| Basic Information | |
|---|---|
| Family ID | F017800 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 238 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKTTALGILTIVATLSNVGIQLLNGGAPDFIGAFAAVTAGVGLIKARDNK |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 238 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.27 % |
| % of genes near scaffold ends (potentially truncated) | 44.54 % |
| % of genes from short scaffolds (< 2000 bps) | 73.95 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.101 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (31.092 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.622 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.361 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.56% β-sheet: 0.00% Coil/Unstructured: 47.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 238 Family Scaffolds |
|---|---|---|
| PF01520 | Amidase_3 | 11.76 |
| PF13539 | Peptidase_M15_4 | 4.62 |
| PF00149 | Metallophos | 3.78 |
| PF05257 | CHAP | 2.94 |
| PF13392 | HNH_3 | 2.10 |
| PF13472 | Lipase_GDSL_2 | 2.10 |
| PF13385 | Laminin_G_3 | 1.68 |
| PF01695 | IstB_IS21 | 1.26 |
| PF04404 | ERF | 1.26 |
| PF14090 | HTH_39 | 0.84 |
| PF03237 | Terminase_6N | 0.42 |
| PF01832 | Glucosaminidase | 0.42 |
| PF03629 | SASA | 0.42 |
| PF08299 | Bac_DnaA_C | 0.42 |
| PF03837 | RecT | 0.42 |
| PF01531 | Glyco_transf_11 | 0.42 |
| PF10030 | DUF2272 | 0.42 |
| PF09588 | YqaJ | 0.42 |
| PF11913 | DUF3431 | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 238 Family Scaffolds |
|---|---|---|---|
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 11.76 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 1.26 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.42 |
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.10 % |
| All Organisms | root | All Organisms | 47.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10127589 | Not Available | 615 | Open in IMG/M |
| 3300000882|FwDRAFT_10004073 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 7252 | Open in IMG/M |
| 3300000882|FwDRAFT_10069266 | Not Available | 2586 | Open in IMG/M |
| 3300000882|FwDRAFT_10089219 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis | 507 | Open in IMG/M |
| 3300000929|NpDRAFT_10336516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300001282|B570J14230_10207366 | Not Available | 538 | Open in IMG/M |
| 3300002835|B570J40625_100128575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2980 | Open in IMG/M |
| 3300002835|B570J40625_101507887 | Not Available | 551 | Open in IMG/M |
| 3300003277|JGI25908J49247_10010041 | Not Available | 2950 | Open in IMG/M |
| 3300003277|JGI25908J49247_10016559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2237 | Open in IMG/M |
| 3300003277|JGI25908J49247_10016978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2204 | Open in IMG/M |
| 3300003277|JGI25908J49247_10149255 | Not Available | 546 | Open in IMG/M |
| 3300003277|JGI25908J49247_10160757 | Not Available | 522 | Open in IMG/M |
| 3300003277|JGI25908J49247_10167421 | Not Available | 509 | Open in IMG/M |
| 3300003393|JGI25909J50240_1116685 | Not Available | 527 | Open in IMG/M |
| 3300003393|JGI25909J50240_1117737 | Not Available | 524 | Open in IMG/M |
| 3300003394|JGI25907J50239_1022939 | All Organisms → Viruses → Predicted Viral | 1374 | Open in IMG/M |
| 3300003394|JGI25907J50239_1029817 | Not Available | 1171 | Open in IMG/M |
| 3300003394|JGI25907J50239_1031743 | All Organisms → Viruses → Predicted Viral | 1127 | Open in IMG/M |
| 3300003394|JGI25907J50239_1105876 | Not Available | 548 | Open in IMG/M |
| 3300003394|JGI25907J50239_1124042 | Not Available | 500 | Open in IMG/M |
| 3300003431|JGI25913J50563_1035745 | Not Available | 769 | Open in IMG/M |
| 3300003497|JGI25925J51416_10084728 | Not Available | 776 | Open in IMG/M |
| 3300004481|Ga0069718_16103240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300004481|Ga0069718_16144729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1354 | Open in IMG/M |
| 3300004481|Ga0069718_16215833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3664 | Open in IMG/M |
| 3300005581|Ga0049081_10027143 | Not Available | 2174 | Open in IMG/M |
| 3300005581|Ga0049081_10186408 | Not Available | 748 | Open in IMG/M |
| 3300005581|Ga0049081_10208178 | Not Available | 699 | Open in IMG/M |
| 3300005581|Ga0049081_10280962 | Not Available | 577 | Open in IMG/M |
| 3300005582|Ga0049080_10227315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 613 | Open in IMG/M |
| 3300005584|Ga0049082_10332105 | Not Available | 504 | Open in IMG/M |
| 3300006802|Ga0070749_10178219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1225 | Open in IMG/M |
| 3300006802|Ga0070749_10204732 | All Organisms → Viruses → Predicted Viral | 1130 | Open in IMG/M |
| 3300006805|Ga0075464_10004131 | Not Available | 6768 | Open in IMG/M |
| 3300007542|Ga0099846_1250744 | Not Available | 614 | Open in IMG/M |
| 3300007544|Ga0102861_1039986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1207 | Open in IMG/M |
| 3300007545|Ga0102873_1024287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1864 | Open in IMG/M |
| 3300007551|Ga0102881_1020510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1861 | Open in IMG/M |
| 3300007560|Ga0102913_1186903 | Not Available | 666 | Open in IMG/M |
| 3300007590|Ga0102917_1091203 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 1075 | Open in IMG/M |
| 3300007593|Ga0102918_1057188 | All Organisms → Viruses → Predicted Viral | 1127 | Open in IMG/M |
| 3300007632|Ga0102894_1179753 | Not Available | 563 | Open in IMG/M |
| 3300007636|Ga0102856_1053300 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis | 642 | Open in IMG/M |
| 3300007647|Ga0102855_1064558 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis | 988 | Open in IMG/M |
| 3300007670|Ga0102862_1114417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300007708|Ga0102859_1014498 | Not Available | 1999 | Open in IMG/M |
| 3300007708|Ga0102859_1090104 | Not Available | 878 | Open in IMG/M |
| 3300007718|Ga0102852_1104972 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis | 561 | Open in IMG/M |
