Metagenome Family F017777

Basic Information
Family ID	F017777
Family Type	Metagenome
Number of Sequences	238
Average Sequence Length	42 residues
Representative Sequence	PVFWELGDFECFSGKLWEGGFIKISNESQQPMQAIGSESLF
Number of Associated Samples	74
Number of Associated Scaffolds	238

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	4.66 %
% of genes near scaffold ends (potentially truncated)	87.39 %
% of genes from short scaffolds (< 2000 bps)	99.16 %
Associated GOLD sequencing projects	73
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.33

Most Common Taxonomy
Group	Unclassified (78.571 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (94.538 % of family members)
Environment Ontology (ENVO)	Unclassified (94.958 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (94.958 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 11.59% β-sheet: 15.94% Coil/Unstructured: 72.46%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 238 Family Scaffolds
PF13650	Asp_protease_2	2.94
PF00078	RVT_1	0.84
PF10536	PMD	0.42

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
All Organisms	root	All Organisms	21.43 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
cellular organisms	root	All Organisms → cellular organisms	21.43 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	20.59 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	20.59 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	20.59 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	19.75 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.42 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	19.75 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	0.42 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	16.81 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	0.42 %
Escherichia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	16.81 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	16.81 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	16.81 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	16.81 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	9.24 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	7.56 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	9.24 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	7.56 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	9.24 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	7.56 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	9.24 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	7.56 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	9.24 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	7.56 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	7.56 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	5.04 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	4.20 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	7.56 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	5.04 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	2.52 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1.68 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Malvoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae	7.56 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	5.04 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	2.52 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	1.26 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.42 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Gossypium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium	7.56 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	5.04 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	2.52 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1.26 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.42 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	7.56 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	5.04 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	2.52 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	1.26 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	0.42 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	7.56 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	5.04 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	2.52 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1.26 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	0.42 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	7.56 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	5.04 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	2.52 %
Panicum sect. Panicum	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum	0.42 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.42 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.42 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.57 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	7.56 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	5.04 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	2.52 %
Panicum hallii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	0.42 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.42 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.42 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.42 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.42 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005328\|Ga0070676_11066577	Not Available	609	Open in IMG/M
3300005334\|Ga0068869_101980352	Not Available	523	Open in IMG/M
3300005718\|Ga0068866_11064824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	578	Open in IMG/M
3300009148\|Ga0105243_12484748	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	557	Open in IMG/M
3300013296\|Ga0157374_11681040	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	659	Open in IMG/M
3300013296\|Ga0157374_12836287	Not Available	512	Open in IMG/M
