1017344662 | 3300004092 | Bog Forest Soil | YLNSEHLLEEIKLKKMKLYCKDEMERIAARVQRARAEAT* |
| Ga0062389_1039792211 | 3300004092 | Bog Forest Soil | YLNSEDLLEEIRLKKLKLAVKDEMNQLAQRLKSNGTPHSQ* |
| Ga0062389_1045734722 | 3300004092 | Bog Forest Soil | FLSPYHNSEDLVEEIRLKKLKLRVKDEMERLASRIPDVRARHTPRPAN* |
| Ga0062386_1006521701 | 3300004152 | Bog Forest Soil | SQSPYLNSEDLIEEIRLKKLKLHVKDEMERIAAQIHSARARHSQ* |
| Ga0062388_1000131266 | 3300004635 | Bog Forest Soil | YLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ* |
| Ga0062388_1003031313 | 3300004635 | Bog Forest Soil | YLNSEHLLEEIKLKKMKLYCKDEMERIAARVQRARSQST* |
| Ga0066685_109018021 | 3300005180 | Soil | ELQRISKSPYLNSEDLLEEIKLKKMKLHCKDAMERIAARITRARSNYTQ* |
| Ga0070709_102115831 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | HEHYEAELRRILSSTYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRSRAAHS* |
| Ga0070708_1005830241 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ELQRILKEPYLSSEDLLEEIKLKKMKLHCKDEMERIASRIQRSRAQHA* |
| Ga0070730_101174953 | 3300005537 | Surface Soil | STYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAAHS* |
| Ga0070730_108754801 | 3300005537 | Surface Soil | KLSATPYLNSEDLLEEIKLKKMKLYCKDEMERIASRVQRARSHSQ* |
| Ga0066661_102367251 | 3300005554 | Soil | NSEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYSQ* |
| Ga0066704_100564284 | 3300005557 | Soil | SEDLLEEIKLKKMKLHCKDEMERIASRIQSSRAAHS* |
| Ga0066704_102631661 | 3300005557 | Soil | ELQKISRSPYLNSEDLLEEIKLKKLKLHCKDEMERIAARIVRAQANSSQ* |
| Ga0070764_102483192 | 3300005712 | Soil | RISTASYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ* |
| Ga0070766_102316883 | 3300005921 | Soil | HRISTASYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ* |
| Ga0066790_105060472 | 3300005995 | Soil | LYEAKLLELSSDSYLNSELLREEIELKKLKLYCKDEMERIIARVQRSPSH* |
| Ga0075024_1008019972 | 3300006047 | Watersheds | NSEDLLEEIKLKKMKLHCKDEMERIALRIQRGRAHAAQ* |
| Ga0075030_1016451652 | 3300006162 | Watersheds | EDLIEEIRLKKLKLHVKDEMERIAARVHSARARHSQ* |
| Ga0070716_1004568392 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LFRSPYLNSEDLIEEIRLKKLKLHVKDEMERIAARVHSAGARHSQ* |
| Ga0070716_1014848981 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SEDLLEEIKLKKMKLHCKDEMERIALRIQRSRAAHS* |
| Ga0066659_105157851 | 3300006797 | Soil | PYLSSEDLLEEIKLKKMKLHCKDEMERIAARIQRARAQHA* |
| Ga0075436_1012617322 | 3300006914 | Populus Rhizosphere | TAGPYLSSEDLLEEIKLKKMKLYCKDEMERIASRVQRARAAHTQ* |
| Ga0099793_100441941 | 3300007258 | Vadose Zone Soil | SPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQRARANHSQ* |
| Ga0099793_105574202 | 3300007258 | Vadose Zone Soil | QKISRSPYLNSEDLLEEIKLKKLKLHCKDEMERIAARIVRARANSSQ* |
| Ga0099793_106132051 | 3300007258 | Vadose Zone Soil | QKLSATPYLNSEDLLEEIKLKKMKLYCKDEMERIAARVQRARSHSQ* |
| Ga0099794_105180421 | 3300007265 | Vadose Zone Soil | QKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIMRARASYSQ* |
| Ga0099794_107243981 | 3300007265 | Vadose Zone Soil | QQISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQRARANHSQ* |