| 3300007862|Ga0105737_1079711 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis | 814 | Open in IMG/M |
| 3300007974|Ga0105747_1076520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
| 3300008108|Ga0114341_10007198 | Not Available | 10003 | Open in IMG/M |
| 3300008113|Ga0114346_1037418 | All Organisms → cellular organisms → Bacteria | 4387 | Open in IMG/M |
| 3300008116|Ga0114350_1000427 | Not Available | 32039 | Open in IMG/M |
| 3300008259|Ga0114841_1055407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1905 | Open in IMG/M |
| 3300008259|Ga0114841_1068385 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 1653 | Open in IMG/M |
| 3300008266|Ga0114363_1049960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1669 | Open in IMG/M |
| 3300008266|Ga0114363_1084886 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300008448|Ga0114876_1002628 | Not Available | 12500 | Open in IMG/M |
| 3300008448|Ga0114876_1020845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3408 | Open in IMG/M |
| 3300008448|Ga0114876_1026830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2882 | Open in IMG/M |
| 3300008448|Ga0114876_1033114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2503 | Open in IMG/M |
| 3300008448|Ga0114876_1082431 | Not Available | 1331 | Open in IMG/M |
| 3300008448|Ga0114876_1240354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300009058|Ga0102854_1025434 | All Organisms → Viruses → Predicted Viral | 1708 | Open in IMG/M |
| 3300009075|Ga0105090_10287001 | All Organisms → Viruses → Predicted Viral | 1009 | Open in IMG/M |
| 3300009081|Ga0105098_10186180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
| 3300009085|Ga0105103_10122224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1364 | Open in IMG/M |
| 3300009085|Ga0105103_10200019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
| 3300009158|Ga0114977_10477620 | Not Available | 685 | Open in IMG/M |
| 3300009159|Ga0114978_10000688 | All Organisms → cellular organisms → Bacteria | 28605 | Open in IMG/M |
| 3300009168|Ga0105104_10500929 | Not Available | 683 | Open in IMG/M |
| 3300009169|Ga0105097_10037329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2606 | Open in IMG/M |
| 3300009169|Ga0105097_10042402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Aokuangvirus → Aokuangvirus SCBWM1 | 2444 | Open in IMG/M |
| 3300009169|Ga0105097_10044014 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 2399 | Open in IMG/M |
| 3300009169|Ga0105097_10128322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1391 | Open in IMG/M |
| 3300009169|Ga0105097_10176133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Rhizorhabdus → Rhizorhabdus histidinilytica | 1177 | Open in IMG/M |
| 3300009169|Ga0105097_10196806 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Luteolibacter → Luteolibacter yonseiensis | 1110 | Open in IMG/M |
| 3300009169|Ga0105097_10642035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis | 599 | Open in IMG/M |
| 3300009170|Ga0105096_10350122 | Not Available | 758 | Open in IMG/M |
| 3300010354|Ga0129333_10023025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5912 | Open in IMG/M |
| 3300010354|Ga0129333_10081865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2992 | Open in IMG/M |
| 3300010354|Ga0129333_10103507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2629 | Open in IMG/M |
| 3300010354|Ga0129333_10106348 | All Organisms → cellular organisms → Bacteria | 2591 | Open in IMG/M |
| 3300010354|Ga0129333_10174423 | Not Available | 1965 | Open in IMG/M |
| 3300010354|Ga0129333_10258981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1566 | Open in IMG/M |
| 3300010354|Ga0129333_10329072 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300010354|Ga0129333_10480825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1091 | Open in IMG/M |
| 3300010354|Ga0129333_10913515 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 742 | Open in IMG/M |
| 3300010368|Ga0129324_10007744 | Not Available | 5860 | Open in IMG/M |
| 3300010368|Ga0129324_10047732 | Not Available | 1969 | Open in IMG/M |
| 3300010368|Ga0129324_10231180 | Not Available | 742 | Open in IMG/M |
| 3300010370|Ga0129336_10770584 | Not Available | 507 | Open in IMG/M |
| 3300011010|Ga0139557_1004014 | All Organisms → cellular organisms → Bacteria | 3164 | Open in IMG/M |
| 3300011011|Ga0139556_1012507 | Not Available | 1222 | Open in IMG/M |
| 3300011011|Ga0139556_1037847 | Not Available | 710 | Open in IMG/M |
| 3300011334|Ga0153697_1074 | Not Available | 32789 | Open in IMG/M |
| 3300012663|Ga0157203_1000222 | Not Available | 19228 | Open in IMG/M |
| 3300012663|Ga0157203_1000252 | Not Available | 17883 | Open in IMG/M |
| 3300012663|Ga0157203_1019329 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis | 1008 | Open in IMG/M |
| 3300013004|Ga0164293_10320081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Luteolibacter → Luteolibacter yonseiensis | 1068 | Open in IMG/M |
| 3300013372|Ga0177922_10260536 | Not Available | 603 | Open in IMG/M |
| 3300013372|Ga0177922_10360549 | Not Available | 673 | Open in IMG/M |
| 3300013372|Ga0177922_10476455 | Not Available | 562 | Open in IMG/M |
| 3300013372|Ga0177922_10689746 | Not Available | 859 | Open in IMG/M |
| 3300014811|Ga0119960_1041864 | Not Available | 723 | Open in IMG/M |
| 3300017701|Ga0181364_1069156 | Not Available | 541 | Open in IMG/M |
| 3300017716|Ga0181350_1008046 | Not Available | 3021 | Open in IMG/M |
| 3300017722|Ga0181347_1014861 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 2499 | Open in IMG/M |
| 3300017722|Ga0181347_1037433 | Not Available | 1495 | Open in IMG/M |
| 3300017723|Ga0181362_1017731 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 1532 | Open in IMG/M |
| 3300017723|Ga0181362_1048537 | Not Available | 885 | Open in IMG/M |
| 3300017723|Ga0181362_1084887 | Not Available | 637 | Open in IMG/M |
| 3300017736|Ga0181365_1010355 | All Organisms → cellular organisms → Bacteria | 2323 | Open in IMG/M |
| 3300017736|Ga0181365_1026446 | Not Available | 1463 | Open in IMG/M |
| 3300017736|Ga0181365_1076806 | Not Available | 820 | Open in IMG/M |
| 3300017754|Ga0181344_1004933 | Not Available | 4512 | Open in IMG/M |