3300013296\|Ga0157374_12970078	Not Available	501	Open in IMG/M
3300013297\|Ga0157378_10852973	Not Available	939	Open in IMG/M
3300013297\|Ga0157378_13015089	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	522	Open in IMG/M
3300014745\|Ga0157377_10854708	Not Available	676	Open in IMG/M
3300014745\|Ga0157377_11471813	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	540	Open in IMG/M
3300015268\|Ga0182154_1024275	Not Available	683	Open in IMG/M
3300015268\|Ga0182154_1035464	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	618	Open in IMG/M
3300015268\|Ga0182154_1069527	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	511	Open in IMG/M
3300015269\|Ga0182113_1046685	Not Available	629	Open in IMG/M
3300015274\|Ga0182188_1003588	Not Available	1059	Open in IMG/M
3300015274\|Ga0182188_1035915	Not Available	582	Open in IMG/M
3300015274\|Ga0182188_1037661	Not Available	575	Open in IMG/M
3300015274\|Ga0182188_1039985	Not Available	567	Open in IMG/M
3300015274\|Ga0182188_1046620	Not Available	544	Open in IMG/M
3300015275\|Ga0182172_1016661	Not Available	768	Open in IMG/M
3300015275\|Ga0182172_1021951	Not Available	714	Open in IMG/M
3300015275\|Ga0182172_1066456	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	525	Open in IMG/M
3300015277\|Ga0182128_1013171	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	828	Open in IMG/M
3300015277\|Ga0182128_1042747	Not Available	602	Open in IMG/M
3300015277\|Ga0182128_1075690	Not Available	510	Open in IMG/M
3300015277\|Ga0182128_1080481	Not Available	501	Open in IMG/M
3300015279\|Ga0182174_1055898	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	573	Open in IMG/M
3300015281\|Ga0182160_1029897	Not Available	674	Open in IMG/M
3300015281\|Ga0182160_1051015	Not Available	583	Open in IMG/M
3300015281\|Ga0182160_1054802	Not Available	571	Open in IMG/M
3300015282\|Ga0182124_1021811	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	729	Open in IMG/M
3300015282\|Ga0182124_1035777	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	639	Open in IMG/M
3300015282\|Ga0182124_1058807	Not Available	556	Open in IMG/M
3300015283\|Ga0182156_1075676	Not Available	526	Open in IMG/M
3300015286\|Ga0182176_1065707	Not Available	548	Open in IMG/M
3300015286\|Ga0182176_1079478	Not Available	515	Open in IMG/M
3300015287\|Ga0182171_1029835	Not Available	688	Open in IMG/M
3300015287\|Ga0182171_1041037	Not Available	630	Open in IMG/M
3300015288\|Ga0182173_1076023	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	523	Open in IMG/M
3300015289\|Ga0182138_1016148	Not Available	814	Open in IMG/M
3300015289\|Ga0182138_1026313	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	714	Open in IMG/M
3300015291\|Ga0182125_1054036	Not Available	595	Open in IMG/M
3300015291\|Ga0182125_1055849	Not Available	590	Open in IMG/M
3300015294\|Ga0182126_1067740	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	559	Open in IMG/M
3300015295\|Ga0182175_1063564	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	575	Open in IMG/M
3300015295\|Ga0182175_1067153	Not Available	566	Open in IMG/M
3300015295\|Ga0182175_1074659	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	548	Open in IMG/M
3300015295\|Ga0182175_1078190	Not Available	540	Open in IMG/M
3300015295\|Ga0182175_1082430	Not Available	532	Open in IMG/M
3300015296\|Ga0182157_1035983	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	688	Open in IMG/M
3300015298\|Ga0182106_1023506	Not Available	778	Open in IMG/M
3300015298\|Ga0182106_1039683	Not Available	670	Open in IMG/M
3300015298\|Ga0182106_1063185	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	585	Open in IMG/M
3300015299\|Ga0182107_1034044	Not Available	704	Open in IMG/M
3300015299\|Ga0182107_1053138	Not Available	619	Open in IMG/M
3300015299\|Ga0182107_1100352	Not Available	509	Open in IMG/M
3300015299\|Ga0182107_1100770	Not Available	508	Open in IMG/M
3300015299\|Ga0182107_1102119	Not Available	506	Open in IMG/M
3300015300\|Ga0182108_1049307	Not Available	637	Open in IMG/M
3300015300\|Ga0182108_1076493	Not Available	558	Open in IMG/M
3300015300\|Ga0182108_1098044	Not Available	516	Open in IMG/M
3300015302\|Ga0182143_1023217	Not Available	780	Open in IMG/M
3300015302\|Ga0182143_1043134	Not Available	656	Open in IMG/M
3300015302\|Ga0182143_1046649	Not Available	642	Open in IMG/M
3300015302\|Ga0182143_1070910	Not Available	567	Open in IMG/M
3300015302\|Ga0182143_1078503	Not Available	550	Open in IMG/M
3300015302\|Ga0182143_1100682	Not Available	508	Open in IMG/M
3300015303\|Ga0182123_1016690	Not Available	827	Open in IMG/M
3300015303\|Ga0182123_1039558	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	655	Open in IMG/M
3300015304\|Ga0182112_1021592	Not Available	800	Open in IMG/M
3300015304\|Ga0182112_1068011	Not Available	576	Open in IMG/M
3300015305\|Ga0182158_1048352	Not Available	634	Open in IMG/M
3300015305\|Ga0182158_1056167	Not Available	607	Open in IMG/M
3300015307\|Ga0182144_1055005	Not Available	619	Open in IMG/M
3300015307\|Ga0182144_1092039	Not Available	529	Open in IMG/M
3300015307\|Ga0182144_1099958	Not Available	516	Open in IMG/M
3300015308\|Ga0182142_1016174	Not Available	896	Open in IMG/M
3300015308\|Ga0182142_1114988	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	503	Open in IMG/M
3300015313\|Ga0182164_1134423	Not Available	507	Open in IMG/M
3300015314\|Ga0182140_1037368	Not Available	708	Open in IMG/M
3300015314\|Ga0182140_1039740	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	696	Open in IMG/M
3300015314\|Ga0182140_1066811	Not Available	597	Open in IMG/M
3300015314\|Ga0182140_1075978	Not Available	574	Open in IMG/M
3300015321\|Ga0182127_1025079	Not Available	819	Open in IMG/M
3300015321\|Ga0182127_1063562	Not Available	623	Open in IMG/M
3300015321\|Ga0182127_1088415	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	562	Open in IMG/M