| Ga0066710_1018250361 | 3300009012 | Grasslands Soil | LQRISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQQARANYTQ |
| Ga0066710_1026034761 | 3300009012 | Grasslands Soil | NSEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYSQ |
| Ga0099829_101930563 | 3300009038 | Vadose Zone Soil | SKSPYLNSEDLLEEIKLKKLKLHCKDEMERIAARIIRARANYTQ* |
| Ga0099829_102182371 | 3300009038 | Vadose Zone Soil | EAELQKLSATPYLNSEDLLEEIKLKKMKLYCKDEMERIAARIHRARSHSQ* |
| Ga0099829_109796092 | 3300009038 | Vadose Zone Soil | QQISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQRGRANHSQ* |
| Ga0099829_111913742 | 3300009038 | Vadose Zone Soil | QRISKSAYLSSEDLLEEIKLKKMKLHCKDEMERIAARLLREKASYTQ* |
| Ga0099830_100101111 | 3300009088 | Vadose Zone Soil | ISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQRARANHSQ* |
| Ga0099830_100872491 | 3300009088 | Vadose Zone Soil | TPYLNSEDLLEEIKLKKMKLYCKDEMERIAARVHRARSHSQ* |
| Ga0099830_101361604 | 3300009088 | Vadose Zone Soil | TPYLNSEDLLEEIKLKKMKLYCKDEMERIAARIQRAGAHSQ* |
| Ga0099830_102904891 | 3300009088 | Vadose Zone Soil | PYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARANYDQ* |
| Ga0099830_103434923 | 3300009088 | Vadose Zone Soil | QKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRTRPSYSQ* |
| Ga0099830_103586673 | 3300009088 | Vadose Zone Soil | EDLLEEIKLKKMKLHCKDEMERIAARIIRARASYSQ* |
| Ga0099830_107555541 | 3300009088 | Vadose Zone Soil | TPYLNSEDLLEEIKLKKMKLYCKDEMERIAARIHRAHAHSQ* |
| Ga0099830_109325791 | 3300009088 | Vadose Zone Soil | KSPYLNSEDLLEEIKLKKLKLHCKDEMERIAARIIRARANYTQ* |
| Ga0099830_114077861 | 3300009088 | Vadose Zone Soil | QKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIVRMRANSSQ* |
| Ga0099828_105113641 | 3300009089 | Vadose Zone Soil | KLSATPYLNSEDLLEEIKLKKMKLYCKDEMERIAARIHRAHAHSQ* |
| Ga0099828_113087461 | 3300009089 | Vadose Zone Soil | ISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIMRARASYSQ* |
| Ga0066709_1011657923 | 3300009137 | Grasslands Soil | SEDLLEEIKLKKLKLHCKDEMERIAARIVRAQANSSQ* |
| Ga0066709_1015897601 | 3300009137 | Grasslands Soil | EDLLEEIKLKKLKLHCKDEMERIAARIVRAQANSSQ* |
| Ga0099792_105535241 | 3300009143 | Vadose Zone Soil | NSEDLLEEIKLKKLKLHCKDEMERIAARILRMPAS* |
| Ga0116137_11276301 | 3300009549 | Peatland | SEDLMEEIRLKKMKLHVKDEMELLAARIHSARARHSQ* |
| Ga0116123_10639091 | 3300009617 | Peatland | LNSEDLMEEIRLKKMKLHVKDEMELLAARIHSARARHSQ* |
| Ga0116217_100533531 | 3300009700 | Peatlands Soil | NSEDLIEETRLKKLKLHVKDEMELLAARIHNGHARHSQ* |
| Ga0134084_100809481 | 3300010322 | Grasslands Soil | LQKISRSPYLNSEDLLEEIKLKKLKLHCKDEMERIAARIVRAQANSSQ* |
| Ga0134086_102894931 | 3300010323 | Grasslands Soil | ISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQQARANYTQ* |
| Ga0126376_110174462 | 3300010359 | Tropical Forest Soil | LLEEIKLKKMKLHCKDEMERIAARIQRARNSSTQ* |
| Ga0126372_113266621 | 3300010360 | Tropical Forest Soil | AELQRILKSPYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAAHS* |
| Ga0126372_128930292 | 3300010360 | Tropical Forest Soil | EDLIEEIRLKKLKLYVKDEMERIAASVHSARAKHSQ* |
