| Basic Information | |
|---|---|
| Family ID | F017766 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 239 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Number of Associated Samples | 181 |
| Number of Associated Scaffolds | 239 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.79 % |
| Associated GOLD sequencing projects | 172 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.582 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.523 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.126 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.954 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 239 Family Scaffolds |
|---|---|---|
| PF00202 | Aminotran_3 | 52.72 |
| PF09335 | SNARE_assoc | 30.13 |
| PF04307 | YdjM | 3.35 |
| PF00781 | DAGK_cat | 0.84 |
| PF01653 | DNA_ligase_aden | 0.42 |
| PF13493 | DUF4118 | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 239 Family Scaffolds |
|---|---|---|---|
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 30.13 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 30.13 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 30.13 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 3.35 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.67 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.58 % |
| Unclassified | root | N/A | 0.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908044|A5_c1_ConsensusfromContig38078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300000955|JGI1027J12803_108903194 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300001356|JGI12269J14319_10350636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 520 | Open in IMG/M |
| 3300001593|JGI12635J15846_10672910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300001661|JGI12053J15887_10417370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300002914|JGI25617J43924_10350773 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300002914|JGI25617J43924_10365501 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300002916|JGI25389J43894_1078086 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300002917|JGI25616J43925_10043247 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300002917|JGI25616J43925_10076104 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300002917|JGI25616J43925_10104468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1166 | Open in IMG/M |
| 3300004091|Ga0062387_100371792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 952 | Open in IMG/M |
| 3300004091|Ga0062387_100415850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 911 | Open in IMG/M |
| 3300005165|Ga0066869_10107194 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005166|Ga0066674_10183774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300005167|Ga0066672_10360114 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300005174|Ga0066680_10268751 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005178|Ga0066688_10194086 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300005181|Ga0066678_10186015 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300005332|Ga0066388_100711081 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300005332|Ga0066388_103636458 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300005439|Ga0070711_101404387 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005467|Ga0070706_100716830 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300005526|Ga0073909_10176120 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300005532|Ga0070739_10436839 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005533|Ga0070734_10357454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
| 3300005549|Ga0070704_100773420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 856 | Open in IMG/M |
| 3300005561|Ga0066699_10152103 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300005712|Ga0070764_10213881 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005841|Ga0068863_102171241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300005843|Ga0068860_101449735 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300006052|Ga0075029_100211016 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300006176|Ga0070765_101735870 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006176|Ga0070765_102111906 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006755|Ga0079222_11265612 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006797|Ga0066659_11315391 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300006800|Ga0066660_11156811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300006804|Ga0079221_11771450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300006806|Ga0079220_10291629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
| 3300006903|Ga0075426_10208632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1417 | Open in IMG/M |
| 3300006904|Ga0075424_100123852 | All Organisms → cellular organisms → Bacteria | 2732 | Open in IMG/M |
| 3300007265|Ga0099794_10062451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1811 | Open in IMG/M |
| 3300009038|Ga0099829_10021970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4400 | Open in IMG/M |
| 3300009038|Ga0099829_10175356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1723 | Open in IMG/M |
| 3300009038|Ga0099829_10310125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1295 | Open in IMG/M |
| 3300009038|Ga0099829_10322103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1270 | Open in IMG/M |
| 3300009088|Ga0099830_10038547 | All Organisms → cellular organisms → Bacteria | 3292 | Open in IMG/M |
| 3300009088|Ga0099830_10176251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1661 | Open in IMG/M |
| 3300009088|Ga0099830_10883218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300009088|Ga0099830_11011354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300009143|Ga0099792_11239391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300009174|Ga0105241_11802547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300009548|Ga0116107_1013230 | All Organisms → cellular organisms → Bacteria | 3442 | Open in IMG/M |