3300015321\|Ga0182127_1106172	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	529	Open in IMG/M
3300015321\|Ga0182127_1124776	Not Available	502	Open in IMG/M
3300015322\|Ga0182110_1103426	Not Available	533	Open in IMG/M
3300015322\|Ga0182110_1126104	Not Available	500	Open in IMG/M
3300015323\|Ga0182129_1033977	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	725	Open in IMG/M
3300015323\|Ga0182129_1061287	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	611	Open in IMG/M
3300015323\|Ga0182129_1069989	Not Available	587	Open in IMG/M
3300015323\|Ga0182129_1091365	Not Available	541	Open in IMG/M
3300015323\|Ga0182129_1108664	Not Available	513	Open in IMG/M
3300015323\|Ga0182129_1115289	Not Available	503	Open in IMG/M
3300015341\|Ga0182187_1115689	Not Available	614	Open in IMG/M
3300015341\|Ga0182187_1117175	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	611	Open in IMG/M
3300015341\|Ga0182187_1145355	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	566	Open in IMG/M
3300015341\|Ga0182187_1193795	Not Available	508	Open in IMG/M
3300015342\|Ga0182109_1092839	Not Available	698	Open in IMG/M
3300015342\|Ga0182109_1150620	Not Available	585	Open in IMG/M
3300015342\|Ga0182109_1195957	Not Available	528	Open in IMG/M
3300015342\|Ga0182109_1203265	Not Available	521	Open in IMG/M
3300015342\|Ga0182109_1204082	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	520	Open in IMG/M
3300015342\|Ga0182109_1212870	Not Available	511	Open in IMG/M
3300015342\|Ga0182109_1223178	Not Available	502	Open in IMG/M
3300015343\|Ga0182155_1173867	Not Available	554	Open in IMG/M
3300015343\|Ga0182155_1217402	Not Available	509	Open in IMG/M
3300015343\|Ga0182155_1224331	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	502	Open in IMG/M
3300015343\|Ga0182155_1226388	Not Available	501	Open in IMG/M
3300015344\|Ga0182189_1036299	Not Available	973	Open in IMG/M
3300015344\|Ga0182189_1094025	Not Available	700	Open in IMG/M
3300015344\|Ga0182189_1123542	Not Available	635	Open in IMG/M
3300015344\|Ga0182189_1178002	Not Available	554	Open in IMG/M
3300015345\|Ga0182111_1142190	Not Available	621	Open in IMG/M
3300015345\|Ga0182111_1149115	Not Available	610	Open in IMG/M
3300015345\|Ga0182111_1154535	Not Available	602	Open in IMG/M
3300015345\|Ga0182111_1170347	Not Available	579	Open in IMG/M
3300015345\|Ga0182111_1187035	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	559	Open in IMG/M
3300015345\|Ga0182111_1222635	Not Available	522	Open in IMG/M
3300015345\|Ga0182111_1230840	Not Available	514	Open in IMG/M
3300015346\|Ga0182139_1108017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	689	Open in IMG/M
3300015346\|Ga0182139_1165062	Not Available	587	Open in IMG/M
3300015346\|Ga0182139_1168244	Not Available	583	Open in IMG/M
3300015346\|Ga0182139_1195875	Not Available	549	Open in IMG/M
3300015346\|Ga0182139_1216242	Not Available	528	Open in IMG/M
3300015347\|Ga0182177_1108451	Not Available	690	Open in IMG/M
3300015347\|Ga0182177_1119602	Not Available	666	Open in IMG/M
3300015347\|Ga0182177_1177162	Not Available	574	Open in IMG/M
3300015347\|Ga0182177_1224460	Not Available	523	Open in IMG/M
3300015347\|Ga0182177_1246433	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	504	Open in IMG/M
3300015347\|Ga0182177_1246689	Not Available	504	Open in IMG/M
3300015351\|Ga0182161_1053838	Not Available	934	Open in IMG/M
3300015351\|Ga0182161_1086781	Not Available	782	Open in IMG/M
3300015351\|Ga0182161_1166810	Not Available	608	Open in IMG/M
3300015351\|Ga0182161_1186906	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	581	Open in IMG/M
3300015351\|Ga0182161_1195324	Not Available	571	Open in IMG/M
3300015351\|Ga0182161_1242580	Not Available	523	Open in IMG/M
3300015355\|Ga0182159_1138409	Not Available	751	Open in IMG/M
3300015355\|Ga0182159_1237728	Not Available	597	Open in IMG/M
3300015355\|Ga0182159_1265229	Not Available	568	Open in IMG/M
3300015355\|Ga0182159_1289335	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	547	Open in IMG/M
3300015355\|Ga0182159_1289960	Not Available	547	Open in IMG/M
3300015355\|Ga0182159_1300897	Not Available	538	Open in IMG/M
3300015355\|Ga0182159_1317841	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	525	Open in IMG/M
3300015355\|Ga0182159_1328021	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	518	Open in IMG/M
3300015355\|Ga0182159_1340174	Not Available	509	Open in IMG/M
3300015361\|Ga0182145_1114579	Not Available	601	Open in IMG/M
3300015361\|Ga0182145_1172799	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	523	Open in IMG/M
3300017404\|Ga0182203_1089107	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	614	Open in IMG/M
3300017404\|Ga0182203_1103111	Not Available	586	Open in IMG/M
3300017404\|Ga0182203_1120560	Not Available	557	Open in IMG/M
3300017404\|Ga0182203_1157309	Not Available	509	Open in IMG/M
3300017407\|Ga0182220_1009292	Not Available	974	Open in IMG/M
3300017407\|Ga0182220_1019712	Not Available	801	Open in IMG/M
3300017407\|Ga0182220_1066701	Not Available	578	Open in IMG/M
3300017407\|Ga0182220_1079297	Not Available	550	Open in IMG/M
3300017407\|Ga0182220_1099946	Not Available	514	Open in IMG/M
3300017407\|Ga0182220_1103645	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	509	Open in IMG/M
3300017409\|Ga0182204_1089385	Not Available	551	Open in IMG/M
3300017409\|Ga0182204_1092898	Not Available	544	Open in IMG/M
3300017409\|Ga0182204_1102724	Not Available	527	Open in IMG/M
3300017410\|Ga0182207_1088559	Not Available	635	Open in IMG/M
3300017410\|Ga0182207_1121860	Not Available	571	Open in IMG/M
3300017411\|Ga0182208_1042828	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	706	Open in IMG/M
3300017411\|Ga0182208_1084547	Not Available	576	Open in IMG/M
3300017411\|Ga0182208_1096209	Not Available	553	Open in IMG/M