| Ga0126379_124304383 | 3300010366 | Tropical Forest Soil | PYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRTRAAAS* |
| Ga0134128_117987861 | 3300010373 | Terrestrial Soil | DPYLSSETLLEEVNLKKMKLQCKDEMERIAARAHRAAAGST* |
| Ga0126381_1040381461 | 3300010376 | Tropical Forest Soil | YLSSEDLLEEIKLKKMKLHCKDEMERIAARIHRTRAQEPQ* |
| Ga0150983_161405002 | 3300011120 | Forest Soil | NSEDLLEEIKLKKMKLHCKDEMERIASRIIRSRSNYSQ* |
| Ga0137392_106995101 | 3300011269 | Vadose Zone Soil | KISKSPYLNSEDLLEEIKLKKLKLHCKDEMERIAARIIRARASYPQ* |
| Ga0137392_108454461 | 3300011269 | Vadose Zone Soil | LLEEIKLKKMKLHCKDEMERIAARIIRTRASYTQ* |
| Ga0137392_110890412 | 3300011269 | Vadose Zone Soil | SEDLLEEIKLKKMKLYCKDEMERIAARIHRARSHSQ* |
| Ga0137392_111719821 | 3300011269 | Vadose Zone Soil | ISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIVRVRANSSQ* |
| Ga0137391_109534171 | 3300011270 | Vadose Zone Soil | ILKEPFLNSEDLLEEIKLKKMKLHCKDEMERIAARIERSRAQHA* |
| Ga0137391_111710741 | 3300011270 | Vadose Zone Soil | PYLNSEDLLEEIKLKKMKLYCKDEMERIAARIHRARSHSQ* |
| Ga0137393_101894301 | 3300011271 | Vadose Zone Soil | AELQRISKAPYLNSEDLLEEIKLKKMKLHCKDEMERIALGIQRARAHSTQ* |
| Ga0137393_107487791 | 3300011271 | Vadose Zone Soil | LQKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIVRMRANSSQ* |
| Ga0137393_107805532 | 3300011271 | Vadose Zone Soil | YLNSEDLLEEIKLKKMKLYCKDEMERIAARIHRAHAHSQ* |
| Ga0137393_109523651 | 3300011271 | Vadose Zone Soil | LQKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIVRVRANSSQ* |
| Ga0137389_112305321 | 3300012096 | Vadose Zone Soil | LLEEIKLKKMKLHCKDEMERIAARIIRARASYSQ* |
| Ga0137389_115521942 | 3300012096 | Vadose Zone Soil | SEDLIEEIKLKKLKLQVKDEMERIAARLHSAAPRHSQ* |
| Ga0137389_116749241 | 3300012096 | Vadose Zone Soil | ATPYLNSEDLLEEIKLKKMKLYCKDEMERIAARIHRARAHSQ* |
| Ga0137388_103282213 | 3300012189 | Vadose Zone Soil | ISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQRGRANHSQ* |
| Ga0137388_105560541 | 3300012189 | Vadose Zone Soil | YLNSEDLLEEIKLKKMKLHCKDEMERIASRIIRSRSNYSQ* |
| Ga0137388_107975761 | 3300012189 | Vadose Zone Soil | KSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYSQ* |
| Ga0137364_101770733 | 3300012198 | Vadose Zone Soil | LQKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIASRIIRSRSNYSQ* |
| Ga0137363_106732961 | 3300012202 | Vadose Zone Soil | QKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARITRSRSNYTQ* |
| Ga0137399_101507534 | 3300012203 | Vadose Zone Soil | YLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRTRSDYTQ* |
| Ga0137399_101636311 | 3300012203 | Vadose Zone Soil | QKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRSRSNYTQ* |
| Ga0137399_115285961 | 3300012203 | Vadose Zone Soil | QKISKSPYLNSEDLLEEIKLKKLKLHCKDEMERIAARIIRTRSNYTQ* |
| Ga0137362_103254961 | 3300012205 | Vadose Zone Soil | LQKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYSQ* |
| Ga0137362_109531262 | 3300012205 | Vadose Zone Soil | YLNSEDLLEEIKLKKMKLYCKDEMERIAARIHRARSHSQ* |