| 3300017754|Ga0181344_1011625 | All Organisms → cellular organisms → Bacteria | 2814 | Open in IMG/M |
| 3300017761|Ga0181356_1035318 | Not Available | 1775 | Open in IMG/M |
| 3300017761|Ga0181356_1084382 | Not Available | 1051 | Open in IMG/M |
| 3300017761|Ga0181356_1181114 | Not Available | 635 | Open in IMG/M |
| 3300017761|Ga0181356_1212663 | Not Available | 567 | Open in IMG/M |
| 3300017761|Ga0181356_1222472 | Not Available | 549 | Open in IMG/M |
| 3300017761|Ga0181356_1248838 | Not Available | 507 | Open in IMG/M |
| 3300017766|Ga0181343_1007849 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter → Mucilaginibacter mali | 3538 | Open in IMG/M |
| 3300017766|Ga0181343_1213160 | Not Available | 527 | Open in IMG/M |
| 3300017774|Ga0181358_1025337 | Not Available | 2342 | Open in IMG/M |
| 3300017774|Ga0181358_1180634 | Not Available | 702 | Open in IMG/M |
| 3300017774|Ga0181358_1263569 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Luteolibacter → Luteolibacter yonseiensis | 537 | Open in IMG/M |
| 3300017777|Ga0181357_1064797 | Not Available | 1411 | Open in IMG/M |
| 3300017777|Ga0181357_1068688 | Not Available | 1364 | Open in IMG/M |
| 3300017777|Ga0181357_1069638 | Not Available | 1354 | Open in IMG/M |
| 3300017777|Ga0181357_1111625 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300017780|Ga0181346_1105747 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300017780|Ga0181346_1111428 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 1055 | Open in IMG/M |
| 3300017780|Ga0181346_1117177 | Not Available | 1022 | Open in IMG/M |
| 3300017780|Ga0181346_1144400 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nomurabacteria | 895 | Open in IMG/M |
| 3300017780|Ga0181346_1151850 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 866 | Open in IMG/M |
| 3300017784|Ga0181348_1280067 | Not Available | 566 | Open in IMG/M |
| 3300017785|Ga0181355_1177208 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nomurabacteria | 849 | Open in IMG/M |
| 3300019784|Ga0181359_1003617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4774 | Open in IMG/M |
| 3300019784|Ga0181359_1011939 | All Organisms → cellular organisms → Bacteria → PVC group → Kiritimatiellota → Kiritimatiellia → Kiritimatiellales → Kiritimatiellaceae → unclassified Kiritimatiellaceae → Kiritimatiellaceae bacterium | 3130 | Open in IMG/M |
| 3300019784|Ga0181359_1013158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium ADurb.Bin341 | 3008 | Open in IMG/M |
| 3300019784|Ga0181359_1018562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2609 | Open in IMG/M |
| 3300019784|Ga0181359_1040422 | Not Available | 1807 | Open in IMG/M |
| 3300019784|Ga0181359_1044161 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 1725 | Open in IMG/M |
| 3300019784|Ga0181359_1135667 | Not Available | 862 | Open in IMG/M |
| 3300019784|Ga0181359_1152896 | Not Available | 789 | Open in IMG/M |
| 3300019784|Ga0181359_1155677 | Not Available | 779 | Open in IMG/M |
| 3300019784|Ga0181359_1172480 | Not Available | 722 | Open in IMG/M |
| 3300019784|Ga0181359_1208725 | Not Available | 623 | Open in IMG/M |
| 3300020048|Ga0207193_1001641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 39941 | Open in IMG/M |
| 3300020151|Ga0211736_10958836 | Not Available | 570 | Open in IMG/M |
| 3300020159|Ga0211734_10123005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1502 | Open in IMG/M |
| 3300020160|Ga0211733_10496486 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 680 | Open in IMG/M |
| 3300020160|Ga0211733_10878712 | Not Available | 910 | Open in IMG/M |
| 3300020161|Ga0211726_10256101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300020162|Ga0211735_10065951 | Not Available | 878 | Open in IMG/M |
| 3300020490|Ga0208052_108435 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300020557|Ga0208231_1058247 | Not Available | 589 | Open in IMG/M |
| 3300020562|Ga0208597_1001501 | Not Available | 8832 | Open in IMG/M |
| 3300020573|Ga0208485_1017571 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300021328|Ga0210298_1156259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300022179|Ga0181353_1018757 | Not Available | 1808 | Open in IMG/M |
| 3300022179|Ga0181353_1096710 | Not Available | 730 | Open in IMG/M |
| 3300022190|Ga0181354_1085478 | Not Available | 1038 | Open in IMG/M |
| 3300022190|Ga0181354_1135006 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300022407|Ga0181351_1189757 | Not Available | 698 | Open in IMG/M |
| 3300024343|Ga0244777_10000325 | Not Available | 38361 | Open in IMG/M |
| 3300024343|Ga0244777_10103722 | Not Available | 1836 | Open in IMG/M |
| 3300024343|Ga0244777_10189888 | Not Available | 1320 | Open in IMG/M |
| 3300024343|Ga0244777_10221036 | Not Available | 1211 | Open in IMG/M |
| 3300024346|Ga0244775_10015315 | Not Available | 7124 | Open in IMG/M |
| 3300024348|Ga0244776_10044097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3517 | Open in IMG/M |
| 3300024348|Ga0244776_10148243 | All Organisms → Viruses → Predicted Viral | 1710 | Open in IMG/M |
| 3300024348|Ga0244776_10357870 | Not Available | 980 | Open in IMG/M |
| 3300024348|Ga0244776_10529308 | Not Available | 756 | Open in IMG/M |
| 3300024505|Ga0255150_1045676 | Not Available | 706 | Open in IMG/M |
| 3300024510|Ga0255187_1022404 | Not Available | 882 | Open in IMG/M |
| 3300025647|Ga0208160_1133761 | Not Available | 615 | Open in IMG/M |
| 3300025889|Ga0208644_1186238 | Not Available | 915 | Open in IMG/M |
| 3300025896|Ga0208916_10003152 | Not Available | 6651 | Open in IMG/M |
| 3300027206|Ga0208023_1034194 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis | 864 | Open in IMG/M |
| 3300027311|Ga0208812_1076935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300027581|Ga0209651_1036580 | Not Available | 1498 | Open in IMG/M |
| 3300027656|Ga0209357_1022461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2193 | Open in IMG/M |
| 3300027659|Ga0208975_1036512 | Not Available | 1551 | Open in IMG/M |
| 3300027659|Ga0208975_1197503 | Not Available | 539 | Open in IMG/M |
| 3300027683|Ga0209392_1243236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300027693|Ga0209704_1110015 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 787 | Open in IMG/M |