3300017413\|Ga0182222_1016643	Not Available	812	Open in IMG/M
3300017413\|Ga0182222_1104149	Not Available	507	Open in IMG/M
3300017413\|Ga0182222_1105429	Not Available	505	Open in IMG/M
3300017415\|Ga0182202_1017559	Not Available	949	Open in IMG/M
3300017415\|Ga0182202_1066098	Not Available	639	Open in IMG/M
3300017415\|Ga0182202_1070495	Not Available	626	Open in IMG/M
3300017415\|Ga0182202_1087960	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	584	Open in IMG/M
3300017417\|Ga0182230_1032398	Not Available	912	Open in IMG/M
3300017420\|Ga0182228_1101971	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	548	Open in IMG/M
3300017420\|Ga0182228_1122811	Not Available	512	Open in IMG/M
3300017424\|Ga0182219_1060957	Not Available	651	Open in IMG/M
3300017424\|Ga0182219_1084014	Not Available	591	Open in IMG/M
3300017424\|Ga0182219_1095918	Not Available	567	Open in IMG/M
3300017424\|Ga0182219_1112083	Not Available	540	Open in IMG/M
3300017425\|Ga0182224_1057461	Not Available	704	Open in IMG/M
3300017425\|Ga0182224_1075309	Not Available	647	Open in IMG/M
3300017427\|Ga0182190_1127141	Not Available	551	Open in IMG/M
3300017427\|Ga0182190_1153920	Not Available	514	Open in IMG/M
3300017430\|Ga0182192_1023967	Not Available	982	Open in IMG/M
3300017430\|Ga0182192_1050160	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	770	Open in IMG/M
3300017430\|Ga0182192_1050827	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	766	Open in IMG/M
3300017430\|Ga0182192_1065839	Not Available	703	Open in IMG/M
3300017430\|Ga0182192_1085866	Not Available	641	Open in IMG/M
3300017430\|Ga0182192_1116299	Not Available	578	Open in IMG/M
3300017430\|Ga0182192_1122186	Not Available	569	Open in IMG/M
3300017430\|Ga0182192_1163569	Not Available	513	Open in IMG/M
3300017433\|Ga0182206_1044530	Not Available	752	Open in IMG/M
3300017433\|Ga0182206_1085711	Not Available	614	Open in IMG/M
3300017433\|Ga0182206_1121368	Not Available	549	Open in IMG/M
3300017433\|Ga0182206_1140439	Not Available	523	Open in IMG/M
3300017436\|Ga0182209_1071163	Not Available	670	Open in IMG/M
3300017436\|Ga0182209_1097557	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	607	Open in IMG/M
3300017436\|Ga0182209_1114495	Not Available	577	Open in IMG/M
3300017436\|Ga0182209_1133351	Not Available	549	Open in IMG/M
3300017436\|Ga0182209_1150328	Not Available	527	Open in IMG/M
3300017436\|Ga0182209_1155710	Not Available	521	Open in IMG/M
3300017438\|Ga0182191_1067568	Not Available	701	Open in IMG/M
3300017438\|Ga0182191_1075142	Not Available	677	Open in IMG/M
3300017438\|Ga0182191_1137195	Not Available	555	Open in IMG/M
3300017438\|Ga0182191_1168519	Not Available	517	Open in IMG/M
3300017442\|Ga0182221_1114366	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	570	Open in IMG/M
3300017442\|Ga0182221_1137770	Not Available	538	Open in IMG/M
3300017443\|Ga0182193_1036926	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	876	Open in IMG/M
3300017443\|Ga0182193_1051171	Not Available	791	Open in IMG/M
3300017443\|Ga0182193_1084911	Not Available	671	Open in IMG/M
3300017443\|Ga0182193_1094147	Not Available	649	Open in IMG/M
3300017443\|Ga0182193_1108829	Not Available	618	Open in IMG/M
3300017443\|Ga0182193_1135987	Not Available	573	Open in IMG/M
3300017443\|Ga0182193_1177453	Not Available	521	Open in IMG/M
3300017443\|Ga0182193_1195474	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	503	Open in IMG/M
3300017682\|Ga0182229_1096243	Not Available	523	Open in IMG/M
3300017683\|Ga0182218_1025228	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	865	Open in IMG/M
3300017683\|Ga0182218_1132366	Not Available	527	Open in IMG/M
3300017683\|Ga0182218_1136545	Not Available	522	Open in IMG/M
3300017683\|Ga0182218_1156058	Not Available	500	Open in IMG/M
3300017684\|Ga0182225_1078837	Not Available	607	Open in IMG/M
3300017684\|Ga0182225_1116113	Not Available	539	Open in IMG/M
3300017684\|Ga0182225_1119596	Not Available	534	Open in IMG/M
3300017684\|Ga0182225_1144068	Not Available	503	Open in IMG/M
3300017685\|Ga0182227_1120454	Not Available	526	Open in IMG/M
3300017685\|Ga0182227_1129175	Not Available	512	Open in IMG/M
3300017686\|Ga0182205_1099743	Not Available	604	Open in IMG/M
3300017686\|Ga0182205_1113594	Not Available	579	Open in IMG/M
3300017689\|Ga0182231_1123782	Not Available	507	Open in IMG/M
3300017690\|Ga0182223_1068629	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	594	Open in IMG/M
3300017690\|Ga0182223_1083219	Not Available	563	Open in IMG/M
3300025899\|Ga0207642_11115472	Not Available	510	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	94.96%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.78%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.26%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	94.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.36%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.26%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.42%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	94.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.26%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.42%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	94.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.26%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.42%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.42%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	0.42%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070676_110665771	3300005328	Miscanthus Rhizosphere	MSIATANPMYWELEDFECFSGKRWEGGFIKINDESHQPIQAVSSKSLF*
Ga0068869_1019803521	3300005334	Miscanthus Rhizosphere	DPVFWELGDFECFSGKSWEGGFIKISNESQQPMQAIGSESLF*
Ga0068866_110648241	3300005718	Miscanthus Rhizosphere	YWELEDFECFSSKLWEGGFIKVNDESQQPIQVVGFENLY*