| Ga0137380_102147013 | 3300012206 | Vadose Zone Soil | NSEDLLEEIKLKKMKLHCKDEMERIAARIIRTRSNYTQ* |
| Ga0137381_100113691 | 3300012207 | Vadose Zone Soil | LNSEDLLEEIKLKKLKLHCKDEMERIAARIIRTRSNYTQ* |
| Ga0137379_113166892 | 3300012209 | Vadose Zone Soil | DLLEEIKLKKMKLHCKDEMERIAARIQQARANYTQ* |
| Ga0137379_116082341 | 3300012209 | Vadose Zone Soil | RILKEPYLSSEDLLEEIKLKKMKLHCKDEMERIASRIQRSRAQHA* |
| Ga0137371_102302771 | 3300012356 | Vadose Zone Soil | EPYLSSEDLLEEIKLKKMKLHCKDEMERIASRIQRSRAQHA* |
| Ga0137384_109238121 | 3300012357 | Vadose Zone Soil | RISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQQARANYTQ* |
| Ga0137384_114440482 | 3300012357 | Vadose Zone Soil | SEDLLEEIKLKKMKLHCKDEMERIASRIQRSRAQHA* |
| Ga0137385_103423903 | 3300012359 | Vadose Zone Soil | QKISKSPYLNSEDLLEEIKLKKLKLHCKDEMERIAARIVRMRANSTQ* |
| Ga0137360_100154707 | 3300012361 | Vadose Zone Soil | LQRILKEPYLSSEDLLEEIKLKKMKLHCKDEMERIAARIERSRAQHA* |
| Ga0137360_103137741 | 3300012361 | Vadose Zone Soil | QKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQRGRANHSQ* |
| Ga0137360_108754272 | 3300012361 | Vadose Zone Soil | YLNSEDLIEEIRLKKLKLHVKDEMERIACSVHSARARHSQ* |
| Ga0137360_115318742 | 3300012361 | Vadose Zone Soil | QKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQRARANHSQ* |
| Ga0137361_101473151 | 3300012362 | Vadose Zone Soil | LNSEDLLEEIKLKKMKLHCKDEMERIAARIQRTQANYSQ* |
| Ga0137361_103849891 | 3300012362 | Vadose Zone Soil | DLLEEIKLKKMKLYCKDEMERIVARIHRARSHSQ* |
| Ga0137361_118808041 | 3300012362 | Vadose Zone Soil | LNSEDLLEEIKLKKMKLHCKDEMERIAARIQRGRANHSQ* |
| Ga0137361_119334662 | 3300012362 | Vadose Zone Soil | KSPYLNSEDLLEEIKLKKMKLYCKDEMERIAARIQRAQAPYTQ* |
| Ga0137390_112358921 | 3300012363 | Vadose Zone Soil | LQKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYPQ* |
| Ga0137358_101184591 | 3300012582 | Vadose Zone Soil | RILKEPYLSSEDLLEEIKLKKMKLHCKDEMERIAARIERSRAQHA* |
| Ga0137358_106074502 | 3300012582 | Vadose Zone Soil | SPYLNSEDLLEEIKLKKLKLHCKDEMERIVARIVRARANSSQ* |
| Ga0137398_102061581 | 3300012683 | Vadose Zone Soil | KISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIMRTRASYSQ* |
| Ga0137397_105771271 | 3300012685 | Vadose Zone Soil | QKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYSQ* |
| Ga0137397_107192451 | 3300012685 | Vadose Zone Soil | LNSEDLLEEIKLKKMKLYCKDEMERIASRVHRARSHSQ* |
| Ga0137395_111754501 | 3300012917 | Vadose Zone Soil | LQKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRTRASYTQ* |
| Ga0137396_111588591 | 3300012918 | Vadose Zone Soil | LNSEDLLEEIKLKKMKLYCKDEMERIASRIQARSHSQ* |
| Ga0137394_108934802 | 3300012922 | Vadose Zone Soil | SKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQRARANHSQ* |
| Ga0137419_102023331 | 3300012925 | Vadose Zone Soil | LLEEIKLKKMKLHCKDEMERIAARIIRTRSNCTQ* |
| Ga0137419_105941331 | 3300012925 | Vadose Zone Soil | LNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYSQ* |
| Ga0137416_104149331 | 3300012927 | Vadose Zone Soil | KISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYSQ* |