| 3300009635|Ga0116117_1046010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
| 3300009644|Ga0116121_1114549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300009759|Ga0116101_1161542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300009792|Ga0126374_10088009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1722 | Open in IMG/M |
| 3300009792|Ga0126374_10483298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300010047|Ga0126382_11832881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300010048|Ga0126373_12904299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300010321|Ga0134067_10056596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1274 | Open in IMG/M |
| 3300010336|Ga0134071_10159003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
| 3300010343|Ga0074044_10585931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300010359|Ga0126376_10333551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1336 | Open in IMG/M |
| 3300010359|Ga0126376_10344215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1318 | Open in IMG/M |
| 3300010360|Ga0126372_12488861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300010361|Ga0126378_10772355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
| 3300010361|Ga0126378_12571344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300010361|Ga0126378_12754778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300010376|Ga0126381_102477487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300010379|Ga0136449_102222594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300011120|Ga0150983_15773310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300011269|Ga0137392_10160377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1821 | Open in IMG/M |
| 3300011269|Ga0137392_11167352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300011270|Ga0137391_10444978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300011270|Ga0137391_10913958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300011270|Ga0137391_11007014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300011271|Ga0137393_11373953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300011271|Ga0137393_11439952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300012096|Ga0137389_10114399 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300012096|Ga0137389_11215303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300012096|Ga0137389_11313271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300012189|Ga0137388_10222638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1708 | Open in IMG/M |
| 3300012189|Ga0137388_10225128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1699 | Open in IMG/M |
| 3300012189|Ga0137388_10370925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1322 | Open in IMG/M |
| 3300012189|Ga0137388_10600162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
| 3300012200|Ga0137382_10265278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1192 | Open in IMG/M |
| 3300012202|Ga0137363_11229652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300012203|Ga0137399_10796518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300012203|Ga0137399_11114587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300012203|Ga0137399_11709152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300012205|Ga0137362_11107968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300012205|Ga0137362_11294656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300012209|Ga0137379_10118423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2547 | Open in IMG/M |
| 3300012209|Ga0137379_11092164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300012210|Ga0137378_11072333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300012210|Ga0137378_11662418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300012211|Ga0137377_10825585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300012285|Ga0137370_10850684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300012351|Ga0137386_10648449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300012357|Ga0137384_10863747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300012361|Ga0137360_10117291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2064 | Open in IMG/M |
| 3300012361|Ga0137360_10392275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1169 | Open in IMG/M |
| 3300012363|Ga0137390_10607625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300012918|Ga0137396_10045426 | All Organisms → cellular organisms → Bacteria | 2988 | Open in IMG/M |
| 3300012925|Ga0137419_11883350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300012971|Ga0126369_10581745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1188 | Open in IMG/M |
| 3300015051|Ga0137414_1263982 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300015053|Ga0137405_1039636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300015053|Ga0137405_1260384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300015054|Ga0137420_1152781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300015197|Ga0167638_1020490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1545 | Open in IMG/M |
| 3300015245|Ga0137409_10368661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
| 3300016270|Ga0182036_10711626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300016371|Ga0182034_10127155 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300016387|Ga0182040_10277371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1272 | Open in IMG/M |
| 3300016422|Ga0182039_10292678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1346 | Open in IMG/M |
| 3300017944|Ga0187786_10110197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 941 | Open in IMG/M |
| 3300017961|Ga0187778_10077098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2052 | Open in IMG/M |
| 3300017961|Ga0187778_10384108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300017966|Ga0187776_10084527 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