Ga0105243_124847482	3300009148	Miscanthus Rhizosphere	YWELDDFECFSSKQWEGGFIKINDESQQPIQAVGFESLF*
Ga0157374_116810402	3300013296	Miscanthus Rhizosphere	ELEDFKCFSGKLWEGGINRINDESQQQIQAVSFEILF*
Ga0157374_128362871	3300013296	Miscanthus Rhizosphere	IATADPVFWEQGDFDCLFGKTWEGGFIRINNEGQQPVQAIGSESLF*
Ga0157374_129700781	3300013296	Miscanthus Rhizosphere	DPVFWELADFECFSGKLWEGGFIKISNESQQPMQAIGL*
Ga0157378_108529733	3300013297	Miscanthus Rhizosphere	FWELGDFECFSGKLWEGGFIKISNESQQPMQAIGSKSLF*
Ga0157378_130150892	3300013297	Miscanthus Rhizosphere	DDSMSIATTDLMYWELEDFEYFSGKRWEGGFIRINDEGQQPIRAVGFESLF*
Ga0157377_108547082	3300014745	Miscanthus Rhizosphere	MYWELEDFECFSSKLWEGGFIKINDESQQPIKPIGSESLF*
Ga0157377_114718131	3300014745	Miscanthus Rhizosphere	PIFWELGDFECLSGKTWEGGFIRINNEGQQPVQAIGSKSLF*
Ga0182154_10242752	3300015268	Miscanthus Phyllosphere	WELGDFEGFSSKLWEGGFIRINDESQQPIQAIGFESLF*
Ga0182154_10354642	3300015268	Miscanthus Phyllosphere	TTADPVFWELGDFECFSGKIWEGGFIRINNESQQSIQAVDFENLS*
Ga0182154_10695271	3300015268	Miscanthus Phyllosphere	ATTDPMYCELEDFECFSGKLWEEGFIKINDEIQQPIQAIGSKSLF*
Ga0182113_10466851	3300015269	Miscanthus Phyllosphere	DFECFSSKSWEGGFIKISNESQQPMQVIGSESLF*
Ga0182188_10035883	3300015274	Miscanthus Phyllosphere	DESMSIATADPVFELGDFECFSGKSWEGGFIKINNESQQPMQAIGSESLF
Ga0182188_10359151	3300015274	Miscanthus Phyllosphere	TTDPVLWELGDFECFSGKTWEGGFIKISNESQQPMQTIGSESLF*
Ga0182188_10376611	3300015274	Miscanthus Phyllosphere	ELGDFECFSSKTWEGGFIKISNESQQPMQAIGSESLF*
Ga0182188_10399851	3300015274	Miscanthus Phyllosphere	ATVNPVFWELGDFECFSGKSWEGGFIKISNESQQPMQAIGSESLF*
Ga0182188_10466202	3300015274	Miscanthus Phyllosphere	MYWELEDFECFSGKLWEGGFIKVNNESQQPIQAVSFENLF*
Ga0182172_10166611	3300015275	Miscanthus Phyllosphere	PVFWELGDFECFSGKTWEGGFNKISNESQQLMQAISSESLF*
Ga0182172_10219511	3300015275	Miscanthus Phyllosphere	ADLVFWELGDFECLSGKMWEGGFIRIKNEGQQLVQVIGSESLF*
Ga0182172_10664561	3300015275	Miscanthus Phyllosphere	MSIATTDPVFWEQGDFECFSGKLWEGGFIGINNESQQPIQAVGFENLS*
Ga0182128_10131711	3300015277	Miscanthus Phyllosphere	ELEDFECFSSKQWEGGFIRINDEGQQPIRAVSSESLF*
Ga0182128_10427471	3300015277	Miscanthus Phyllosphere	ATADPVFWELGYFECFSGKTWEGGFIKINNESQQPMQAIGSESLF*
Ga0182128_10756901	3300015277	Miscanthus Phyllosphere	ADLVFWKLGDFECFSGKTREGGFIKISNESQQPMQAIGSESVF*
Ga0182128_10804811	3300015277	Miscanthus Phyllosphere	ATADLVFWELGDFECFSSKLWEGDFIKISNESQQPMQAIGSKSLF*
Ga0182174_10558981	3300015279	Miscanthus Phyllosphere	FWELEDFECFSGKLWDGGFIRINNESQQPIQAVGFENLF*
Ga0182160_10298971	3300015281	Miscanthus Phyllosphere	ELEDFECFSSKLWEGGFIKINDESQQPIHAIGSESLF*
Ga0182160_10510151	3300015281	Miscanthus Phyllosphere	ELEDFECFSSKLWEGGFIKISDESQQLIQAIGSESLF*
Ga0182160_10548021	3300015281	Miscanthus Phyllosphere	PVYWELEDFECFSGKLWEGGFIKVNDESQQPIQAVGFENLF*
Ga0182124_10218113	3300015282	Miscanthus Phyllosphere	DFKCFSSKLWEGGFIKISNESQQPIQAVGFENLS*
Ga0182124_10357771	3300015282	Miscanthus Phyllosphere	IATANPVFWELGDFECFSCKIWEGGFLRIHNESHQPIQVVSFEILS*
Ga0182124_10588071	3300015282	Miscanthus Phyllosphere	DLVFWELGDFECFSGKSWEGGFIKISNESQQPMQAIGSESLF*
Ga0182156_10756762	3300015283	Miscanthus Phyllosphere	DFECFSGKLWEGGFIRINDKSQQPIQAFVFENLS*
Ga0182176_10657071	3300015286	Miscanthus Phyllosphere	ATADLVFWELGDFECFSSKSWEGGFIKIRNESQQPMQAIGSESLF*
Ga0182176_10794781	3300015286	Miscanthus Phyllosphere	WELGDFKCFSGKSWEGGFIKISNESQQPMQAIGSESLF*
Ga0182171_10298351	3300015287	Miscanthus Phyllosphere	VSIATADPIFWELGDFKCFSGKTWEGGFIKISNESQQPMQAIGSESLF*
Ga0182171_10410372	3300015287	Miscanthus Phyllosphere	MILSIATADPMYWELEDFECFSGKQWEGGFIRINDEGQQPIRAVGSESLF*
Ga0182173_10760232	3300015288	Miscanthus Phyllosphere	MSIATADPVFWELEDFECLSGKLWEGCFIRINTESQQPIQVVGFKDLF*
Ga0182138_10161483	3300015289	Miscanthus Phyllosphere	VYWELEDFDCFSGKLWEGGFIKISNEGQQPIQAIGSESLF*
Ga0182138_10263132	3300015289	Miscanthus Phyllosphere	IATADPMYWELGDFECFSGNRWEGGFVRINDEGQQPIRAIGSKSLF*
Ga0182125_10540361	3300015291	Miscanthus Phyllosphere	FWELGDFGCFSSKSWEGGFIKISNESQQPMQAFGSESLF*
Ga0182125_10558491	3300015291	Miscanthus Phyllosphere	ELEDFECFSGKLWDGGFIKISNESQQLVQAISSESLFW*
Ga0182126_10677401	3300015294	Miscanthus Phyllosphere	DLIFWELEDFECFSGKLWEGDFISINNKSQQPIQAVGFKKLF*
Ga0182175_10635641	3300015295	Miscanthus Phyllosphere	DPVFWELGDFKCFSGKLWEGGFIRINDESQQLIQVVSFENLS*
Ga0182175_10671532	3300015295	Miscanthus Phyllosphere	ELEDFECFSGKLWEGGFIKVSDESQQLIQAIGSESVF*
Ga0182175_10746592	3300015295	Miscanthus Phyllosphere	YWELEDFECFSGKLWGGGFIKINDESQKPIQAIGSKTLF*
Ga0182175_10781901	3300015295	Miscanthus Phyllosphere	LEDFKYFSGKLWEGGFIKINDESQQPIQAIGYESLF*
Ga0182175_10824302	3300015295	Miscanthus Phyllosphere	LEDFKCFSGKLWEGGFIKISDESQQPIQAIGSESLF*
Ga0182157_10359833	3300015296	Miscanthus Phyllosphere	ELEDFECFSGKLWEGGFIKVNDESQQLIQAVGFENLF*
Ga0182157_10857211	3300015296	Miscanthus Phyllosphere	LGDFECLSSKTWEGGFVRINNEGQWLVQAISFESLF*
Ga0182106_10235061	3300015298	Miscanthus Phyllosphere	AIADPVYWELEDFECFFGKLWEGGFIKISDESQQSIQAIGSESLF*
Ga0182106_10396831	3300015298	Miscanthus Phyllosphere	MSIAIANPVYWELEDFECFSGKLWEGGFIKISDESQQLIQAVGVKILF*
Ga0182106_10631851	3300015298	Miscanthus Phyllosphere	EDFECFSGKLWEGGFIKINDEGQQPIQAVGSESLF*
Ga0182107_10340441	3300015299	Miscanthus Phyllosphere	MSIATVDLVFWELGDFECFSGKLWEGGFIKISNESQQPMQAIGS*
Ga0182107_10531381	3300015299	Miscanthus Phyllosphere	DPMYWELEDFKCFSSKLWEGGFIKINDENQQLIQAIGSESLF*
Ga0182107_11003521	3300015299	Miscanthus Phyllosphere	LVFWELGDFECFSGKSWEGGFIKISNESQQLMQAIDSGSLF*
Ga0182107_11007701	3300015299	Miscanthus Phyllosphere	VSIATADPVYWELEDFECFSGKLWEGGFIKINNESQQLMQAIDSESLF*
Ga0182107_11021191	3300015299	Miscanthus Phyllosphere	VFWELGDFECFSGKSWEGGFIKISNESQQLMQAIGSESLF*
Ga0182108_10493071	3300015300	Miscanthus Phyllosphere	ELGDFECFSGKSWEGGFIKISNESQQPVQVISSESLL*
Ga0182108_10764932	3300015300	Miscanthus Phyllosphere	VSIATADPVFWELGDFEYFSGKSWEGGFIKISNESQQPMQAIGSESLF*
Ga0182108_10980441	3300015300	Miscanthus Phyllosphere	VTTADPVFWELAYFECFSGKLWKGGFIKINNESQQPMQAIGSESLF*