| Ga0137416_104633501 | 3300012927 | Vadose Zone Soil | DLLEEIKLKKMKLHCKDEMERIAARIQRARANHSQ* |
| Ga0137416_113007411 | 3300012927 | Vadose Zone Soil | EDLLEEIKLKKLKLHVKDEMLQMAQRLNGSPERHSQ* |
| Ga0137404_116289512 | 3300012929 | Vadose Zone Soil | QKLTSDPYLNSEHLLEEIKLKKMKLYCKDEMERIAARLRARANPT* |
| Ga0134110_100969081 | 3300012975 | Grasslands Soil | ELQKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIASRITRSRSNYTQ* |
| Ga0134075_100420051 | 3300014154 | Grasslands Soil | YLNSEDLLEEIKLKKMKLHCKDEMERIAARIQQARANYTQ* |
| Ga0181526_103430752 | 3300014200 | Bog | PYLSSEDLIEEIRLKKLKLHVRDEMELLASRIHSAHARHSQ* |
| Ga0182024_104802763 | 3300014501 | Permafrost | YLSSEHLLEEIKLKKMKLYCKDEMERIAASVRRARAQGT* |
| Ga0137414_11426661 | 3300015051 | Vadose Zone Soil | SLPQFSEDLLEEIKLKKMKLHCKDEMERIASRIQSSRAAHS* |
| Ga0137418_101472854 | 3300015241 | Vadose Zone Soil | NSEDLLEEIKLKKMKLHCKDEMERIATRIERSRAQHA* |
| Ga0137418_102376621 | 3300015241 | Vadose Zone Soil | NSEDLLEEIKLKKMKLHCKDEMERIAARIQRTRANYSQ* |
| Ga0137418_104615231 | 3300015241 | Vadose Zone Soil | RILKEPYLNSEDLLEEIKLKKMKLHCKDEMERIARIQRSRAQHA* |
| Ga0137409_1000186722 | 3300015245 | Vadose Zone Soil | ISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIASRIIRSRSNYTQ* |
| Ga0182040_100477494 | 3300016387 | Soil | NSEDLLEEIRLKKLKLHVKDEMERIASQLHGARARHTQ |
| Ga0187824_100644491 | 3300017927 | Freshwater Sediment | PYLSSEDLLEEIKLKKLKLHCKDEMERIASRIQRSRAQHA |
| Ga0187825_104265032 | 3300017930 | Freshwater Sediment | YLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ |
| Ga0187808_104937011 | 3300017942 | Freshwater Sediment | ISQSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARILRARAGYAQ |
| Ga0187817_105351242 | 3300017955 | Freshwater Sediment | SPYLNSEDLLEEIKLKKMKLHCKDEMERIAARILRARAGYA |
| Ga0187816_102031472 | 3300017995 | Freshwater Sediment | EDLLEEIKLKKMKLHCKDEMERIAARILRARAGYAQ |
| Ga0187804_101635571 | 3300018006 | Freshwater Sediment | NSEDLLEEIKLKKMKLQCKDEMERIAARILRARAGYAQ |
| Ga0187810_105161671 | 3300018012 | Freshwater Sediment | NSEDLLEEIKLKKMKLHCKDEMERIAARILRARAGYAQ |
| Ga0187784_104393441 | 3300018062 | Tropical Peatland | QFRRPLEEIRLKKLKLHVKDEMERIAVHFQSARAKHTQ |
| Ga0187770_104792391 | 3300018090 | Tropical Peatland | LNSEDLIEEIRLKKLKLHVKDEMEMLAARMLRARHSH |
| Ga0066669_102050531 | 3300018482 | Grasslands Soil | ISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIASRIIRSRSNYSQ |
| Ga0182025_12133631 | 3300019786 | Permafrost | YLSSEHLLEEIKLKKMKLYCKDEMERIAASVRRARAQGT |
| Ga0210407_102657851 | 3300020579 | Soil | LNSEDLLEEIKLKKMKLYCKDEMERIAARIHRARSHSQ |
| Ga0210407_110450621 | 3300020579 | Soil | PYLNSEDLLEEIKLKKMKLHCKDEMERIAARIARARAQQHTQ |
| Ga0210399_108783561 | 3300020581 | Soil | ISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARILRAKTNYSQ |
| Ga0210399_112073172 | 3300020581 | Soil | PYLNSEDLLEEIKLKKMKLHCKDEMERIAARILRSRASYTQ |
| Ga0210395_111373021 | 3300020582 | Soil | KKLTSDPYLNSEHLLEEIKLKKMKLHCKDEMERIAASIRRASAHST |
| Ga0210401_106006501 | 3300020583 | Soil | HRISTASYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ |
| Ga0210404_101715193 | 3300021088 | Soil | KSAYLNSEDLLEEIKLKKMKLHCKDEMERIAARIVRPPSDYTQ |
| Ga0210406_101111841 | 3300021168 | Soil | STATYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ |
| Ga0210400_104445421 | 3300021170 | Soil | LSATPYLNSEDLLEEIKLKKMKLYCKDEMERIASRIQARSHSQ |
| Ga0210405_101308271 | 3300021171 | Soil | RISTATYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ |
| Ga0210405_102232401 | 3300021171 | Soil | EDLLEEIKLKKMKLHCKDEMERIASRIVRGRANYSQ |
| Ga0210405_104147313 | 3300021171 | Soil | ASYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ |
| Ga0210405_111377941 | 3300021171 | Soil | YLNSEHLLEEIKLKKMKLYCKDEMERIAARVHRARANTT |
| Ga0210388_115336362 | 3300021181 | Soil | LQKLSQSHYLNSEDLIEEIRLKKLKLHVKDEMERIAAHFQSARASHSQ |
| Ga0210393_103565531 | 3300021401 | Soil | ISTASYLSSEDLLEEIKLKKMKLHCKDEMERIALRIKV |
| Ga0210397_101980673 | 3300021403 | Soil | TATYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ |
| Ga0210389_108552041 | 3300021404 | Soil | LSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ |
| Ga0210387_108532581 | 3300021405 | Soil | YEAELQKLTSDPYLNSEHLLEEIKLKKMKLYCKDEMERIAARVQRARSQST |
| Ga0210387_116557292 | 3300021405 | Soil | EDLLEEIKLKKMKLYCKDEMERIASRIHRARATSQ |
| Ga0210394_100874031 | 3300021420 | Soil | PYLSSEHLLEEIKLKKMKLYCKDEMERIAARVQRARANVT |
| Ga0210391_115287472 | 3300021433 | Soil | FLSSEDLLEEIKLKKMKLHFKDEMERIALRIQRARAQYTQ |
| Ga0210398_102800513 | 3300021477 | Soil | SPYLSSEDLLEEIRLKKLKLHVKDEMEQLLASRIHRAQAHSQ |
| Ga0210402_108626171 | 3300021478 | Soil | SKSPYLNSEDLIEEIRLKKMKLHCKDEMERIAARIIRARASYSQ |
| Ga0210409_100626961 | 3300021559 | Soil | LQKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIVRARTNYSQ |
| Ga0210409_101730751 | 3300021559 | Soil | EDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ |
| Ga0210409_108735012 | 3300021559 | Soil | PYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYPQ |
| Ga0210409_115702512 | 3300021559 | Soil | DLSEEIRLKKLKLHVKDEMERIAAHFQSARARHTQ |
| Ga0126371_105268201 | 3300021560 | Tropical Forest Soil | QKISSSPYLNSEDLLEEIRLKKLKLHVKDEMELLAGRIKRLKSQTTQ |
| Ga0247669_10931321 | 3300024182 | Soil | LSSEDLLEEIKLKKLKLHCKDEMERIALRIQRARAQYTQ |
| Ga0247688_10488421 | 3300024186 | Soil | LKEPYLNSEDLIEEIKLKKLKLHCKDEMERIASRIERLRAQHA |
| Ga0179589_100924773 | 3300024288 | Vadose Zone Soil | KLSATPYLNSEDLLEEIKLKKMKLYCKDEMERIASRVHRARSHSQ |
| Ga0207687_118821062 | 3300025927 | Miscanthus Rhizosphere | EPYLSSEDLLEEIKLKKLKLHCKDEMEQIASRIQRARAQHA |
| Ga0209240_11210812 | 3300026304 | Grasslands Soil | NSEDLLEEIKLKKMKLHCKDEMERIAARIMRTRASYSQ |
| Ga0209472_11890881 | 3300026323 | Soil | YLSSEDLLEEIKLKKMKLHCKDEMERIASRIQSSRAAHS |
| Ga0209160_11125881 | 3300026532 | Soil | EDLLEEIKLKKMKLHCKDEMERIASRIQRSRAQHA |
| Ga0179587_101571291 | 3300026557 | Vadose Zone Soil | SEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYSQ |
| Ga0207764_1247142 | 3300026839 | Tropical Forest Soil | PYLNSEDLIEEIRLKKLKLHVKDEMERIAAQLHGARARHTQ |
| Ga0208525_10431481 | 3300027288 | Soil | SILKSPFLNSEDLIEEIKLKKMKLHCKDEMERIALRIQRARAAHG |