| 3300027693|Ga0209704_1241159 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 528 | Open in IMG/M |
| 3300027721|Ga0209492_1017465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2446 | Open in IMG/M |
| 3300027721|Ga0209492_1042176 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
| 3300027721|Ga0209492_1053724 | Not Available | 1421 | Open in IMG/M |
| 3300027753|Ga0208305_10185560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300027753|Ga0208305_10315556 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300027764|Ga0209134_10003744 | All Organisms → Viruses → Predicted Viral | 4404 | Open in IMG/M |
| 3300027764|Ga0209134_10017477 | All Organisms → Viruses → Predicted Viral | 2238 | Open in IMG/M |
| 3300027785|Ga0209246_10056170 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
| 3300027798|Ga0209353_10002883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9193 | Open in IMG/M |
| 3300027798|Ga0209353_10165395 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300027808|Ga0209354_10123239 | Not Available | 1058 | Open in IMG/M |
| 3300028025|Ga0247723_1000607 | All Organisms → cellular organisms → Bacteria | 23848 | Open in IMG/M |
| 3300028025|Ga0247723_1011096 | Not Available | 3473 | Open in IMG/M |
| 3300028269|Ga0255193_1048010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1024420 | Not Available | 4020 | Open in IMG/M |
| 3300031758|Ga0315907_10002099 | Not Available | 25773 | Open in IMG/M |
| 3300031857|Ga0315909_10130758 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
| 3300031857|Ga0315909_10255054 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 1343 | Open in IMG/M |
| 3300031857|Ga0315909_10549392 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300031873|Ga0315297_10829124 | Not Available | 770 | Open in IMG/M |
| 3300031999|Ga0315274_10390367 | All Organisms → Viruses → Predicted Viral | 1617 | Open in IMG/M |
| 3300032050|Ga0315906_10827523 | Not Available | 722 | Open in IMG/M |
| 3300032092|Ga0315905_11623015 | Not Available | 501 | Open in IMG/M |
| 3300032093|Ga0315902_10165134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 2280 | Open in IMG/M |
| 3300032401|Ga0315275_12007617 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis | 609 | Open in IMG/M |
| 3300033521|Ga0316616_103625439 | Not Available | 581 | Open in IMG/M |
| 3300033993|Ga0334994_0228875 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Luteolibacter → Luteolibacter yonseiensis | 987 | Open in IMG/M |
| 3300033994|Ga0334996_0135008 | Not Available | 1392 | Open in IMG/M |
| 3300033994|Ga0334996_0215537 | Not Available | 1013 | Open in IMG/M |
| 3300033995|Ga0335003_0024582 | Not Available | 3248 | Open in IMG/M |
| 3300034012|Ga0334986_0055841 | All Organisms → Viruses → Predicted Viral | 2488 | Open in IMG/M |
| 3300034013|Ga0334991_0030624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3002 | Open in IMG/M |
| 3300034013|Ga0334991_0193415 | Not Available | 890 | Open in IMG/M |
| 3300034013|Ga0334991_0196796 | Not Available | 879 | Open in IMG/M |
| 3300034061|Ga0334987_0221312 | Not Available | 1313 | Open in IMG/M |
| 3300034064|Ga0335001_0074622 | Not Available | 1949 | Open in IMG/M |
| 3300034064|Ga0335001_0247494 | Not Available | 984 | Open in IMG/M |
| 3300034064|Ga0335001_0276239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300034082|Ga0335020_0000721 | Not Available | 24326 | Open in IMG/M |
| 3300034101|Ga0335027_0165296 | Not Available | 1608 | Open in IMG/M |
| 3300034101|Ga0335027_0174220 | Not Available | 1554 | Open in IMG/M |
| 3300034105|Ga0335035_0372418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 819 | Open in IMG/M |
| 3300034106|Ga0335036_0459549 | Not Available | 803 | Open in IMG/M |
| 3300034122|Ga0335060_0323787 | Not Available | 836 | Open in IMG/M |
| 3300034122|Ga0335060_0532802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300034272|Ga0335049_0509303 | Not Available | 765 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 31.09% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 11.34% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.24% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.98% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.04% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.36% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.94% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.68% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.26% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.26% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 1.26% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.84% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.84% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.84% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.84% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.42% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.42% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.42% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.42% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020490 | Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021328 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R877 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300024510 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027206 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027311 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028269 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BS_KBA_SWE12_21mDRAFT_101275892 | 3300000124 | Marine | MKTTALGILTIIATLSNVALQLLSGSNPDFAAAFAAVVAGAGLIQASDSK* |
| FwDRAFT_100040734 | 3300000882 | Freshwater And Marine | MKTTVLGILTIVATLANVGVQVLNGGAPDFMAAFAAVTAGVGLIKARDNK* |
| FwDRAFT_100692662 | 3300000882 | Freshwater And Marine | MKTTALGILTIVATLSNVGIQLLNGGSPDFVGAFAAVTAGFGLI |
| FwDRAFT_100892192 | 3300000882 | Freshwater And Marine | MKTTALGVLTIVATLANVGIQLLNGAAPDFIGAFAAVTAGVGLIKARDNK* |
| NpDRAFT_103365163 | 3300000929 | Freshwater And Marine | MKTTALGILTIVATLSNVGIQLLNGGSPDFVGAFAAVTAGFGLIKARDNK* |