Ga0182143_10232173	3300015302	Miscanthus Phyllosphere	ELEDFECFSSKLWEGGFIKISNESQQPIQAIGFKSLF*
Ga0182143_10431341	3300015302	Miscanthus Phyllosphere	IAIADLVFWEIADFECFSSKLWEGGFIRISNESQQPMQAIGSESLF*
Ga0182143_10466491	3300015302	Miscanthus Phyllosphere	NFECFSGKLWEGGFIKISDESKQPIQAIGSESLF*
Ga0182143_10709101	3300015302	Miscanthus Phyllosphere	ELGDFECFSGKSWEGGFIKISNESQQPMQAIGSKSLF*
Ga0182143_10785031	3300015302	Miscanthus Phyllosphere	GDFECLSGKTWEGGFIRINNEGQQPVQAIGSESLF*
Ga0182143_11006821	3300015302	Miscanthus Phyllosphere	DPVFWELGDFECFSSKTWEGGFIKISNESQQLMQAIGSESLF*
Ga0182123_10166901	3300015303	Miscanthus Phyllosphere	ADPVYWELEDFECFSSKLWEGGFIKISDESQQPIQAIGSKSLF*
Ga0182123_10395581	3300015303	Miscanthus Phyllosphere	TTANLVYWELEDFECFSVKLWKGCFIKISNESQQPIQTIGFESLF*
Ga0182112_10215922	3300015304	Miscanthus Phyllosphere	WELDDFECFLGVLWEGGFIKISNQGQQPIQAIGSESSF*
Ga0182112_10680111	3300015304	Miscanthus Phyllosphere	LGDFECFSGKSWEGGFIKISNESQQPMQAIGSESLF*
Ga0182158_10483521	3300015305	Miscanthus Phyllosphere	LVFWELGDFECFSGKSWEGGFIKISNESQQPMQVIGSKSLF*
Ga0182158_10561671	3300015305	Miscanthus Phyllosphere	DFECFTSKLWEGGFIKISNESQQPMQAIGSKSLF*
Ga0182144_10550051	3300015307	Miscanthus Phyllosphere	GDFECFFGKLWEESFIKISNEGQQPIQAISSKSLF*
Ga0182144_10920392	3300015307	Miscanthus Phyllosphere	VSIATADPVFWELGDFECFSGKIWEGGFIRVNNESQQPIQVVGFENLY*
Ga0182144_10999582	3300015307	Miscanthus Phyllosphere	ATTNPMYWELEDFECFFGKQWEGGFIKINDESQQPIQAVDSESLF*
Ga0182142_10161741	3300015308	Miscanthus Phyllosphere	ADLVFWELGDFECFSSKLWEGGFIKISNESQQPMQAIGSESLF*
Ga0182142_11149881	3300015308	Miscanthus Phyllosphere	IADPVYWELEDFECFSGKLWKGCFIKISSESQQPIQAISSESLF*
Ga0182164_11344231	3300015313	Switchgrass Phyllosphere	TADPVFWELGDFKCFFGKSWEGGFIKISNESQQPMQAISSESLF*
Ga0182140_10373683	3300015314	Miscanthus Phyllosphere	VSIAIVDPMYWKLEDFKCFSGKQWEGGFIKISNESQQLIQAVGFENLF*
Ga0182140_10397402	3300015314	Miscanthus Phyllosphere	MYWELEDFESFSGKLWEGGFIKINDESQQPIQAVGSKSLF*
Ga0182140_10668111	3300015314	Miscanthus Phyllosphere	ELGDFEYFFGKLWEGGFIKISNESQQLMQAIGSESLF*
Ga0182140_10759782	3300015314	Miscanthus Phyllosphere	VTADPVFWELGDFECFSGKSWEGGFIKISNESQQPMQAISSKSLF*
Ga0182127_10250791	3300015321	Miscanthus Phyllosphere	LGDFECLSGKTWERGIIRINNEGQQPIQAIGSKSLF*
Ga0182127_10635622	3300015321	Miscanthus Phyllosphere	DSVSIATTNPMYWELEDFECFSGKQWEGRFIKINDEGQQPIRAVGSESLF*
Ga0182127_10884151	3300015321	Miscanthus Phyllosphere	WELEDLECFSGKLWEGGFIKINDESQQPIQAVGSESMF*
Ga0182127_11061721	3300015321	Miscanthus Phyllosphere	AIADPMYWELEDFECFSGKLWEGGFIKINDESQQPIQAVGSESLF*
Ga0182127_11247761	3300015321	Miscanthus Phyllosphere	MYWELEDFECFSSKLWEGGFIKINDESQQPIQVVGSES
Ga0182110_11034261	3300015322	Miscanthus Phyllosphere	SIATADPVFWELGDFECFSGKSWKGGFIKISNESQQPMQAISSESLF*
Ga0182110_11261041	3300015322	Miscanthus Phyllosphere	AAADPVFWELGDFECFSGKLWEGGFIKISNESQQPKQAIGSKSLF*
Ga0182129_10339773	3300015323	Miscanthus Phyllosphere	ADPMYWELEDFECFSGKLWEGGFIKINDESQQPI*
Ga0182129_10612871	3300015323	Miscanthus Phyllosphere	DSVSVATADPMYWELEDFEWFSGKQWESAFIRINDEGQQPIQAVGSESLF*
Ga0182129_10699891	3300015323	Miscanthus Phyllosphere	GDFECFSSKLWEGGFIKISNESQQPMQAIGSESLF*
Ga0182129_10913651	3300015323	Miscanthus Phyllosphere	WELGDFECFSGKSWEGGFIKIGNESQRPMQAIGSESLF*
Ga0182129_11086641	3300015323	Miscanthus Phyllosphere	ANLVFWELGDFECFSGKLWEGGFIKINNESQHPMQAISSESLF*
Ga0182129_11152891	3300015323	Miscanthus Phyllosphere	ELEDFECFSRKQWEGGFIRINDEGQQSIRAVSSKSLF*
Ga0182187_11156891	3300015341	Miscanthus Phyllosphere	PVFWELGDFKCLSSKIWEGGFIRINNEGQQPVQAIGSKSLF*
Ga0182187_11171752	3300015341	Miscanthus Phyllosphere	ELVHADDYVNIATTDPMYWELEDFECFSGKQWEGGFIRINDEGQQPIRAVGSKSLF*
Ga0182187_11453551	3300015341	Miscanthus Phyllosphere	ADLVFWELGDFECLSGKTWEGGFIRINNEGQQPVQAIGSESLF*
Ga0182187_11937951	3300015341	Miscanthus Phyllosphere	VYWELEDFECFLGKLWEGGFIKISNESQQPIQAIGSESLF*
Ga0182109_10928392	3300015342	Miscanthus Phyllosphere	LVFWELGDFECLSGKTWEGGFIRINNEGQQLVQAIGFESLF*
Ga0182109_11506201	3300015342	Miscanthus Phyllosphere	VFWELGDFECFSGKLWEGGFIKISNESQQPMQAISSESLF*
Ga0182109_11959571	3300015342	Miscanthus Phyllosphere	FWELGDFECFSDKSWEGGFIKISNKSQQPMQAIGSESLF*
Ga0182109_12032651	3300015342	Miscanthus Phyllosphere	TDLAFWELGDFECFSGKLWEGGFIKISNESQQPMQAIGSESLF*
Ga0182109_12040822	3300015342	Miscanthus Phyllosphere	SIATTDPMYWELEDFECFSSKRWEGGFIRINDEGQQPIRAVGSKSLF*
Ga0182109_12128701	3300015342	Miscanthus Phyllosphere	SIATADPMYWELEDFECFSGKLWEGGFIKINDESQQPIQAINYESLF*
Ga0182109_12231781	3300015342	Miscanthus Phyllosphere	EDFNCFSSKLWKGGLIKISEESQQAIQAIGSKSLF*
Ga0182155_11738672	3300015343	Miscanthus Phyllosphere	ADLVYWELEDFECFFGKLWKGDFIKINDENQQPIQAIGFESLF*
Ga0182155_12174021	3300015343	Miscanthus Phyllosphere	ATADPVFWELGDFEFFSGKSWEGFIKISNESQQSMQAIGSESLF
Ga0182155_12243312	3300015343	Miscanthus Phyllosphere	DPMYWELEDFECFSSKQWEGGFIRINDEGQQLIRAADSESLF*
Ga0182155_12263881	3300015343	Miscanthus Phyllosphere	ELGDFECFFGKSWEGGFIKISNENQQPMQAIGSESLF*
Ga0182189_10362991	3300015344	Miscanthus Phyllosphere	TADPMYWELEDFECFSGKQWEGGFISINDEGQLLIRAVGFESLF*
Ga0182189_10940252	3300015344	Miscanthus Phyllosphere	ATIDLVYWELEDFKCFSGKLWEGGFININDESQQPIQAINS*
Ga0182189_11235422	3300015344	Miscanthus Phyllosphere	GDFECFSGKTWEGGFIKISNESQQPMQAIGSESLF*
Ga0182189_11780021	3300015344	Miscanthus Phyllosphere	ADPVFWKLGDFECFSGKLWEGGFIKINNESQQPIQAIGSESLF*
Ga0182111_11421901	3300015345	Miscanthus Phyllosphere	DPVFWELGDFECFSSKSWEGGFIKIINECQQPMQAIDFQSLF*
Ga0182111_11491152	3300015345	Miscanthus Phyllosphere	MLMILSIATTDPMYWELEDFECFSSKLWEGGFIKINDESQQPIQAVGSESLF*
Ga0182111_11545352	3300015345	Miscanthus Phyllosphere	ATADPVYWELEDFECFSSKLWEGGFIKISNESQQPIQAIGSESLF*
Ga0182111_11703471	3300015345	Miscanthus Phyllosphere	FWELGDFECFSGKSWEGGFIKISNEIQQPMQAIGFESLF*
Ga0182111_11870351	3300015345	Miscanthus Phyllosphere	ADPIFWELRDFEWFSSKLWEGGFIRVNDESQQPIQAVGFKNLS*