| Ga0209731_10581072 | 3300027326 | Forest Soil | LQRISRSPFLNSEDLLEEIKLKKMKLHCKDEMERIAARILRARAGYAQ |
| Ga0209179_11053371 | 3300027512 | Vadose Zone Soil | TPYLNSEDLLEEIKLKKMKLYCKDEMERIASRVHRARSHSQ |
| Ga0209220_11214812 | 3300027587 | Forest Soil | ISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARANYTQ |
| Ga0209076_10911251 | 3300027643 | Vadose Zone Soil | SPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQRARANHSQ |
| Ga0209076_10927641 | 3300027643 | Vadose Zone Soil | QKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIMRARASYSQ |
| Ga0209073_100993961 | 3300027765 | Agricultural Soil | ISAAPYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRTRAQYTQ |
| Ga0209139_102111412 | 3300027795 | Bog Forest Soil | PFLNSEALLEEIKLKKMKLQCKDEMERIALRIQRARAPYTQ |
| Ga0209180_103151643 | 3300027846 | Vadose Zone Soil | ELQKLSATPYLNSEDLLEEIKLKKMKLYCKDEMERIAARVHRARSHSQ |
| Ga0209701_101228131 | 3300027862 | Vadose Zone Soil | YLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRTRPSYSQ |
| Ga0209701_102656191 | 3300027862 | Vadose Zone Soil | YLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYPQ |
| Ga0209283_100900885 | 3300027875 | Vadose Zone Soil | SATPYLNSEDLLEEIKLKKMKLYCKDEMERIAARIHRARSHSQ |
| Ga0209283_103445163 | 3300027875 | Vadose Zone Soil | KISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARILRARANYPQ |
| Ga0209283_104973442 | 3300027875 | Vadose Zone Soil | LNSEDLLEEIKLKKMKLYCKDEMERIAARIQRAQAPYTQ |
| Ga0209283_106897851 | 3300027875 | Vadose Zone Soil | LNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARSNYPQ |
| Ga0209275_101060781 | 3300027884 | Soil | STASYLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYTQ |
| Ga0209068_101499711 | 3300027894 | Watersheds | KISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRGQASYSQ |
| Ga0209624_101408931 | 3300027895 | Forest Soil | HAKYEAELKKLTSDPYLNSEHLLEEIKLKKMKLHCKDEMERIAASIRRASAHST |
| Ga0209488_103132701 | 3300027903 | Vadose Zone Soil | SATPYLNSEDLLEEIKLKKMKLYCKDEMERIASRIHRARSHSQ |
| Ga0209488_103166303 | 3300027903 | Vadose Zone Soil | LSATPYLNSEDLLEEIKLKKMKLYCKDEMERIASRVHRARSHSQ |
| Ga0209488_110348541 | 3300027903 | Vadose Zone Soil | NSEDLLEEIKLKKLKLHCKDEMERIAARILRMPAS |
| Ga0265354_10178821 | 3300028016 | Rhizosphere | HRISTSSFLSQEDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYSQ |
| Ga0209526_108579161 | 3300028047 | Forest Soil | PYLNSEDLLEEIKLKKMKLYCKDEMERIAARVHRARSHSQ |
| Ga0247663_10696942 | 3300028145 | Soil | ELRRILNEPYLSAEDLLEEIKLKKMKLHCKDEMERIASRIQRSRAQHA |
| Ga0137415_104407751 | 3300028536 | Vadose Zone Soil | ELQKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYSQ |
| Ga0137415_105754061 | 3300028536 | Vadose Zone Soil | ISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQRARANYSQ |
| Ga0308309_100301836 | 3300028906 | Soil | TSSFLSSEDLLEEIKLKKMKLHCKDEMERIALRIQRARAPYTQ |
| Ga0222749_102142501 | 3300029636 | Soil | AELQKLSATPYLNSEDLLEEIKLKKMKLYCKDEMERIASRVHRARAHSQ |
| Ga0222749_106329301 | 3300029636 | Soil | KSPYLNSEDLLEEIKLKKMKLYCKDEMERIAARNQRARPHST |
| Ga0138302_12585041 | 3300030937 | Soil | MKSTSQSCKKILKEPFLNSEDLLEEIKLKKMKLHCKDEMERIAARIERSRAQHA |
| Ga0318574_101257251 | 3300031680 | Soil | NSEDLLEEIRLKKLKLHVKDEMERVASQLHGARAKHTQ |
| Ga0310686_1017086141 | 3300031708 | Soil | EDLLEEIKLKKMKLHCKDEMERIALRIQRARAQYSQ |
| Ga0307469_115348812 | 3300031720 | Hardwood Forest Soil | PYLNSEDLLEEIKLKKMKLHCKDEMERIAARIQRARANHSQ |
| Ga0307475_101576403 | 3300031754 | Hardwood Forest Soil | YLSSEDLLEEIKLKKMKLHCKDEMERIAARIERSRAQHA |
| Ga0307475_103889431 | 3300031754 | Hardwood Forest Soil | QKLTSDPYLNSEHLQEEIKLKKMKLHCKDKMERIAARTQRAPTQST |
| Ga0307475_110325212 | 3300031754 | Hardwood Forest Soil | YLNSEDLLEEIKLKKMKLYCKDEMERIASRIHRARSHSQ |
| Ga0307475_112754501 | 3300031754 | Hardwood Forest Soil | YLNSEDLLEEIRLKKMKLHCKDEMERIAARIIRARANYTQ |
| Ga0306925_112646881 | 3300031890 | Soil | PYLNSEDLLEEIRLKKLKLHVKDEMERVASQLHGARAKHTQ |
| Ga0318551_106753692 | 3300031896 | Soil | PYLNSEDLLEEIRLKKLKLHVKDEMERIASQLHGARARHTQ |
| Ga0306923_101925511 | 3300031910 | Soil | PYLNSEDLLEEIRLKKLKLHVKDEMERIASQLHGARARHTP |
| Ga0310916_108505632 | 3300031942 | Soil | SLSQSPFLNSDDLIEEIKLKKLKLRVKDEMERLAARIHGARARHSQ |
| Ga0310916_113351252 | 3300031942 | Soil | EDLLEEIRLKKLKLHVKDEMERIASQLHGARARHTQ |
| Ga0306926_121976451 | 3300031954 | Soil | EDLLEEIRLKKLKLHVKDEMERIASQLHGARARPTQ |
| Ga0307479_1000612914 | 3300031962 | Hardwood Forest Soil | RISKAPYLNSEDLLEEIKLKKMKLHCKDEMERIALGIQRARAHSTQ |
| Ga0307479_103988811 | 3300031962 | Hardwood Forest Soil | LQKISKSPYLNSEDLLEEIKLKKMKLHCKDEMERIAARIIRARASYPQ |
| Ga0307479_105897621 | 3300031962 | Hardwood Forest Soil | LSATPYLNSEDLLEEIKLKKMKLYCKDEMERIAARIHRARSHSQ |
| Ga0307479_106284743 | 3300031962 | Hardwood Forest Soil | YLSSVDLLEEIKLKKLKLHCKDEMERIASRIQRSRAQHA |
| Ga0307479_116682442 | 3300031962 | Hardwood Forest Soil | SPYLNSEDLLEEIRLKKLKLHVKDEMERIAAQLHGARAKHMQ |
| Ga0318531_100121235 | 3300031981 | Soil | SSEDLLEEIKLKKLKLHCKDEMERIASRIQRARAQHA |
| Ga0318556_107192762 | 3300032043 | Soil | QRILKEPYLSSEDLLEEIKLKKLKLHCKDEMERIASRIQRARAQHA |
| Ga0318533_106405592 | 3300032059 | Soil | NKEDLIEEIRLKKLKLHVKDEMERIATSVHSARARHSQ |
| Ga0318553_107766081 | 3300032068 | Soil | LQRILKEPYLSSEDLLEEIKLKKLKLHCKDEMERIASRIQRARAQHA |
| Ga0307470_106871412 | 3300032174 | Hardwood Forest Soil | ELQRISKAPYLNSEDLLEEIKLKKLKLHCKDEMERIASRIHRMRAQQTQ |
| Ga0307471_1003884611 | 3300032180 | Hardwood Forest Soil | SKYEAELLKLSATPYLNSEDLLEEIKLKKMKLYCKDEMERIAARIHRARSHSQ |
| Ga0307471_1004627043 | 3300032180 | Hardwood Forest Soil | QRILKEPYLSSEDLLEEIKLKKMKLHCKDEMERIAARIERSRAQHA |
| Ga0307471_1013499221 | 3300032180 | Hardwood Forest Soil | EAELQRISKAPYLSSEDLVEEIKLKKMKLHCKDEMERIALRIQRSRAHAAQ |
| Ga0307471_1030774891 | 3300032180 | Hardwood Forest Soil | SKYEAELLRLSATPYLNSEDLLEEIKLKKMKLYCKDEMERIAARVHRARSHSQ |
| Ga0335078_118856321 | 3300032805 | Soil | ISAAPYLSSEDLLEEIKLKKMKLSCKDEMERIALRIQRSRAQVS |
| Ga0314864_0035476_3_125 | 3300033805 | Peatland | KAPYLNSEDLLEEIKLKKLKLHCKDEMERIASRIHRMRAQ |
| ⦗Top⦘ |