| 3300017973|Ga0187780_10063899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2534 | Open in IMG/M |
| 3300018006|Ga0187804_10361083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300018024|Ga0187881_10024979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3206 | Open in IMG/M |
| 3300018058|Ga0187766_11289397 | Not Available | 532 | Open in IMG/M |
| 3300018089|Ga0187774_10983555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300018431|Ga0066655_10387929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300018433|Ga0066667_11316014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300020006|Ga0193735_1130061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300020170|Ga0179594_10404640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300020199|Ga0179592_10010687 | All Organisms → cellular organisms → Bacteria | 3971 | Open in IMG/M |
| 3300020199|Ga0179592_10057279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1776 | Open in IMG/M |
| 3300020199|Ga0179592_10301016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300020579|Ga0210407_10102123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2179 | Open in IMG/M |
| 3300020579|Ga0210407_10534687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300020579|Ga0210407_10643224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300020579|Ga0210407_11277035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300020580|Ga0210403_10771285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300020580|Ga0210403_10917627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300020581|Ga0210399_11262375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300020581|Ga0210399_11578849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300020582|Ga0210395_11123241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300020583|Ga0210401_10904641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300021088|Ga0210404_10436689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300021088|Ga0210404_10436935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300021168|Ga0210406_10654284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300021168|Ga0210406_11260804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300021170|Ga0210400_11205045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300021178|Ga0210408_10265033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1369 | Open in IMG/M |
| 3300021178|Ga0210408_10477608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 992 | Open in IMG/M |
| 3300021180|Ga0210396_10804977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300021180|Ga0210396_11065874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300021405|Ga0210387_11329750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300021420|Ga0210394_10062453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3235 | Open in IMG/M |
| 3300021420|Ga0210394_10503773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300021420|Ga0210394_10719416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300021420|Ga0210394_10769954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300021479|Ga0210410_10540721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
| 3300021479|Ga0210410_11832094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300021559|Ga0210409_10050161 | All Organisms → cellular organisms → Bacteria | 3928 | Open in IMG/M |
| 3300021560|Ga0126371_10659330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300021560|Ga0126371_13019140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300024323|Ga0247666_1023584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1309 | Open in IMG/M |
| 3300025469|Ga0208687_1011450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2711 | Open in IMG/M |
| 3300025498|Ga0208819_1011154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2865 | Open in IMG/M |
| 3300025899|Ga0207642_10205672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1090 | Open in IMG/M |
| 3300025905|Ga0207685_10836942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300025906|Ga0207699_10890178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300025922|Ga0207646_10914126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300026304|Ga0209240_1004699 | All Organisms → cellular organisms → Bacteria | 5163 | Open in IMG/M |
| 3300026317|Ga0209154_1308167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300026333|Ga0209158_1051483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1681 | Open in IMG/M |
| 3300026334|Ga0209377_1337473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300026377|Ga0257171_1047808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300026498|Ga0257156_1125192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300026514|Ga0257168_1067344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300026538|Ga0209056_10571006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300026547|Ga0209156_10032742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2933 | Open in IMG/M |
| 3300026557|Ga0179587_10097103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1777 | Open in IMG/M |
| 3300026557|Ga0179587_10434562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300026859|Ga0207859_1007875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 974 | Open in IMG/M |
| 3300026895|Ga0207758_1015395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300027039|Ga0207855_1061721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300027045|Ga0207726_1020041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
| 3300027297|Ga0208241_1052759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300027562|Ga0209735_1001435 | All Organisms → cellular organisms → Bacteria | 4133 | Open in IMG/M |
| 3300027643|Ga0209076_1005039 | All Organisms → cellular organisms → Bacteria | 3116 | Open in IMG/M |
| 3300027662|Ga0208565_1110209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300027703|Ga0207862_1124277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300027821|Ga0209811_10115086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
| 3300027855|Ga0209693_10557687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300027857|Ga0209166_10109059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1538 | Open in IMG/M |
| 3300027862|Ga0209701_10217539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1132 | Open in IMG/M |
| 3300027862|Ga0209701_10640859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300027875|Ga0209283_10431372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300027903|Ga0209488_10543817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300028293|Ga0247662_1028683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
| 3300028536|Ga0137415_10785701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300028906|Ga0308309_11011608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 720 | Open in IMG/M |
| 3300030842|Ga0075404_11176017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300031090|Ga0265760_10201174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300031128|Ga0170823_14405930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300031231|Ga0170824_120567018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2552 | Open in IMG/M |
| 3300031469|Ga0170819_17456717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300031549|Ga0318571_10238780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300031561|Ga0318528_10057690 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300031718|Ga0307474_10217245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1459 | Open in IMG/M |
| 3300031719|Ga0306917_11524823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300031740|Ga0307468_100826793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300031754|Ga0307475_11517167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300031768|Ga0318509_10799639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300031796|Ga0318576_10283460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300031835|Ga0318517_10539401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300031846|Ga0318512_10054559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1792 | Open in IMG/M |
| 3300031859|Ga0318527_10518318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300031897|Ga0318520_10506533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300031912|Ga0306921_11424539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300031941|Ga0310912_10644049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300031942|Ga0310916_11218371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300031947|Ga0310909_10659625 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300031962|Ga0307479_10318133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1538 | Open in IMG/M |
| 3300031962|Ga0307479_10413155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1334 | Open in IMG/M |
| 3300032041|Ga0318549_10584853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300032059|Ga0318533_10778205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300032091|Ga0318577_10482196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300032174|Ga0307470_10673304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 785 | Open in IMG/M |
| 3300032180|Ga0307471_101593042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300032180|Ga0307471_102239343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300032180|Ga0307471_102408989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300032180|Ga0307471_103164435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300032180|Ga0307471_103823770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300032205|Ga0307472_100408216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
| 3300032205|Ga0307472_101999226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300032805|Ga0335078_11539902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300032954|Ga0335083_10335861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1313 | Open in IMG/M |
| 3300032954|Ga0335083_10381417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
| 3300033158|Ga0335077_11152843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300033289|Ga0310914_11509198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300033402|Ga0326728_10306454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1443 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.51% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.09% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.26% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.84% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.42% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.42% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.42% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026859 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 25 (SPAdes) | Environmental | Open in IMG/M |
| 3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030842 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_c1_01401160 | 2124908044 | Soil | ERFGHVRVIGEIPRLPNLHRTSLMQVFMNHFDRAAFSQ |
| JGI1027J12803_1089031943 | 3300000955 | Soil | RFGHVRVIGELPRLPNLHRTALIQVFMNHFDRAAFAQ* |
| JGI12269J14319_103506361 | 3300001356 | Peatlands Soil | IEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFSQ* |
| JGI12635J15846_106729101 | 3300001593 | Forest Soil | QNRENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMNNFDRAAFSQ* |
| JGI12053J15887_104173701 | 3300001661 | Forest Soil | GHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ* |
| JGI25617J43924_103507731 | 3300002914 | Grasslands Soil | RENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ* |
| JGI25617J43924_103655011 | 3300002914 | Grasslands Soil | IERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| JGI25389J43894_10780862 | 3300002916 | Grasslands Soil | ENRETIERFGHVRVIGEVPRLPNLHRTALMQVFLNHFDRAAFSQ* |
| JGI25616J43925_100432471 | 3300002917 | Grasslands Soil | VLIGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| JGI25616J43925_100761041 | 3300002917 | Grasslands Soil | NRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| JGI25616J43925_101044681 | 3300002917 | Grasslands Soil | VLIGDQNRENRETIERFGHVRVIGEIPKLPNLHRTAXMQVFMNHFDRAAFAQ* |
| Ga0062387_1003717921 | 3300004091 | Bog Forest Soil | DQNRENRETIERFGHVRVIGEIPRLPNLHRTALMQVFLNHFDRAAFSQ* |
| Ga0062387_1004158502 | 3300004091 | Bog Forest Soil | RENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMNNFDRAAFAQ* |
| Ga0066869_101071941 | 3300005165 | Soil | NRENRETIERFGHVRVIGEVPRLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0066674_101837742 | 3300005166 | Soil | ETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0066672_103601141 | 3300005167 | Soil | ENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0066680_102687512 | 3300005174 | Soil | NRENRETIERFGHVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0066688_101940863 | 3300005178 | Soil | NRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0066678_101860151 | 3300005181 | Soil | GVVLIGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0066388_1007110811 | 3300005332 | Tropical Forest Soil | QNRENRETIERFGHVRVIGEIPKLPNLHRTALMQIFMNHFDRAAFAQ* |
| Ga0066388_1036364582 | 3300005332 | Tropical Forest Soil | VLIGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQIFMNHFDRAAFAQ* |
| Ga0070711_1014043871 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GVVLIGDQNRENRDTIEKFGHVRVIGEVPKLPNLHRTALMQVFLNHFDRSAFAQ* |
| Ga0070706_1007168301 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TIERFGHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ* |
| Ga0073909_101761202 | 3300005526 | Surface Soil | RLGHVRVIGEVPRLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0070739_104368391 | 3300005532 | Surface Soil | ENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0070734_103574541 | 3300005533 | Surface Soil | QNRENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMNNFDRAAFAQ* |
| Ga0070704_1007734201 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | QNRENRETVERFGHVRVIGEVPRLPNLHRTSLMQVFMNHFDRSAFSQ* |
| Ga0066699_101521032 | 3300005561 | Soil | DQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0070764_102138812 | 3300005712 | Soil | DQNRENRETVEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ* |
| Ga0068863_1021712412 | 3300005841 | Switchgrass Rhizosphere | QNRENRETVERFGHVRVIGEIPRLPNLHRTALMQVFMNHFDRSAFSQ* |
| Ga0068860_1014497352 | 3300005843 | Switchgrass Rhizosphere | DQNRENRETVERFGHVRVIGEVPRLPNLHRTSLMQVFMNHFDRSAFSQ* |
| Ga0075029_1002110161 | 3300006052 | Watersheds | IGDQNRENRETVEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ* |
| Ga0070765_1017358702 | 3300006176 | Soil | DQNRENRETIERFGHVRVIGEIPRLPNLHRTSLMQVFMNNFDRAAFSQ* |
| Ga0070765_1021119062 | 3300006176 | Soil | QNRENRETIERFGHVRVIGEIPRLPNLHRTALMQIFMNHFDRAAFAQ* |
| Ga0079222_112656121 | 3300006755 | Agricultural Soil | ENRETIERFGHVRVIGEIPRLPNLHRTALMQIFMNHFDRAAFAQ* |
| Ga0066659_113153912 | 3300006797 | Soil | IGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0066660_111568111 | 3300006800 | Soil | NRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0079221_117714501 | 3300006804 | Agricultural Soil | HVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0079220_102916291 | 3300006806 | Agricultural Soil | FGHVRVIGEIPRLPNLHRTALMQIFMNHFDRAAFAQ* |
| Ga0075426_102086321 | 3300006903 | Populus Rhizosphere | ENRETIERFGHVRVIGELPRLPNLHRTALIQVFMNHFDRAAFAQ* |
| Ga0075424_1001238521 | 3300006904 | Populus Rhizosphere | NRETVERFGHVRVIGEVPRLPNLHRTALMQVFMNHFDRSAFSQ* |
| Ga0099794_100624511 | 3300007265 | Vadose Zone Soil | NRENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ* |
| Ga0099829_100219701 | 3300009038 | Vadose Zone Soil | TIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0099829_101753561 | 3300009038 | Vadose Zone Soil | ETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0099829_103101251 | 3300009038 | Vadose Zone Soil | HVRVIGEIPKLPNLHRTALMQVFMSHFDRAAFSQ* |
| Ga0099829_103221032 | 3300009038 | Vadose Zone Soil | RENRETIERFGHVRVIGEVPRLPNLHRTALMQVFLNHFDRAAFSQ* |
| Ga0099830_100385475 | 3300009088 | Vadose Zone Soil | FGHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ* |
| Ga0099830_101762511 | 3300009088 | Vadose Zone Soil | ENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMSHFDRAAFSQ* |
| Ga0099830_108832182 | 3300009088 | Vadose Zone Soil | GDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0099830_110113542 | 3300009088 | Vadose Zone Soil | LIGDQNRENRETIERFGHVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0099792_112393912 | 3300009143 | Vadose Zone Soil | RFGHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ* |
| Ga0105241_118025471 | 3300009174 | Corn Rhizosphere | RENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0116107_10132305 | 3300009548 | Peatland | LIGDQNRENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFSQ* |
| Ga0116117_10460101 | 3300009635 | Peatland | NRENRETIERFGHVRVIGEIPRLPNLHRTALMQVFLNHFDRAAFSQ* |
| Ga0116121_11145491 | 3300009644 | Peatland | FGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ* |
| Ga0116101_11615422 | 3300009759 | Peatland | HVRVIGEIPRLPNLHRTALMQIFMNHFDRAAFSQ* |
| Ga0126374_100880091 | 3300009792 | Tropical Forest Soil | NRENRETIERFGHVRVIGELPRLPNLHRTALIQVFMNHFDRAAFAQ* |
| Ga0126374_104832982 | 3300009792 | Tropical Forest Soil | HVRVIGEIPKLPNLHRTALMQIFMNHFDRAAFAQ* |
| Ga0126382_118328811 | 3300010047 | Tropical Forest Soil | IERFGHVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAK* |
| Ga0126373_129042991 | 3300010048 | Tropical Forest Soil | RETVDRFGHVRVIGEIPRLPNLHRTALMQVFMNHFDRSAFSQ* |
| Ga0134067_100565961 | 3300010321 | Grasslands Soil | TIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0134071_101590033 | 3300010336 | Grasslands Soil | LIGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0074044_105859312 | 3300010343 | Bog Forest Soil | VLIGDQNRENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFSQ* |
| Ga0126376_103335511 | 3300010359 | Tropical Forest Soil | RETIERFGHVRVIGEIPKLPNLHRTSLMQTFMNHFDRAAFAQ* |
| Ga0126376_103442151 | 3300010359 | Tropical Forest Soil | NRENRETVEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ* |
| Ga0126372_124888611 | 3300010360 | Tropical Forest Soil | NRENRETIERFGHVRVIGEVPRLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0126378_107723551 | 3300010361 | Tropical Forest Soil | ENRETIERFGHVRVIGEIPKLPNLHRTALMQIFMNHFDRAAFAQ* |
| Ga0126378_125713441 | 3300010361 | Tropical Forest Soil | GVVLIGDQNRENRETIERFGHVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0126378_127547782 | 3300010361 | Tropical Forest Soil | ETIERFGHVRVIGEIPKLPNLHRTALMQTFLNHFDRAAFAQ* |
| Ga0126381_1024774872 | 3300010376 | Tropical Forest Soil | VVLIGDQNRENRDTIEKFGHVRVIGEVPKLPNLHRTALMQVFLNHFDRSAFAQ* |
| Ga0136449_1022225941 | 3300010379 | Peatlands Soil | TIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ* |
| Ga0150983_157733102 | 3300011120 | Forest Soil | DQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0137392_101603774 | 3300011269 | Vadose Zone Soil | LIGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137392_111673522 | 3300011269 | Vadose Zone Soil | ERFGHVRVIGEVPRLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137391_104449783 | 3300011270 | Vadose Zone Soil | WHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137391_109139581 | 3300011270 | Vadose Zone Soil | ETIERFGHVRVIGEIPRLPNLHRTALMQVFMTHFDRAAFAQ* |
| Ga0137391_110070141 | 3300011270 | Vadose Zone Soil | HVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137393_113739531 | 3300011271 | Vadose Zone Soil | ENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137393_114399522 | 3300011271 | Vadose Zone Soil | RETIERFGHVRVIGEIPKLPNLHRTALMQIFMNHFDRAAFAQ* |
| Ga0137389_101143991 | 3300012096 | Vadose Zone Soil | ETIERFGHVRVIGEIPRLPNLHRTALMQVFLNHFDRAAFAQ* |
| Ga0137389_112153031 | 3300012096 | Vadose Zone Soil | TIERFGHVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0137389_113132712 | 3300012096 | Vadose Zone Soil | VVLIGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0137388_102226381 | 3300012189 | Vadose Zone Soil | NRETIERFGHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ* |
| Ga0137388_102251283 | 3300012189 | Vadose Zone Soil | GHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ* |
| Ga0137388_103709253 | 3300012189 | Vadose Zone Soil | IGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137388_106001623 | 3300012189 | Vadose Zone Soil | RETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137382_102652781 | 3300012200 | Vadose Zone Soil | HVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0137363_112296522 | 3300012202 | Vadose Zone Soil | FGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137399_107965182 | 3300012203 | Vadose Zone Soil | VHGVVLIGDQNRENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ* |
| Ga0137399_111145871 | 3300012203 | Vadose Zone Soil | QNRENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ* |
| Ga0137399_117091521 | 3300012203 | Vadose Zone Soil | RFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0137362_111079681 | 3300012205 | Vadose Zone Soil | RFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137362_112946561 | 3300012205 | Vadose Zone Soil | RETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0137379_101184231 | 3300012209 | Vadose Zone Soil | NRETIERFGHVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0137379_110921642 | 3300012209 | Vadose Zone Soil | RFGHVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0137378_110723332 | 3300012210 | Vadose Zone Soil | FGHVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0137378_116624181 | 3300012210 | Vadose Zone Soil | RENRETIERFGHVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0137377_108255851 | 3300012211 | Vadose Zone Soil | IERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137370_108506842 | 3300012285 | Vadose Zone Soil | GDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137386_106484491 | 3300012351 | Vadose Zone Soil | RENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0137384_108637471 | 3300012357 | Vadose Zone Soil | QNRENRETIERFGHVRVIGEVPRLPNLHRTALMQVFLNHFDRAAFSQ* |
| Ga0137360_101172913 | 3300012361 | Vadose Zone Soil | RENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137360_103922753 | 3300012361 | Vadose Zone Soil | RLWHVQVIGEIPKLPNLHLTALMQVFMNHFDRAAFAQ* |
| Ga0137390_106076253 | 3300012363 | Vadose Zone Soil | ERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137396_100454261 | 3300012918 | Vadose Zone Soil | RETIERFGHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ* |
| Ga0137419_118833501 | 3300012925 | Vadose Zone Soil | NRETIERFGHVRVIGEIPKLPNLHRTALMQVFMSHFDRAAFSQ* |
| Ga0126369_105817451 | 3300012971 | Tropical Forest Soil | ETIERFGHVRVIGEIPKLPNLHRTALMQTFMNHFDRAAFAQ* |
| Ga0137414_12639823 | 3300015051 | Vadose Zone Soil | HGVVLIGDQNRENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ* |
| Ga0137405_10396362 | 3300015053 | Vadose Zone Soil | ETIERFGHVRVIGEVPRLPNLHRTALMQVFLNHFDRAAFSQ* |
| Ga0137405_12603841 | 3300015053 | Vadose Zone Soil | NRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ* |
| Ga0137420_11527813 | 3300015054 | Vadose Zone Soil | FGHVRVIGELPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0167638_10204901 | 3300015197 | Glacier Forefield Soil | NRENRETIERFGHVRVIGEIPRLPNLHRTSLMQVFMNHFDRAAFSQ* |
| Ga0137409_103686611 | 3300015245 | Vadose Zone Soil | VLIGEQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ* |
| Ga0182036_107116261 | 3300016270 | Soil | RDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0182034_101271553 | 3300016371 | Soil | GDQNRENRDTIEKFGHVRVIGEIPKLPNIHRTALMQVFLNHFDRSAFAQ |
| Ga0182040_102773712 | 3300016387 | Soil | ETVERFGHVRVIGEIPRLPNLHRTALMQVFMNHFDRSAFSQ |
| Ga0182039_102926783 | 3300016422 | Soil | RENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0187786_101101972 | 3300017944 | Tropical Peatland | RENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0187778_100770981 | 3300017961 | Tropical Peatland | GVVLIGDQNRENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0187778_103841081 | 3300017961 | Tropical Peatland | ETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ |
| Ga0187776_100845273 | 3300017966 | Tropical Peatland | RENRETIEKFGHVRVIGEIPRLPNLHRTALMQVFLNHFDRSAFSQ |
| Ga0187780_100638994 | 3300017973 | Tropical Peatland | VVLIGDQNRENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0187804_103610832 | 3300018006 | Freshwater Sediment | RENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFSQ |
| Ga0187881_100249791 | 3300018024 | Peatland | ENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFSQ |
| Ga0187766_112893971 | 3300018058 | Tropical Peatland | ERFGHVRVIGEIPRLPNLHRTALMQVFMNNFDRAAFAQ |
| Ga0187774_109835552 | 3300018089 | Tropical Peatland | LIGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0066655_103879292 | 3300018431 | Grasslands Soil | DQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0066667_113160142 | 3300018433 | Grasslands Soil | RFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0193735_11300611 | 3300020006 | Soil | IGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0179594_104046402 | 3300020170 | Vadose Zone Soil | RFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ |
| Ga0179592_100106876 | 3300020199 | Vadose Zone Soil | IGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ |
| Ga0179592_100572791 | 3300020199 | Vadose Zone Soil | VVLIGEQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ |
| Ga0179592_103010162 | 3300020199 | Vadose Zone Soil | ENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ |
| Ga0210407_101021234 | 3300020579 | Soil | FGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0210407_105346872 | 3300020579 | Soil | TIERFGHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ |
| Ga0210407_106432241 | 3300020579 | Soil | ERFGHVRVIGEIPRLPNLHRTALMQIFMNHFDRAAFSQ |
| Ga0210407_112770352 | 3300020579 | Soil | NRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0210403_107712851 | 3300020580 | Soil | FGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0210403_109176271 | 3300020580 | Soil | GHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0210399_112623751 | 3300020581 | Soil | VVMIGDQNRENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0210399_115788492 | 3300020581 | Soil | GHVRVIGEIPRLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0210395_111232411 | 3300020582 | Soil | ETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0210401_109046412 | 3300020583 | Soil | IGDQNRENRETVEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0210404_104366892 | 3300021088 | Soil | VLIGDQNRENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0210404_104369352 | 3300021088 | Soil | GHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ |
| Ga0210406_106542841 | 3300021168 | Soil | QNRENRDTIEKFGHVRVIGEVPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0210406_112608042 | 3300021168 | Soil | TIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0210400_112050452 | 3300021170 | Soil | NRENRETIERFGHVRVIGEIPKLPNLHRTALMQTFMNHFDRAAFAQ |
| Ga0210408_102650331 | 3300021178 | Soil | RFGHVRVIGEIPKLPNLHRTALMQTFMNHFDRAAFAQ |
| Ga0210408_104776082 | 3300021178 | Soil | QNRENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMNNFDRAAFAQ |
| Ga0210396_108049772 | 3300021180 | Soil | ETIEKFGHVRVIGEIPRLPNLHRTALMQIFMNHFDRAAFAQ |
| Ga0210396_110658742 | 3300021180 | Soil | IGDQNRENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0210387_113297501 | 3300021405 | Soil | EKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0210394_100624535 | 3300021420 | Soil | ETIEKFGHVRVIGEIPKLPNLHRTSLMQVFLNHFDRSAFAQ |
| Ga0210394_105037731 | 3300021420 | Soil | NRENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMNNFDRAAFAQ |
| Ga0210394_107194162 | 3300021420 | Soil | QNRENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0210394_107699542 | 3300021420 | Soil | GDQNRENRDTVEKFGHVRVIGEIPRLPNLHRTALMQVFLNHFDRSAFSQ |
| Ga0210410_105407212 | 3300021479 | Soil | ETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0210410_118320942 | 3300021479 | Soil | RETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0210409_100501615 | 3300021559 | Soil | ENRETLERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ |
| Ga0126371_106593302 | 3300021560 | Tropical Forest Soil | ENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0126371_130191401 | 3300021560 | Tropical Forest Soil | NRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0247666_10235841 | 3300024323 | Soil | QNRENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMNHFDRAAFSQ |
| Ga0208687_10114504 | 3300025469 | Peatland | IEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFSQ |
| Ga0208819_10111544 | 3300025498 | Peatland | EKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFSQ |
| Ga0207642_102056722 | 3300025899 | Miscanthus Rhizosphere | RFGHVRVIGEIPRLPNLHRTALMQVFMNNFDRAAFAQ |
| Ga0207685_108369422 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RENRDTIEKFGHVRVIGEVPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0207699_108901782 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMNNFDRAAFAQ |
| Ga0207646_109141262 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | QNRENRETIERFGHVRVIGEVPRLPNLHRTALMQVFLNHFDRSAFSQ |
| Ga0209240_10046991 | 3300026304 | Grasslands Soil | ETIERFGHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ |
| Ga0209154_13081671 | 3300026317 | Soil | VVLIGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0209158_10514833 | 3300026333 | Soil | TIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0209377_13374731 | 3300026334 | Soil | LIGDQNRENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0257171_10478082 | 3300026377 | Soil | DQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ |
| Ga0257156_11251921 | 3300026498 | Soil | IEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0257168_10673441 | 3300026514 | Soil | IERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ |
| Ga0209056_105710062 | 3300026538 | Soil | TIERFGHVRVIGEVPRLTNLHRTALIQVFMNHFDRSAFAQ |
| Ga0209156_100327424 | 3300026547 | Soil | RENRETIERFGHVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0179587_100971031 | 3300026557 | Vadose Zone Soil | GVVLIGEQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ |
| Ga0179587_104345621 | 3300026557 | Vadose Zone Soil | HGVVLIGDQNRENRETIERFAHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0207859_10078754 | 3300026859 | Tropical Forest Soil | IGDQNRENRDTIEKFGHVRVIGEIPKLPNIHRTALMQVFLNHFDRSAFAQ |
| Ga0207758_10153953 | 3300026895 | Tropical Forest Soil | NRENRDTIEKFGHVRVIGEIPKLPNIHRTALMQVFLNHFDRSAFAQ |
| Ga0207855_10617211 | 3300027039 | Tropical Forest Soil | VVMIGDQNRENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0207726_10200412 | 3300027045 | Tropical Forest Soil | IGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0208241_10527591 | 3300027297 | Forest Soil | RETIEKFGHVRVIGEIPRLPNLHRTALMQIFMNHFDRAAFSQ |
| Ga0209735_10014351 | 3300027562 | Forest Soil | RFGHVRVIGEIPRLPNLHRTSLMQVFMNNFDRAAFSQ |
| Ga0209076_10050391 | 3300027643 | Vadose Zone Soil | TIERFGHVRVIGELPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0208565_11102091 | 3300027662 | Peatlands Soil | IGDQNRENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFSQ |
| Ga0207862_11242772 | 3300027703 | Tropical Forest Soil | DQNRENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0209811_101150862 | 3300027821 | Surface Soil | RFGHVRVIGEVPRLPNLHRTALMQVFMNHFDRAAFSQ |
| Ga0209693_105576872 | 3300027855 | Soil | TIERFGHVRVIGEIPRLPNLHRTALMQIFMNHFDRAAFSQ |
| Ga0209166_101090593 | 3300027857 | Surface Soil | ERFGHVRVIGEIPRLPNLHRTALMQVFMSHFDRAAFSQ |
| Ga0209701_102175393 | 3300027862 | Vadose Zone Soil | FGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ |
| Ga0209701_106408592 | 3300027862 | Vadose Zone Soil | RFGHVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0209283_104313721 | 3300027875 | Vadose Zone Soil | FGHVRVIGEVPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0209488_105438171 | 3300027903 | Vadose Zone Soil | RETIERFGHVRVIGEIPRLPNLHRTALMQVFMTHFDRAAFAQ |
| Ga0247662_10286831 | 3300028293 | Soil | QNRENRETVERFGHVRVIGEVPRLPNLHRTSLMQVFMNHFDRSAFSQ |
| Ga0137415_107857012 | 3300028536 | Vadose Zone Soil | ERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0308309_110116081 | 3300028906 | Soil | APTRTENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMNNFDRAAFAQ |
| Ga0075404_111760171 | 3300030842 | Soil | QNRENRETIERFGHVRVIGEIPRLPNLHRTALMQVFMNNFDRAAFSQ |
| Ga0265760_102011742 | 3300031090 | Soil | VHGVVLIGDQNRENRDTIEKFGHVRVIGEVPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0170823_144059301 | 3300031128 | Forest Soil | KFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0170824_1205670181 | 3300031231 | Forest Soil | ERFGHVRVIGEVPRLPNLHRTALMQVFLNHFDRAAFSQ |
| Ga0170819_174567172 | 3300031469 | Forest Soil | GDQNRENRDTIEKFGHVRVIGEVPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0318571_102387801 | 3300031549 | Soil | VLIGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0318528_100576901 | 3300031561 | Soil | NRENRETVERFGHVRVIGEIPRLPNLHRTALMQVFMNHFDRSAFSQ |
| Ga0307474_102172451 | 3300031718 | Hardwood Forest Soil | ETIERFGHVRVIGEIPRLPNLHRTALMQVFLNHFDRAAFAQ |
| Ga0306917_115248231 | 3300031719 | Soil | GDQNRENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0307468_1008267932 | 3300031740 | Hardwood Forest Soil | FGHVRVIGEIPRLPNLHRTALMQVFMNYFDRSAFSQ |
| Ga0307475_115171671 | 3300031754 | Hardwood Forest Soil | EQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0318509_107996391 | 3300031768 | Soil | FGHVRVIGEIPKLPNIHRTALMQVFLNHFDRSAFAQ |
| Ga0318576_102834602 | 3300031796 | Soil | QNRENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0318517_105394011 | 3300031835 | Soil | NRETVERFGHVRVIGEIPRLPNLHRTALMQVFMNHFDRSAFSQ |
| Ga0318512_100545591 | 3300031846 | Soil | IGDQNRENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0318527_105183181 | 3300031859 | Soil | MIGDQNRENRDTIEKFGHVRVIGEIPKLPNIHRTALMQVFLNHFDRSAFAQ |
| Ga0318520_105065331 | 3300031897 | Soil | GHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0306921_114245391 | 3300031912 | Soil | VHGVVLIGDQNRENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0310912_106440491 | 3300031941 | Soil | ETIERFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0310916_112183712 | 3300031942 | Soil | RETIERFGHVRVIGEIPKLPNLHRTSLMQTFMNHFDRAAFAQ |
| Ga0310909_106596253 | 3300031947 | Soil | RDTIEKFGHVRVIGEIPKLPNIHRTALMQVFLNHFDRSAFAQ |
| Ga0307479_103181331 | 3300031962 | Hardwood Forest Soil | AELPVYGVVMIGDQNRENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0307479_104131551 | 3300031962 | Hardwood Forest Soil | GVVLIGVQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0318549_105848531 | 3300032041 | Soil | ENRETVERFGHVRVIGEIPRLPNLHRTALMQVFMNHFDRSAFSQ |
| Ga0318533_107782051 | 3300032059 | Soil | DTNDKYGHVRVIGEIPKLPNIHRTALMQVFLNHFDRSAFAQ |
| Ga0318577_104821961 | 3300032091 | Soil | DQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0307470_106733042 | 3300032174 | Hardwood Forest Soil | GHVRVIGEIPRLPNLHRTALMQVFMNNFDRAAFAQ |
| Ga0307471_1015930422 | 3300032180 | Hardwood Forest Soil | GHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFSQ |
| Ga0307471_1022393431 | 3300032180 | Hardwood Forest Soil | GVVLIGDQNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFMNHFDRAAFAQ |
| Ga0307471_1024089891 | 3300032180 | Hardwood Forest Soil | GHVRVIGEVPRLPNLHRTALIQVFMNHFDRAAFAQ |
| Ga0307471_1031644352 | 3300032180 | Hardwood Forest Soil | RFGHVRVIGEIPRLPNLHRTALMQVFMSHFDRGAFSQ |
| Ga0307471_1038237702 | 3300032180 | Hardwood Forest Soil | GVVLIGDQNRENRETIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0307472_1004082162 | 3300032205 | Hardwood Forest Soil | GHVRVIGEIPRLPNLHRTALMQVFMNYFDRSAFSQ |
| Ga0307472_1019992262 | 3300032205 | Hardwood Forest Soil | ETIERFGHVRVIGEIPRLPNLHRTALMQVFMNNFDRAAFAQ |
| Ga0335078_115399021 | 3300032805 | Soil | NRENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0335083_103358611 | 3300032954 | Soil | HGVVLIGDQNRENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0335083_103814172 | 3300032954 | Soil | QNRENRETIERFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0335077_111528431 | 3300033158 | Soil | ENRDTVEKFGHVRVIGEVPKLPNLHRTALMQVFLNHFDRSAFAQ |
| Ga0310914_115091982 | 3300033289 | Soil | NRETIERFGHVRVIGEIPKLPNLHRTSLMQTFMNHFDRAAFAQ |
| Ga0326728_103064541 | 3300033402 | Peat Soil | LIGDQNRENRDTIEKFGHVRVIGEIPKLPNLHRTALMQVFLNHFDRSAFAQ |
| ⦗Top⦘ |