Ga0182111_12226351	3300015345	Miscanthus Phyllosphere	PVFWELGDFECFSGKLWEGGFIKISNESQQPMQAIGSESLF*
Ga0182111_12308401	3300015345	Miscanthus Phyllosphere	ESMSIATANPVYWELEDFECFSGKLWEGGFIKISNEGQQPIQAIGFESWF*
Ga0182139_11080171	3300015346	Miscanthus Phyllosphere	MATANPVFWELGDFECFSSKIWEGGFIRINDESQQPIQAVGFENLS*
Ga0182139_11650621	3300015346	Miscanthus Phyllosphere	ELGDFECFSGKSWEGGFIKISNESQQPMQAIDSESLF*
Ga0182139_11682441	3300015346	Miscanthus Phyllosphere	DPMYWELEDFECFSGKRWEGGFIRINDEGQQSIQAVGSESLF*
Ga0182139_11958751	3300015346	Miscanthus Phyllosphere	IVIADPVYWELEDFKCFSSKLWEGGFIKISDESQQPIQAIGSKSLF*
Ga0182139_12162421	3300015346	Miscanthus Phyllosphere	SVSIATVDLMYWELEDFEYFSGKRWEGFIRINDEGQQLIRAVGFESLF
Ga0182177_11084512	3300015347	Miscanthus Phyllosphere	LGDFECFSSKTWEGGFIKISNESQQPMQAIGSESLF*
Ga0182177_11196021	3300015347	Miscanthus Phyllosphere	IADPVFWELGDFECFSGKSWEGGFIKISNESQQSIQAIGSESLF*
Ga0182177_11771622	3300015347	Miscanthus Phyllosphere	ADLVFWELGDIECFSGNLWEGGFIKISNESQQPIQAVGFKNLF*
Ga0182177_12244601	3300015347	Miscanthus Phyllosphere	IATADPIFWELEDFECFSSKLWEGGFIKISDESQQPI*
Ga0182177_12464331	3300015347	Miscanthus Phyllosphere	PVSITTADPVFWELGDFECLSGKTWEGGFIRINNEGRQPVQAIGFESLF*
Ga0182177_12466891	3300015347	Miscanthus Phyllosphere	EDFECFSGKLWEGGFIKISNEGQQPIQAKDSESLF*
Ga0182161_10538382	3300015351	Miscanthus Phyllosphere	MSIATADPVFWELGDFECFSGKSWEGGFIKISNEGQQPMQAIGSESLF*
Ga0182161_10867811	3300015351	Miscanthus Phyllosphere	DFECFSSKTWEGGFIKISNESQQPMQTIGSESLF*
Ga0182161_11668101	3300015351	Miscanthus Phyllosphere	YWELEDFECFSSKLWEGGFIKISNEGQQPIQAIDSKSLF*
Ga0182161_11869061	3300015351	Miscanthus Phyllosphere	VSSATADLVFWELGDFECSSSKSWEGGFIKISNESQQPMQAIGSES
Ga0182161_11953241	3300015351	Miscanthus Phyllosphere	ELGDFECFSGKLWEGGFIKISNESQQPMQAIDSKSLF*
Ga0182161_12425801	3300015351	Miscanthus Phyllosphere	LVFWELGDFECFSGKLWEGGFIKISNKRQQSMQAIGSESLF*
Ga0182159_11384091	3300015355	Miscanthus Phyllosphere	TTNPMYWELEDFECFSRKLWEGGFININDESQQLIQAIGSESLL*
Ga0182159_12377281	3300015355	Miscanthus Phyllosphere	EDFECFSGKLWEGGFIKISNEGQQSIQAIGSESLF*
Ga0182159_12652291	3300015355	Miscanthus Phyllosphere	DFECFSGKLWEGGFIKISNESQQPMQGIGSESLF*
Ga0182159_12893351	3300015355	Miscanthus Phyllosphere	VSIAIADPMYWELEDFKCFSGKLWEGGFIKINDESQQLIQAVDSESLF*
Ga0182159_12899602	3300015355	Miscanthus Phyllosphere	YWELEDFECFSGKQWEGGFIKINDESQQPIQAVSSESLF*
Ga0182159_13008971	3300015355	Miscanthus Phyllosphere	DPVYWELEDFECFSGKLWEGGFIKINDEIQQPIQAIGFESLF*
Ga0182159_13178412	3300015355	Miscanthus Phyllosphere	VSIATVDPLYWELEDFERFPGKLWEGGFIKINDESQQPIQAVGSKSLF*
Ga0182159_13280211	3300015355	Miscanthus Phyllosphere	DPMYWELEDFECFSSKRWEGGFIKINDEGQQPIRAIGFESLF*
Ga0182159_13401742	3300015355	Miscanthus Phyllosphere	MSIATADPMFWELEDFECFFGKQWEGGFIRINDEGQQLIRAIGSESLF*
Ga0182145_11145791	3300015361	Miscanthus Phyllosphere	IAIADPVFLELGDFECFSGKLWEGGFIKINNESQQPMQAIGSESLF*
Ga0182145_11727992	3300015361	Miscanthus Phyllosphere	WELEDFECFSGKRWEGGFIRINDKGQQPIQAVGSKSLF*
Ga0182203_10891072	3300017404	Miscanthus Phyllosphere	PANDSMSIAIADPMYWELEDFKCFSGKLREGGFIKINDESQQLIQAIDSKSLF
Ga0182203_11031111	3300017404	Miscanthus Phyllosphere	AIVNPVYWELEDFECSSGKLWEGGFIKISNEGQQPIQAIGSKSLF
Ga0182203_11205601	3300017404	Miscanthus Phyllosphere	FWELGDFECFSGKSWEGGFIKISNESQQPMQAIGSENLF
Ga0182203_11573092	3300017404	Miscanthus Phyllosphere	DPMYWELEDFECFSSKRWEGGFIRINDEGQRLIQTVGSKSLF
Ga0182220_10092922	3300017407	Miscanthus Phyllosphere	VSIATTDPIFWELGDFECFFGKLWEGGFIKISNESQQAMQAIGSESLF
Ga0182220_10197121	3300017407	Miscanthus Phyllosphere	VFWELGDFECFSGKSWEGGFIKTSNESQQPMQAIGSESLF
Ga0182220_10667011	3300017407	Miscanthus Phyllosphere	TDPMYWELEDFECFSGKLWEGGFIKISNKGQQPIQAISSESLF
Ga0182220_10792971	3300017407	Miscanthus Phyllosphere	ELGDFECFSSKSWEGGFIKISNESQQPVQAIGSESLF
Ga0182220_10999461	3300017407	Miscanthus Phyllosphere	IVFWELEDFECFSGKSWEGGFIKINNESQQSMQAIGSESLF
Ga0182220_11036451	3300017407	Miscanthus Phyllosphere	ADPVFWELGDFECLSGKTWEGGFIRINNEDQQPVQAIGSESLF
Ga0182204_10893851	3300017409	Miscanthus Phyllosphere	VSIATADPVYWELEDFECFSGKLWEGGFIKNNDESQQPIQAIGSESLF
Ga0182204_10928982	3300017409	Miscanthus Phyllosphere	WKLGDFECFSGKLWEGGFIKISNESQQPMQAIGSESLF
Ga0182204_11027241	3300017409	Miscanthus Phyllosphere	TVDPVYWELEDFEYFSGKLWEGGFIRVNDESQQPIQVVGSESLF
Ga0182207_10885592	3300017410	Miscanthus Phyllosphere	VSIATADPVFWELGDFKCFSGKIWEGGFIRVNNESQQPIQAVGSKSLF
Ga0182207_11218601	3300017410	Miscanthus Phyllosphere	MSIATANPVYWELEDFECFSGKLWEGGFIKISNEGQQPIQAIGSESLF
Ga0182208_10428281	3300017411	Miscanthus Phyllosphere	VNIATTDPMYWELEDFECFSGKQWEGGFVQINDESQQPIQAVGSKSLF
Ga0182208_10845471	3300017411	Miscanthus Phyllosphere	AIVDPVFWELGDFECFSSKTWEGGFIKIGNKSQQPMQAIGSESLF
Ga0182208_10962091	3300017411	Miscanthus Phyllosphere	SIATTDLVYWELEDFECFSSKLWEGGFIKISNESQQPIQAIGSESLF
Ga0182222_10166432	3300017413	Miscanthus Phyllosphere	MSIATANLVYWELEDFECFSGKLWEGGFIKISDESQQPIQAIGSESLF
Ga0182222_11041491	3300017413	Miscanthus Phyllosphere	VFWELGDFECFSGKSWEGGFIKISNESQQLMEAIGSKSLF
Ga0182222_11054291	3300017413	Miscanthus Phyllosphere	ELGDFECFSSKSWEGGFIKISNESQQPMQANSFIKISSESLF
Ga0182202_10175593	3300017415	Miscanthus Phyllosphere	DLVFWELGDFKCFSGKLWEGGFIKISNENQQPMQAIGSESLF
Ga0182202_10660981	3300017415	Miscanthus Phyllosphere	VSIATADLVFWELGDFECFSSKSWEGGFIKTSNESQQPMQAIGSESLF
Ga0182202_10704951	3300017415	Miscanthus Phyllosphere	WELGDFECFSGKLWEGGFIKISNESQQLMQAIGSESLF
Ga0182202_10879601	3300017415	Miscanthus Phyllosphere	DPVFWELGDFECFSGKLWEGGFIRINDESQQPIQAVGFENLS
Ga0182230_10323982	3300017417	Miscanthus Phyllosphere	ATADLVFSELGDFECFSSKSSEGGFIKISNESQQSMQAIGSESLF
Ga0182228_11019711	3300017420	Miscanthus Phyllosphere	IVTVDPMHWELEDFECFSGKRWEGGFIRINDKGQQPIQAVGSKSLF
Ga0182228_11228111	3300017420	Miscanthus Phyllosphere	MSIATADPVFWELGDFECFFGKSWEGGFIKISNESQQLMQAINSESLF
Ga0182219_10609571	3300017424	Miscanthus Phyllosphere	SIAIANPVYWELEDFECFSGKLWKGGFIKISNESQQPIQAISSESLF