| B570J14230_102073661 | 3300001282 | Freshwater | MKTTALGILTIVATVSNVGIQLLSGDSPDFSAAFAAVVAGVGLIKAADAK* |
| B570J40625_1001285753 | 3300002835 | Freshwater | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGFGLIKARDSGR* |
| B570J40625_1015078871 | 3300002835 | Freshwater | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGFGLIKARD |
| JGI25908J49247_100100414 | 3300003277 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLLNGGAPDFIGAFAAVTAGVGLIKARDNK* |
| JGI25908J49247_100165596 | 3300003277 | Freshwater Lake | MKTTALGIITIIATLSNVALQLLSGGQPDFAAAFAAVVAGAGLIQASDAK* |
| JGI25908J49247_100169782 | 3300003277 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLLNGGAPDFIGAFAAVTAGVGLIKAGDSK* |
| JGI25908J49247_101492551 | 3300003277 | Freshwater Lake | MKTTALGIITIIATLSNVALQLLSGGSPDFAAAFAAVVAGAGLIQASDAK* |
| JGI25908J49247_101607571 | 3300003277 | Freshwater Lake | MKTTALGILTIIVTVANVAIQLLTGGSPDIAASFAAILGG |
| JGI25908J49247_101674211 | 3300003277 | Freshwater Lake | MKTTLLGILTIVATVANVAVQLLTGDNPDLAAAFAAVVAGAGLIKAADAK* |
| JGI25909J50240_11166852 | 3300003393 | Freshwater Lake | TMKTTLLGILTIVATVANVAIQLLTGDNPDLAAAFAAVVAGAGLIKAADAK* |
| JGI25909J50240_11177372 | 3300003393 | Freshwater Lake | MKTTALGIVTIIATLSNVALQLLSGGSPDFAAAFAAVVAGAGLIQASDAK* |
| JGI25907J50239_10229393 | 3300003394 | Freshwater Lake | MKTTILGILTIVSTVANVAIQLLTGDNPDLAASFAAIVAGAGLIK |
| JGI25907J50239_10298171 | 3300003394 | Freshwater Lake | MKTTALGILTIIATIANVAIQLLTGDTPDLAASFAAIVAGAGLIKAA |
| JGI25907J50239_10317432 | 3300003394 | Freshwater Lake | MKTTALGILTIVATLSSVGIQVLKGGSPDLIGAFAAITAGVGLIKARDNK* |
| JGI25907J50239_11058761 | 3300003394 | Freshwater Lake | YNPTRTMKTTALGIVTIIATLSNVALQLLSGGSPDFAAAFAAVVAGAGLIQASDAK* |
| JGI25907J50239_11240422 | 3300003394 | Freshwater Lake | MKTTVLGILTIVATISNVAIQFISGEAPDFAAAFAAVVAGVGLIKAADAK* |
| JGI25913J50563_10357452 | 3300003431 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLLNGSAPDFIGAFAAVTAGVGLIKAGDDK* |
| JGI25925J51416_100847283 | 3300003497 | Freshwater Lake | MKTTVLGILTIVATISNVAIQFISGEAPDFAAAFAAVVAGVGLIKAAXAK* |
| Ga0069718_161032403 | 3300004481 | Sediment | MKTTALGILTIVATLSNVGIQLLNGSAPDFVGAFAAVTAGFGLIKARDNK* |
| Ga0069718_161447291 | 3300004481 | Sediment | MKTTVLGILTIVATASNVAIQIISGESPDFAAAFAAVIAGVGLIKAADAK* |
| Ga0069718_1621583310 | 3300004481 | Sediment | VATLANVSIQLLNGSSPDLVGAFAAVTAGFGLIKARDNK* |
| Ga0049081_100271433 | 3300005581 | Freshwater Lentic | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGVGLIKAGDSK* |
| Ga0049081_101864082 | 3300005581 | Freshwater Lentic | MKTTALGILTIVATLSNVGIQLLNGGSPDFIGAFAAVTAGVGLIKAGDSK* |
| Ga0049081_102081783 | 3300005581 | Freshwater Lentic | MKTTALGILTIIATVANVAIQLLTGENPDFAAAFAAVVAGAGLIKAADAK* |
| Ga0049081_102809622 | 3300005581 | Freshwater Lentic | MKTTALGILTIVATLSNVGIQLLNGGAPDFIGAFAAITAGVGLIKAGDSK* |
| Ga0049080_102273151 | 3300005582 | Freshwater Lentic | IVATLANVGVQVLKGGAPDFMGAFAAVTAGIGLIKARDNK* |
| Ga0049082_103321051 | 3300005584 | Freshwater Lentic | MQTTALGILTIIATIANVAIQLLTGDTPDLAASFAAIVAGAGLIKAADAK* |
| Ga0070749_101782192 | 3300006802 | Aqueous | MKTTVLGVLTIVATLSNVGIQVLKGGAPDFVGAFAAITAGFGLIKARDAGR* |
| Ga0070749_102047322 | 3300006802 | Aqueous | MKTTALGILTIVATISNVGIQILKGGAPDLVGAFAAITAGFGLIKARDASK* |
| Ga0075464_1000413111 | 3300006805 | Aqueous | MKTTALGILTIVATLSNVGIQLLNGGAPDLVGAFAAVTAGVGLIKAGDSK* |
| Ga0099846_12507441 | 3300007542 | Aqueous | MKTTALGILTIVATLSNVGIQLLNGSAPDFIGAFAAVTAGVGLIKAGDQ* |
| Ga0102861_10399864 | 3300007544 | Estuarine | MKTTALGILTIVATLSNVGIQLINGSAPDFVGAFAAVTAGFGLIKARDAGR* |
| Ga0102873_10242872 | 3300007545 | Estuarine | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGFGLIKARDNK* |
| Ga0102881_10205104 | 3300007551 | Estuarine | LSNVGIQLLNGGAPDFVGAFAAVTAGFGLIKARDNK* |
| Ga0102913_11869032 | 3300007560 | Estuarine | MKTTVLGILTIVATLANVGVQVLKGGAPDFMAAFAAVTAGVGLIKARDNK* |
| Ga0102917_10912031 | 3300007590 | Estuarine | LANVGIQLLNGAAPDFIGAFAAVTAGVGLIKARDNK* |
| Ga0102918_10571882 | 3300007593 | Estuarine | MKTTALGILTIVATLSNVGIQILKGGAPDFVGAFAAVTA |
| Ga0102894_11797532 | 3300007632 | Estuarine | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGFGLIK |
| Ga0102856_10533001 | 3300007636 | Estuarine | MKTTALGILTIVATLSSVGIQVLKGGAPDLIGAFAAITAGVGLIKARDNK* |
| Ga0102855_10645583 | 3300007647 | Estuarine | MKTTALGILTIVATLSSVGVQVLNGGAPDLIGAFAAITAGVGLIKARDNK* |
| Ga0102862_11144173 | 3300007670 | Estuarine | VLTIVATLANCGVQILNGGTPDLMGAFAAITAGFGLVKAKDASK* |
| Ga0102859_10144983 | 3300007708 | Estuarine | MKTTALGILTIVATLSSVGIQVLKGGAPDLIGAFAAITAGV |
| Ga0102859_10901042 | 3300007708 | Estuarine | MKTTALGILTIVATLSNVGIQLLNGGAPDFIGAFAAVTAGVGLIKAGDDK* |
| Ga0102852_11049722 | 3300007718 | Estuarine | MKTTALGILTIVATLSSVGVQVLKGGAPDLIGAFAAITAGVGLIKARDNK* |
| Ga0105737_10797111 | 3300007862 | Estuary Water | LTIVATLSNVGIQVLKGGAPDLMSAFAAVTAGIGLIKARDNK* |
| Ga0105747_10765201 | 3300007974 | Estuary Water | GILTIVATLANVGVQVLKGGAPDFMGAFAAVTAGIGLIKARDNK* |
| Ga0114341_100071987 | 3300008108 | Freshwater, Plankton | MKTTLLGVLTIVATLANVGMQILQGQSPDLMAAFAAVTAGVGLIKAHDSK* |
| Ga0114346_10374183 | 3300008113 | Freshwater, Plankton | MKTTVLGILTIVATVSNVAIQVISGEAPDFAAAFAAVVAGIGLVKAADAK* |
| Ga0114350_100042727 | 3300008116 | Freshwater, Plankton | MKTTVLGILTIVTTVSNVGIQVIKGTPPDFAAAFAAVAAGVGLIKAADAKKK* |
| Ga0114841_10554071 | 3300008259 | Freshwater, Plankton | SNVGIQILKGGAPDFVGAFAAVTAGIGLIKAKDAK* |
| Ga0114841_10683852 | 3300008259 | Freshwater, Plankton | MKTTVLGILTIVATLANVGVQVLNGGAPDFMAAFAAVTAGVGLIKARDQK* |
| Ga0114363_10499604 | 3300008266 | Freshwater, Plankton | MKTTALGILTIVATLANVGVQVLKGGAPDFVGAFAAITAGFGLIKARDAGR* |
| Ga0114363_10848861 | 3300008266 | Freshwater, Plankton | LSNVGIQLLNGGAPDFVGAFAAITAGFGLIKARDAGR* |
| Ga0114876_10026284 | 3300008448 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLLNGSAPDFVGAFAAVTAGFGLIKARDAGR* |
| Ga0114876_10208458 | 3300008448 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLINGSAPDFVGAFAAVTAGFGLIKARDAGK* |
| Ga0114876_10268303 | 3300008448 | Freshwater Lake | MKTTALGILTIVATVSNVGIQVLKGTPPDFAAAFAAVAAGVGLIKAADAKKK* |
| Ga0114876_10331142 | 3300008448 | Freshwater Lake | MKTTALGILTIVATVSNVGIQVLKGTPPDFAAAFAAVVAGVGLIKAADAKKK* |
| Ga0114876_10824313 | 3300008448 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAITAGFGLIKARDAGR* |
| Ga0114876_12403542 | 3300008448 | Freshwater Lake | MKTTALGILTIVATLSSVGIQLLKGGSPDLVGAFAAVTAGFGLIKARDNK* |
| Ga0102854_10254343 | 3300009058 | Estuarine | MKTTALGILTILATLSSVGVQVLKGGAPDLIGAFAAITAGVGLIKARDNK* |
| Ga0105090_102870013 | 3300009075 | Freshwater Sediment | MKTTALGILTIVATLANVGVQVLNGGAPNFMGAIAALTAGFGLVKAQDHRR* |
| Ga0105098_101861803 | 3300009081 | Freshwater Sediment | LANVGVQVLKGGAPDFMGAFAAVTAGIGLIKARDNK* |
| Ga0105103_101222243 | 3300009085 | Freshwater Sediment | MKTTALGILTIVATLANVGVQVLKGGAPDFMGAFAALTAGFGLIKARDASK* |
| Ga0105103_102000194 | 3300009085 | Freshwater Sediment | ATLANVGVQVLKGGAPDLMGAFAAVTAGIGLIKARDNK* |
| Ga0114977_104776201 | 3300009158 | Freshwater Lake | TNRTKTRTTARTMKTTLLGILTIVATVANVAIQLLTGDNPDLAAAFAAVVAGAGLIKAADAK* |
| Ga0114978_1000068838 | 3300009159 | Freshwater Lake | MKTTLLGILTIVATVANVAIQLLTGDNPDLAAAFAAVVAGAGLIKAADAK* |
| Ga0105104_105009293 | 3300009168 | Freshwater Sediment | MRTTALGILTIVATLSGVGIQILKGGAPDFVGAFAAVTAGIGL |
| Ga0105097_100373291 | 3300009169 | Freshwater Sediment | LTIVATIANVGVQVLKGGAPDFMGAFAAVTAGIGLIKARDAK* |
| Ga0105097_100424026 | 3300009169 | Freshwater Sediment | MKTTALGILTIVATLSNVGIQLLNGVSPDFIGAFAAVTAGVGLIKAGDSK* |
| Ga0105097_100440144 | 3300009169 | Freshwater Sediment | MKTTLLGVLTIVATLANVGLQFLQGESPDLMAAFAALTAGVGLIKAHDSK* |
| Ga0105097_101283221 | 3300009169 | Freshwater Sediment | LGILTIVATLSNVGIQVLKGGAPDFVGAFAAVTAGIGLIKARDNK* |
| Ga0105097_101761332 | 3300009169 | Freshwater Sediment | MKTTALGILTIVATLSNVGIQLLNGSAPDFIGAFAAVTAGVGLIKAGDSK* |
| Ga0105097_101968063 | 3300009169 | Freshwater Sediment | MKTTALGILTIVATLANVGVQVLKGGNPDFMGAIAALTAGFGLVKAQDHRR* |
| Ga0105097_106420351 | 3300009169 | Freshwater Sediment | GILTIVATLSNVGIQVLKGGSPDLMGAFAAVTAGIGLIKARDYK* |
| Ga0105096_103501222 | 3300009170 | Freshwater Sediment | MKTTALGILTIVATLSNVGIQVLKGGSPDLMSAFAALTAGVGLIKARD |
| Ga0129333_100230257 | 3300010354 | Freshwater To Marine Saline Gradient | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGFGLIKARDAGK* |
| Ga0129333_100818651 | 3300010354 | Freshwater To Marine Saline Gradient | TIVATLANVGVQVLKGGAPDFMGAFAAVTAGIGLIKARDNK* |
| Ga0129333_101035076 | 3300010354 | Freshwater To Marine Saline Gradient | MKTTALGILTIVATLSNVGIQLLNGGSPDFVGAFAAVTAGFGLIKARDAGK* |
| Ga0129333_101063484 | 3300010354 | Freshwater To Marine Saline Gradient | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAITAGFGLIKARDAGK* |
| Ga0129333_101744231 | 3300010354 | Freshwater To Marine Saline Gradient | TTALGILTIVATLSNVGIQLLNGGSPDFVGAFAAVTAGFGLIKARDASK* |
| Ga0129333_102589813 | 3300010354 | Freshwater To Marine Saline Gradient | MKTTVLGILTIVATVSNVAIQVISGEAPDLAAAFAAVVAGIGLVKAADDK* |
| Ga0129333_103290722 | 3300010354 | Freshwater To Marine Saline Gradient | MKTTALGILTIVATLSNVGIQILKGGAPDFVGAFAAVTAGFGLIKARDAGK* |
| Ga0129333_104808252 | 3300010354 | Freshwater To Marine Saline Gradient | MKTTALGILTIVATLSNVGIQILKGGAPDFVGAFAAVTAGFGLIKARDAGR* |
| Ga0129333_109135152 | 3300010354 | Freshwater To Marine Saline Gradient | ATLSNVGIQILKGGAPDFVGAFAAVTAGVGLIKAKDAK* |
| Ga0129324_100077441 | 3300010368 | Freshwater To Marine Saline Gradient | IMKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGVGLIKAGDSK* |
| Ga0129324_100477321 | 3300010368 | Freshwater To Marine Saline Gradient | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTA |
| Ga0129324_102311801 | 3300010368 | Freshwater To Marine Saline Gradient | IIVSTVSNACVQLLKGGSPDLIGAFTSITAGIGLIKAQDQ* |
| Ga0129336_107705842 | 3300010370 | Freshwater To Marine Saline Gradient | MKTTVLGILTIVATVSNVAIQVISGDSPDFAAAFAAVVAGIGLVKAADDK* |
| Ga0139557_10040145 | 3300011010 | Freshwater | MKTTLLGILTIVATVANVAIQLLTGDTPDLAASFAAIVAGAGLIKAADAK* |
| Ga0139556_10125071 | 3300011011 | Freshwater | MKTTLLGILTIVATVANVAIQLLTGDNPDLAASFAAIVAGAGLIKAADAK* |
| Ga0139556_10378472 | 3300011011 | Freshwater | MKTTALGIITIIATLANVAVQILSGGSPDFAAAFAAVVAGAGLIQASDAK* |
| Ga0153697_107441 | 3300011334 | Freshwater | MIQLNKIMKTTVLGILTIVATASNVAIQIISGESPDFAAAFAAVIAGVGLIKAADAK* |
| Ga0157203_100022246 | 3300012663 | Freshwater | MKTTVLGILTIVATISNVAIQFISGEAPDFTAAFAAVVAGVGLIKAADAK* |
| Ga0157203_10002526 | 3300012663 | Freshwater | MKTTVLGILTIVATVSNVAIQFISGEAPDFAAAFAAVVAGVGLIKAADAK* |
| Ga0157203_10193293 | 3300012663 | Freshwater | MKTTTLGILTIVATLSNVGIQVLKGGAPDLIGAFAAITAGVGLIKARDNK* |
| Ga0164293_103200812 | 3300013004 | Freshwater | MKTTVLGILTIVATISNLAIQFISGEAPDFAAAFAAVVAGVGLIKAADAK* |
| Ga0177922_102605361 | 3300013372 | Freshwater | MKTTLLGILTIVATVANVAIQLLTGDNPDLAAAFAAVV |
| Ga0177922_103605492 | 3300013372 | Freshwater | MKTTVLGILTIVATLANVGVQVLKGGAPDFMSAFAAVTAGVGLIKARDNK* |
| Ga0177922_104764552 | 3300013372 | Freshwater | TALGIITIIATLSNVALQILSGGSPDLAAAFAAIVAGAGLIQASDAK* |
| Ga0177922_106897461 | 3300013372 | Freshwater | MKTTALGILTIIATIANVAIQLLTGDTPDLAASFAAI |
| Ga0119960_10418641 | 3300014811 | Aquatic | MKTTLLGILTIIATIANVAIQLLTGDNPDLAASFAAIVAGAGLIKAL* |
| Ga0181364_10691561 | 3300017701 | Freshwater Lake | TRIHIMKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGVGLIKAGDSK |
| Ga0181350_10080467 | 3300017716 | Freshwater Lake | MKTTVLGILTIVATISNVAIQFISGEAPDFAAAFAAVVAGVGLIKAAD |
| Ga0181347_10148614 | 3300017722 | Freshwater Lake | MKTTALGIITIIATLSNVALQLLSGGQPDFAAAFAAVVAGAGLI |
| Ga0181347_10374334 | 3300017722 | Freshwater Lake | QNNNMKTTALGIVTIIATLSNVALQLLSGGSPDFAAAFAAVVAGAGLIQASDAK |
| Ga0181362_10177312 | 3300017723 | Freshwater Lake | MKTTALGIVTIIATLSNVALQLLSGGQPDFAAAFAAVVAGAGLIQASDAK |
| Ga0181362_10485373 | 3300017723 | Freshwater Lake | MKTTLLGILTIVATVANVAIQLLTGDNPDLAVSFAAIV |
| Ga0181362_10848871 | 3300017723 | Freshwater Lake | MKTTALGIVTIIATLSNVALQLLSGGSPDFAAAFAAVV |
| Ga0181365_10103552 | 3300017736 | Freshwater Lake | MKTTLLGILTIVATVANVAIQILTGDNPDLAAAFAAVVAGAGLIKAADAK |
| Ga0181365_10264461 | 3300017736 | Freshwater Lake | MKTTALGIITIIATLSNVALQLLSGGSPDFAAAFAAVVAGAGLIQASDSK |
| Ga0181365_10768063 | 3300017736 | Freshwater Lake | MKTTALGIVTIIATLSNVALQLLSGGSPDFAAAFAAVVAGVGL |
| Ga0181344_10049334 | 3300017754 | Freshwater Lake | MKTTVLGILTIVATASNVAIQIISGESPDFAVAFAAVIAGVGLIKAADAK |
| Ga0181344_10116257 | 3300017754 | Freshwater Lake | MKTTKLGILTIVATVANVAIQLLTGDNPDLAAAFAAVVAGAGLIKAADAK |
| Ga0181356_10353181 | 3300017761 | Freshwater Lake | MKTTALGILTIIATIANVAIQLLTGDTPDLAASFAAIV |
| Ga0181356_10843821 | 3300017761 | Freshwater Lake | MKTTALGIITIIATLSNVALQILSGGSPDLAAAFAAIVAGA |
| Ga0181356_11811142 | 3300017761 | Freshwater Lake | MKTTVLGILTIVATISNVAIQFISGEAPDFTAAFAAVVAGVGLIKAADAK |
| Ga0181356_12126634 | 3300017761 | Freshwater Lake | GIVTIIATLSNVALQLLSGGSPDFAAAFAAVVAGEGLIQASDAK |
| Ga0181356_12224722 | 3300017761 | Freshwater Lake | MKTTALGIVTIIATLSNVTLQILSGGSPDLAAAFAAIVAGAGLIQASDAK |
| Ga0181356_12488381 | 3300017761 | Freshwater Lake | MKTTALGIVTIIATLSNVALQLLSGGSPDFAAAFAAVVAGVGLIQASDAK |
| Ga0181343_10078496 | 3300017766 | Freshwater Lake | MKTTILGILTIVATVANVAIHLLTGDNPDLAAAFAAIVA |
| Ga0181343_12131602 | 3300017766 | Freshwater Lake | VLGILTIVATASNVAIQIISGESPDFAAAFAAVIAGVGLIKAADAK |
| Ga0181358_10253374 | 3300017774 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLLNGSAPDFIGAFAAVTAGV |
| Ga0181358_11806341 | 3300017774 | Freshwater Lake | MKTTALGIVTIIATLSNVALQLLSGGSPDFAAAFAAVVAGV |
| Ga0181358_12635691 | 3300017774 | Freshwater Lake | MKTTALGIVTIIATLSNVALQLLSGGSPDFAAAFAAVVAGAL |
| Ga0181357_10647971 | 3300017777 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLLNGSSPDFIGAFAAVTA |
| Ga0181357_10686881 | 3300017777 | Freshwater Lake | MKTTALGIVTIIATLSNVALQLLSGGSPDFAAAFAAVVAGAGLIQA |
| Ga0181357_10696384 | 3300017777 | Freshwater Lake | MKTTALGIVTIIATLSNVALQLLSGGSPDFAAAFA |
| Ga0181357_11116251 | 3300017777 | Freshwater Lake | TTARTMKTTLLGILTIVATVANVAIQLLTGDNPDLAAAFAAVVAGAGLIKAADAK |
| Ga0181346_11057473 | 3300017780 | Freshwater Lake | MKTTLLGILTIVATVANVAIQLLTGDNPDLAAAFAAVVAGAGL |
| Ga0181346_11114281 | 3300017780 | Freshwater Lake | QNNNMKTTALGIVTIIATLSNVALQLLSGGSPDFTAAFAAVVAGAGLIQASDAK |
| Ga0181346_11171771 | 3300017780 | Freshwater Lake | VATLSNVGIQLLNGGAPDFVGAFAAVTAGVGLIKAGDSK |
| Ga0181346_11444003 | 3300017780 | Freshwater Lake | MKTTILGILTIVATVANVAIQLLTGDNPDLAAAFAAVVAGAGL |
| Ga0181346_11518503 | 3300017780 | Freshwater Lake | LGILTIVATVSNVGIQILKGGTPDLVGAFAAVTAGIGLIKAKDAK |
| Ga0181348_12800671 | 3300017784 | Freshwater Lake | MKTTLLGILTIVATVANVAIQLLTGDHPDLAAAFAAVVAGAGLIKAADA |
| Ga0181355_11772083 | 3300017785 | Freshwater Lake | MQTTILGILTIVATVANVAIQLLTGDNPDLAASFAAIVAGAG |
| Ga0181359_10036176 | 3300019784 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGVGLIKAGDSK |
| Ga0181359_10119392 | 3300019784 | Freshwater Lake | MKTTALGIITIIATLSNVALQLLSGGQPDFAAAFAAVVAGAGLIQASDAK |
| Ga0181359_10131584 | 3300019784 | Freshwater Lake | MKTTVLGILTIVATISNVAIQFISGEAPDFAAAFAAVVAGVGLIKAADAK |
| Ga0181359_10185624 | 3300019784 | Freshwater Lake | MKTTALGIITIIATLSNVALQILSGGSPDLAAAFAAIVAGAGLIQASDAK |
| Ga0181359_10404224 | 3300019784 | Freshwater Lake | MKTTALGIVTIIATLSNVTLQILSGGSPDLAAAFAAVVAGAGLIQASDAK |
| Ga0181359_10441614 | 3300019784 | Freshwater Lake | MKTTALGIITIIATLSNVALQLLSGGSPDFAAAFAAVVAGAGLIQASDAK |
| Ga0181359_11356672 | 3300019784 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLLNGSSPDFIGAFAAVTAGVGLIKAGDDK |
| Ga0181359_11528962 | 3300019784 | Freshwater Lake | MKTTLLGILTIVATVANVAVQLLTGDNPDLAAAFAAVVAGAGLIKAADAK |
| Ga0181359_11556773 | 3300019784 | Freshwater Lake | MKTTLLGILTIVATVANVAIQLLTGDNPDLAAAFAAVVAGAGLIKAADAK |
| Ga0181359_11724801 | 3300019784 | Freshwater Lake | MKTTALGIVTIIATLSNVALQLLSGGSPDFAAAFAAVVAGAGLIQASDAK |
| Ga0181359_12087252 | 3300019784 | Freshwater Lake | MKTTALGIVTIIATLSNVALQILSGGSPDLAAAFAAVVAGAGLIQASDAK |
| Ga0207193_100164113 | 3300020048 | Freshwater Lake Sediment | MKTTALGILTIVATLSSVGIQVLKGGAPDLIGAFAAITAGVGLIKARDNK |
| Ga0211736_109588363 | 3300020151 | Freshwater | MKTTALGILTIVATLANVGVQILKGGAPDFMGAFAAVTAGVGLIKA |
| Ga0211734_101230054 | 3300020159 | Freshwater | MKTTALGILTIVATLANVGVQILKGGAPDFMGAFAAVTAGVGLIKARDNK |
| Ga0211733_104964861 | 3300020160 | Freshwater | TALGILTIVATLANVGVQVLKGGAPDFMAAFAAVTAGVGLIKARDNK |
| Ga0211733_108787121 | 3300020160 | Freshwater | VKTTALGILTIVATLANVGVQVLKGGAPDFMAAFAAVTAGVGLIK |
| Ga0211726_102561012 | 3300020161 | Freshwater | MKTTALGILTIVATLSSVGIQLLKGGSPDLVGAFAAVTAGVGLIKARDNK |
| Ga0211735_100659511 | 3300020162 | Freshwater | MKTTALGILTIVATLANVGVQVLKGGAPDFMAAFAA |
| Ga0208052_1084353 | 3300020490 | Freshwater | TLANVGVQVLKGGAPDFMAAFAAVTAGVGLIKARDNK |
| Ga0208231_10582473 | 3300020557 | Freshwater | TTALGILTIVATLANVGVQVLQGGAPDFMGAFAAVTAGIGLIKAKDNK |
| Ga0208597_10015018 | 3300020562 | Freshwater | MKTTVLGILTIVATISNLAIQFISGEAPDFAAAFAAVVAGVGLIKAADAK |
| Ga0208485_10175712 | 3300020573 | Freshwater | MLKTTVLGILTIVATVSNVGIQILKGGAPDFVGAFAAVTA |
| Ga0210298_11562592 | 3300021328 | Estuarine | MKTTALGILTIVATLSNVGIQLLNGGAPDFIGAFAAVTAGVGLIKARDNK |
| Ga0181353_10187573 | 3300022179 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLLNGSAPDFIGAFAAVTAGVGLIKAGDDK |
| Ga0181353_10967103 | 3300022179 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGVGLIKAGDSKF |
| Ga0181354_10854781 | 3300022190 | Freshwater Lake | MKTTALGIITIIATLSNVALQILSGGSPDLAAAFAAIVAGAGLIQASDAKF |
| Ga0181354_11350061 | 3300022190 | Freshwater Lake | TILGILTIVATVANVAIQLLTGDNPDLAAAFAAVVAGAGLIKAADAK |
| Ga0181351_11897571 | 3300022407 | Freshwater Lake | MKTTALGIVTIIATLSNVALQLLSGGSPDFTAAFAAVVAGAGLIQASDAK |
| Ga0181351_12121041 | 3300022407 | Freshwater Lake | IIATLSNVALQLLSGGSPDFAAAFAAVVAGAGLIQASDAK |
| Ga0244777_1000032532 | 3300024343 | Estuarine | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGFGLIKARDNK |
| Ga0244777_101037222 | 3300024343 | Estuarine | MKTTALGILTIVATLSNVGIQLLNGSAPDFIGAFAAVTAGVGLIKAGDSK |
| Ga0244777_101898881 | 3300024343 | Estuarine | MKTTVLGILTIVATLANVGVQVLKGGAPDFMAAFAAVTAGVGLIKARDNK |
| Ga0244777_102210362 | 3300024343 | Estuarine | MKTTALGVLTIVATLANVGIQLLNGAAPDFIGAFAAVTAGVGLIKARDNK |
| Ga0244775_100153154 | 3300024346 | Estuarine | MKTTVLGILTIVATLANVGVQVLNGGAPDFMAAFAAVTAGVGLIKARDNK |
| Ga0244776_100440972 | 3300024348 | Estuarine | MKTTALGILTILATLSSVGVQVLKGGAPDLIGAFAAITAGVGLIKARDNK |
| Ga0244776_101482434 | 3300024348 | Estuarine | MKTTALGILTIVATLSSVGIQVLKGGAPDLIGAFAAITAGVG |
| Ga0244776_103578701 | 3300024348 | Estuarine | MKTTALGILTIVATLSSVGIQVLKGGAPDLIGAFAAI |
| Ga0244776_105293084 | 3300024348 | Estuarine | IHIMKTTALGILTIVATLSNVGIQLLNGGAPDFIGAFAAVTAGVGLIKAGDDK |
| Ga0255150_10456761 | 3300024505 | Freshwater | TALGILTIVATVSNVGIQILKGSPPDFAAAFAAVTAGIGLIKAADAKK |
| Ga0255187_10224043 | 3300024510 | Freshwater | NVGVQVLKGGAPDLVGAFAAITAGFGLIKARDAGR |
| Ga0208160_11337611 | 3300025647 | Aqueous | MKTTALGILTIVATLSNVGIQLLNGSAPDFIGAFAAVTAGVGLIKAGDQ |
| Ga0208644_11862382 | 3300025889 | Aqueous | MKTTALGILTIVATISNVGIQILKGGAPDLVGAFAAITAGFGLIKARDASK |
| Ga0208916_100031523 | 3300025896 | Aqueous | MKTTALGILTIVATLSNVGIQLLNGGAPDLVGAFAAVTAGVGLIKAGDSK |
| Ga0208023_10341942 | 3300027206 | Estuarine | HNKYMKTTALGILTILATLSSVGVQVLKGGAPDLIGAFAAITAGVGLIKARDNK |
| Ga0208812_10769353 | 3300027311 | Estuarine | NKYTMKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGFGLIKARDNK |
| Ga0209651_10365801 | 3300027581 | Freshwater Lake | MKTTALGILTIIATLSNVALQLLSGGQPDFAAAFAAVVAGAGLIQASDAK |
| Ga0209357_10224611 | 3300027656 | Freshwater Lake | NITMKTTALGILTIIATLSNVALQLLSGGQPDFAAAFAAVVAGAGLIQASDAK |
| Ga0208975_10365123 | 3300027659 | Freshwater Lentic | MKTTALGILTIVATLSNVGIQLLNGGSPDFIGAFAAITAGVG |
| Ga0208975_11975031 | 3300027659 | Freshwater Lentic | MKTTALGILTIVATLANVGVQVLKGGAPDFMGAFAALTAGFGLIKARDNK |
| Ga0209392_12432363 | 3300027683 | Freshwater Sediment | LTIVATLANVGVQVLNGGAPDFMGAIAALTAGFGLVKAQDQRR |
| Ga0209704_11100152 | 3300027693 | Freshwater Sediment | ATLSGVGIQILKGGAPDFVGAFAAVTAGIGLIKARDAK |
| Ga0209704_12411593 | 3300027693 | Freshwater Sediment | LGILTIVATLANVGVQVLKGGAPDFMAAFAAVTAGIGLIKARDNK |
| Ga0209492_10174653 | 3300027721 | Freshwater Sediment | MKTTALGILTIVATLSNVGIQLLNGVSPDFIGAFAAVTAGVGLIKAGDSK |
| Ga0209492_10421761 | 3300027721 | Freshwater Sediment | MKTTALGILTIVATLANVGVQVLKGGNPDFMGAIAALTAGFGLVKAQDHRR |
| Ga0209492_10537244 | 3300027721 | Freshwater Sediment | ILTIVATLANVGVQVLKGGNPDFMGAIAALTAGFGLVKAQDQRR |
| Ga0208305_101855601 | 3300027753 | Estuarine | ILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGFGLIKARDNK |
| Ga0208305_103155561 | 3300027753 | Estuarine | LGVLTIVATLANVGIQLLNGAAPDFIGAFAAVTAGVGLIKARDNK |
| Ga0209134_100037442 | 3300027764 | Freshwater Lake | MKTTALGILTIVATLSNVGIQVLKGGSPDLIGAFAAITAGVGLIKAHDRK |
| Ga0209134_100174771 | 3300027764 | Freshwater Lake | INNNTYMKTTALGILTIVATLSSIGIQVLKGGSPDLIGAFAAITAGVGLIKARDNK |
| Ga0209246_100561703 | 3300027785 | Freshwater Lake | MKTTALGILTIVATLSSVGIQVLKGGSPDLIGAFAAITAGVGLIKARDNK |
| Ga0209353_100028834 | 3300027798 | Freshwater Lake | MKTTALGILTIVATLSNVGIQLLNGGSPDFVGAFAAVTAGVGLIKAGDSK |
| Ga0209353_101653951 | 3300027798 | Freshwater Lake | ILTIVATLSSVGIQVLKGGSPDLIGAFAAITAGVGLIKARDNK |
| Ga0209354_101232393 | 3300027808 | Freshwater Lake | MKTTALGIITIIATLSNVALQLLSGGSPDFAAAFAAVVA |
| Ga0247723_100060711 | 3300028025 | Deep Subsurface Sediment | MKTTILGIMIIVSTLSNVAIQLLKGASPDFHVAGAAVLAGIGLIKAADAK |
| Ga0247723_10110964 | 3300028025 | Deep Subsurface Sediment | MKTTVLGILTIVATISNVAIQFISGESPDFAAAFAAVIAGVGLIKAADAK |
| Ga0255193_10480103 | 3300028269 | Freshwater | MKTTALGILTIVATLANVGVQVLKGGAPDLVGAFAAITAGFGLIKARDAGR |
| (restricted) Ga0247831_10244201 | 3300028559 | Freshwater | TALGILTIIATISNVAIQILSGGSPDFAAAFAAIVAGAGLIQASDAK |
| Ga0315907_1000209930 | 3300031758 | Freshwater | MKTTVLGILTIVTTVSNVGIQVIKGTPPDFAAAFAAVAAGVGLIKAADAKKK |
| Ga0315909_101307583 | 3300031857 | Freshwater | MKTTALGILTIVATLSNVGIQLINGSAPDFVGAFAAVTAGFGLIKARDAGK |
| Ga0315909_102550541 | 3300031857 | Freshwater | SNVAVQVLKGGAPDFAAAFAAVTAGIGLIKAKDAK |
| Ga0315909_105493923 | 3300031857 | Freshwater | LGILTIVATLANVGVQVLKGGAPDFMGAFAAVTAGIGLIKARDAGR |
| Ga0315297_108291242 | 3300031873 | Sediment | MKTTALGILTIVATLANVGAQVLKGGAPDFMGAFAAVTAGI |
| Ga0315274_103903673 | 3300031999 | Sediment | MKTTALGILTIVATLANVGVQVLQGGAPDFMGAFA |
| Ga0315906_108275232 | 3300032050 | Freshwater | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAITAGFGLIKARDAGR |
| Ga0315905_116230153 | 3300032092 | Freshwater | LTIVATVSNVAIQVISGEAPDFAAAFAAVVAGIGLVKAADAK |
| Ga0315902_101651343 | 3300032093 | Freshwater | MKTTALGILTVVATVSNVGIQILKGGTPDIVGAFAAITAGVGLIKAKDDK |
| Ga0315275_120076171 | 3300032401 | Sediment | ALGILTIVATLANVGAQVLKGGAPDFMGAFAAVTAGIGLIKARDNK |
| Ga0316616_1036254392 | 3300033521 | Soil | MKTTALGILTIVATLSNVGVQLLNGGAPDFVGAFAAITAGFGLIKARDAGR |
| Ga0334994_0228875_856_987 | 3300033993 | Freshwater | MKTTVLGILTIVATISNLAIQFISGEAPDFAAAFAAVVAGVGLI |
| Ga0334996_0135008_1114_1269 | 3300033994 | Freshwater | MKTTALGILTIVATLANVGVQVLKGGNPDFMGAIAALTAGFGLVKAQDQRR |
| Ga0334996_0215537_867_1013 | 3300033994 | Freshwater | MKTTVLGILTILATVSNLAIQFISGEAPDFTAAFAAVVAGVGLIKAADA |
| Ga0335003_0024582_139_291 | 3300033995 | Freshwater | MKTTALGILTIVATLSNVGIQLLNGSAPDFIGAFAAVTAGVGLIKARDDK |
| Ga0334986_0055841_126_278 | 3300034012 | Freshwater | MKTTALGILTIVATLSNVGIQLLNGSAPDFVGAFAAVTAGVGLIKAGDDK |
| Ga0334991_0030624_231_383 | 3300034013 | Freshwater | MKTTALGILTIVATLSNVGIQLINGSAPDFVGAFAAVTAGFGLIKARDDK |
| Ga0334991_0193415_532_684 | 3300034013 | Freshwater | MKTTALGILTIVATLSNVGIQLLNGSTPDFIGAFAAVTAGVGLIKAGDDK |
| Ga0334991_0196796_440_622 | 3300034013 | Freshwater | MVGMIQPNKIMKTTVLGILTIVATASNVAIQIISGESPDFAAAFAAVIAGVGLIKAADAK |
| Ga0334987_0221312_92_244 | 3300034061 | Freshwater | MKTTTLGILTIVATLSNVGIQLINGSAPDFVGAFAAVTAGFGLIKARDDK |
| Ga0335001_0074622_1169_1321 | 3300034064 | Freshwater | MKTTALGILTIVATLSNVGIQLLNGVSPDFIGAFAAVTAGVGLIKAGDDK |
| Ga0335001_0247494_857_982 | 3300034064 | Freshwater | MKTTILGILIIVSTVSNACVQLLKGGSPDLIGAFTTITAGIG |
| Ga0335001_0276239_257_412 | 3300034064 | Freshwater | MKTTALGILTIVATLSNVGIQLLNGGAPDFVGAFAAVTAGFGLIKARDSGR |
| Ga0335020_0000721_19567_19749 | 3300034082 | Freshwater | MVGMIQLNKIMKTTVLGILTIVATASNVAIQIISGESPDFAAAFAAVIAGVGLIKAADAK |
| Ga0335027_0165296_1496_1606 | 3300034101 | Freshwater | MKTTALGILTIVATLANVGVQVLQGGAPDFMGAFAAV |
| Ga0335027_0174220_14_169 | 3300034101 | Freshwater | MKTTALGILTIVATLANVGVQVLKGGNPDFMGAIAALTAGFGLIKAQDSRR |
| Ga0335035_0372418_2_124 | 3300034105 | Freshwater | IVATLANVGVQVLKGGAPDFMGAFAAVTAGIGLIKARDNK |
| Ga0335036_0459549_2_106 | 3300034106 | Freshwater | MKTTALGILTIVATLANVGVQVLKGGAPDFMGAFA |
| Ga0335060_0323787_1_141 | 3300034122 | Freshwater | MKTTALGILTIVATLSNVGIQLINGSAPDFVGAFAAVTAGFGLIKAR |
| Ga0335060_0532802_1_138 | 3300034122 | Freshwater | LGILTIVATLANVGVQVLKGGAPDFMGAFAAVTAGIGLIKAKDNK |
| Ga0335049_0509303_2_112 | 3300034272 | Freshwater | MKTTALGILTIVATLANVGVQVLKGGAPDFMGAFAAV |
| ⦗Top⦘ |