Ga0182219_10840141	3300017424	Miscanthus Phyllosphere	LEDFKCFSSKLWEGGFIKISDESQQPIQAIGSKSLF
Ga0182219_10959181	3300017424	Miscanthus Phyllosphere	FWELGDFECFSGKSWEGGFIKISNESQQPMQAIGSESLF
Ga0182219_11120831	3300017424	Miscanthus Phyllosphere	ATTDLAFWELGDFECFSGKLWEGGFIKISNESQQPMQAIGSESLF
Ga0182224_10574612	3300017425	Miscanthus Phyllosphere	MSLSIATADPVFWELGDFECLSGKTWEGGFIRINNEGQQPVQAIGS
Ga0182224_10753091	3300017425	Miscanthus Phyllosphere	WELEDFECFSGKLWEGGFIKISSEGQQPIQAIGFESLF
Ga0182190_11271411	3300017427	Miscanthus Phyllosphere	VFWELGDFECFSGKSWEGGFIKINNESQQPMQAIGSKSLF
Ga0182190_11539201	3300017427	Miscanthus Phyllosphere	PMYWELEDFECFSGKRWEGGFIKINDESQQPIQAVGSKSLF
Ga0182192_10239671	3300017430	Miscanthus Phyllosphere	AIADPVFLELGDFECFSGKLWEGGFIKINNESQQPMQAIGSESLF
Ga0182192_10501601	3300017430	Miscanthus Phyllosphere	GDFECFSGKTWEGGFIKISNESQQPMQAIDSESLF
Ga0182192_10508272	3300017430	Miscanthus Phyllosphere	ATADLVFWELGDFECLSGKTWEGGFIRINNEGQQPVQAIGSESLF
Ga0182192_10658391	3300017430	Miscanthus Phyllosphere	FWELGDFECFSSKLWEGGFIKISNESQQPMQAIGSESLF
Ga0182192_10858661	3300017430	Miscanthus Phyllosphere	ESVSITTVNPVFWELGDFECFSGKSWEGGFIKISNESQQPMQAIGSESLF
Ga0182192_11162991	3300017430	Miscanthus Phyllosphere	LAYWELEDFECFSSKLSEGGFIKINDESQQPIQAIGSQSLF
Ga0182192_11221862	3300017430	Miscanthus Phyllosphere	MSIATTDLVYWELEDFECFSGKQWEGGFIKINDDSQQPIQAVGSEGLF
Ga0182192_11635691	3300017430	Miscanthus Phyllosphere	PVFWELGDFECFSGKSWEGGFIKISNESQQPMQAIDSKSLF
Ga0182206_10445301	3300017433	Miscanthus Phyllosphere	LEDFECFSSKLWEGGFIKISDKSQQLIQAIGSESLF
Ga0182206_10857111	3300017433	Miscanthus Phyllosphere	MSIATADPVFWELGDFECFSGKSWEGGFIKISTESQQPMQAIGSESLF
Ga0182206_11213681	3300017433	Miscanthus Phyllosphere	FWELGDFECFSSKLWEGGFIKISNESQQRMQVISSESLF
Ga0182206_11404392	3300017433	Miscanthus Phyllosphere	IFWELGDFECFSGKIWEGGFIRVNNESQQPIQAVGFENMS
Ga0182209_10711631	3300017436	Miscanthus Phyllosphere	YWELEDFECFSGKLWEGGFIKISNKGQQRIQAIGSEGLF
Ga0182209_10975571	3300017436	Miscanthus Phyllosphere	PVFWELGDFECLSGKTWEGGFIKINNEGQQPVQAIGSKSLF
Ga0182209_11144952	3300017436	Miscanthus Phyllosphere	MSIATADPMYWELEDFKCFSGKRWEGGFIKINDESQQPIQEVGSESLF
Ga0182209_11333512	3300017436	Miscanthus Phyllosphere	IATADLVFWELGDFECFSGKLWEGGFIKISNESQQPMQAIGSKSLF
Ga0182209_11503281	3300017436	Miscanthus Phyllosphere	DLVFWELRDFECFASKPWEGGFIKISNEIQQPMQAIGSESLF
Ga0182209_11557102	3300017436	Miscanthus Phyllosphere	IAIADPMYWELEDFECFSRKLWEGGFIKVNDEGQQPIQAIGFENLF
Ga0182191_10675681	3300017438	Miscanthus Phyllosphere	FWELGDFECFSGKTWEGGFIKISHESQQPMQAIGSESLF
Ga0182191_10751422	3300017438	Miscanthus Phyllosphere	VSIAIADPMYWELEDFECFSGKLWEGGFIKINDESQQPIQAVGSE
Ga0182191_11371952	3300017438	Miscanthus Phyllosphere	MYWELEDFECFSSKLWEGGFIKVNDESQQPIQAFGIENLF
Ga0182191_11685191	3300017438	Miscanthus Phyllosphere	MYWELEDFECFYGKLWEGGFFKINDESQQLIQAIGFESL
Ga0182221_11143661	3300017442	Miscanthus Phyllosphere	MSIAIADLIFWELGDFECFSGKLWEGGFIKISNESQQPMQAIGSKSLF
Ga0182221_11377701	3300017442	Miscanthus Phyllosphere	PVFWELGDFECFSGKLWEGGFIKISNESQQPMQAIGSESLF
Ga0182193_10369262	3300017443	Miscanthus Phyllosphere	VDFERIECFSGKTWEEGVITINDDSQQPIQVVGSENLY
Ga0182193_10511711	3300017443	Miscanthus Phyllosphere	VSIATVDPVFWELGDFECLSDKIWEGGFIRIHNEGQQPIQAISSESLF
Ga0182193_10849111	3300017443	Miscanthus Phyllosphere	VFWELEDFECFSGKLWEGGFIKISNESQQPMQPIGSKRLF
Ga0182193_10941472	3300017443	Miscanthus Phyllosphere	MIGFMQSIATANPVYWEPEDFECFSRKLWEGGFIKINDESQQLIQAIDSKSLF
Ga0182193_11088291	3300017443	Miscanthus Phyllosphere	YWELEDFECFSSKLWEGGFIKISDESQQPIQVIGSESLF
Ga0182193_11359871	3300017443	Miscanthus Phyllosphere	VSIATADPVFWELGDFECFSGKSWEGGFIKISNESQQPMQAIGSESLF
Ga0182193_11774531	3300017443	Miscanthus Phyllosphere	ELEDFKCFSGKSWEGGFIKINNESQQPMQAIGSESLF
Ga0182193_11954742	3300017443	Miscanthus Phyllosphere	DPVFWELGDFECFSGKLWEGGFIRINDESQQPIQAVSFEKLS
Ga0182229_10962431	3300017682	Miscanthus Phyllosphere	MSIATVDLVFWELGDFECFSGKLWEGGFIKISNESQQAMQAIGSESLF
Ga0182218_10252283	3300017683	Miscanthus Phyllosphere	TMSIATADPVFWELEDFECFSGKLWEGGFIRINNESQQPIQAVGFENWS
Ga0182218_11323663	3300017683	Miscanthus Phyllosphere	ATTNPMYWELEDFECFSGKLWEGGFININDESQQLIQAIGSESLL
Ga0182218_11365451	3300017683	Miscanthus Phyllosphere	SVSVATTNPVYWELEDFECFSSKLREGGFIKISNESQQPIQAIGSKSLF
Ga0182218_11560581	3300017683	Miscanthus Phyllosphere	LEDFECFFSGKLWEGGFIKISNEGQQPIQAIISECLF
Ga0182225_10788371	3300017684	Miscanthus Phyllosphere	LGDFECFSDKLWEGGFIKISNESQQPMQAVSSESLF
Ga0182225_11161132	3300017684	Miscanthus Phyllosphere	MSIAIADPVFWELEDFECFSGKLWEGGFIKISDESQQLIQAVGFENLF
Ga0182225_11195962	3300017684	Miscanthus Phyllosphere	VSIATTDPMYWELEDFECFSGKRWEGGFIRINDEGQQPIQAVGSESLF
Ga0182225_11440682	3300017684	Miscanthus Phyllosphere	LEDFECFSGKLWEGGFIIINDEGQQLIQAVGSKSLF
Ga0182227_11204541	3300017685	Miscanthus Phyllosphere	LEDFKCFSSKLWEGGFIKINDESKQPIQAISSESLF
Ga0182227_11291751	3300017685	Miscanthus Phyllosphere	ELGDFECFSGKTWEGGFIKISNESQQPMQATGSESLFS
Ga0182205_10997431	3300017686	Miscanthus Phyllosphere	SITTADPVFWKLGDFECFFGKSWEGGFIKISNKSQQPMQAISSESLF
Ga0182205_11135941	3300017686	Miscanthus Phyllosphere	LEDFECFSGKLWEGGFIKSNDESRQPIQEIGSESLF
Ga0182231_11237821	3300017689	Miscanthus Phyllosphere	TVDPVFWELGDFECLSGKIWEGGFIRINNEGQQPVQAIGSKSLF
Ga0182223_10686292	3300017690	Miscanthus Phyllosphere	MSIATADPMYWELEDFKCFSGKRWEGGFIKINDESQQPIQVVGFESLF
Ga0182223_10832191	3300017690	Miscanthus Phyllosphere	TADPVLWELGEFECFSSKLWEGGFIKINNESQQPMQAIGSESLF
Ga0182223_11086761	3300017690	Miscanthus Phyllosphere	MSIATADPVFWVLGDFKCFSSKSWEGGFIKISNESQQPMQAIGS
Ga0207642_111154721	3300025899	Miscanthus Rhizosphere	DPMFWELEDFEYFSGKRWEGGFIRINDEGQQPIRAVGSKSLF

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.33
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.33
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F017777

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign