 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F017723 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 239 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MNRNEQQMYKDISDLTKALTRLVKLLEKLAKQQL |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 239 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 30.96 % |
| % of genes near scaffold ends (potentially truncated) | 17.15 % |
| % of genes from short scaffolds (< 2000 bps) | 86.19 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.803 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (61.088 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.703 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.305 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 239 Family Scaffolds |
|---|---|---|
| PF14743 | DNA_ligase_OB_2 | 17.57 |
| PF03013 | Pyr_excise | 12.97 |
| PF01068 | DNA_ligase_A_M | 10.46 |
| PF04404 | ERF | 3.35 |
| PF04542 | Sigma70_r2 | 1.26 |
| PF08279 | HTH_11 | 0.84 |
| PF12684 | DUF3799 | 0.84 |
| PF10250 | O-FucT | 0.42 |
| PF03951 | Gln-synt_N | 0.42 |
| PF03819 | MazG | 0.42 |
| PF04545 | Sigma70_r4 | 0.42 |
| PF00777 | Glyco_transf_29 | 0.42 |
| PF00462 | Glutaredoxin | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 239 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 10.46 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 10.46 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.26 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.26 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.26 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.26 |
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.80 % |
| All Organisms | root | All Organisms | 27.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 61.09% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 9.62% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.44% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.60% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 3.77% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.93% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.09% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.67% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 1.26% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.84% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.84% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.84% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.84% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.42% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.42% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.42% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.42% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.42% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.42% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.42% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.42% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.42% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001829 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM55, ROCA_DNA132_0.2um_27g | Environmental | Open in IMG/M |
| 3300001973 | Marine microbial communities from Bermuda, Atlantic Ocean - GS001 | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002033 | Marine microbial communities from the Sargasso Sea - GS000a &b | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300002145 | S2t7BSb (114f) | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300014818 | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0152 : 8 days incubation | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300019146 | Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5 | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100556382 | 3300000115 | Marine | MNRNEQQMYKDISDLTKALTKLTKLIEKVIKQQQ* |
| DelMOSpr2010_100468092 | 3300000116 | Marine | MNKNEQQMYKDISSLTKAVQRLVKLLEQMAKQQL* |
| JGI24006J15134_100169422 | 3300001450 | Marine | MNRNEQQMYKDISSLTKALLRLVKILEKMAKDQS* |
| JGI24006J15134_100500203 | 3300001450 | Marine | MTRNEQQMYKDISSLTKALERLVRILEKMAKQQL* |
| JGI24006J15134_100578164 | 3300001450 | Marine | MNKLEQQMYRDISSLTKALLRLVKILEKMAKDQS* |
| JGI24006J15134_100630363 | 3300001450 | Marine | MTKHEQEMYRDISRLTKAVEKLVKILERLAKQQND* |
| JGI24006J15134_101771532 | 3300001450 | Marine | MNRNEQQMYKDISSLTKALERLVKILEKLAKEQL* |
| JGI24006J15134_101915992 | 3300001450 | Marine | MTKYEQEMYRDISRLTKAVEKLVKILEQLAKQQND* |
| JGI24006J15134_101949612 | 3300001450 | Marine | MNRNEQQMYKDISSLTKALLRLVRILEKMAKDQS* |
| JGI24005J15628_101139723 | 3300001589 | Marine | MNRNEQQMYRDISSLTKALERLVKILEKMAKQQL* |
| ACM55_10310933 | 3300001829 | Marine Plankton | IMNRNEQQMYKDISELTKALTRLAKILEKLMKQQYE* |
| GOS2217_101468986 | 3300001973 | Marine | MNRNEQQMYKDISDLTKALTRLVKLLEKLAKQQL* |
| GOS2246_101427261 | 3300001974 | Marine | LNVLEIMNRNEQQMYKDISALTKALEKLVKILTKLAKEQS* |
| GOS24894_101036886 | 3300002033 | Marine | MSRNEQQMYKDISELTKALTRLAKILEKILKQQHE* |
| GOScombined01_1022734436 | 3300002040 | Marine | MNRNEQQMYKDISDLTKSINRLVKLLEKIIKQQHE* |
| S2t7BSb_100797512 | 3300002145 | Marine | MNRNEQQMYEDISRLTKAVERLVKLLEKLAQQQS* |
| S2t7BSb_102588262 | 3300002145 | Marine | MNRNEQQMYEDISRLTKAVERLVKLIEQMAKEELKNNDRRPN* |
| S2t7BSb_104016812 | 3300002145 | Marine | MNRNEQQMYDDISRLTKAVERLVKLLEKLAQQQS* |
| KVRMV2_1003643672 | 3300002231 | Marine Sediment | MNRNEQQMYKDISDLTKALTKLVKILEKMAKEQL* |
| KVWGV2_102358863 | 3300002242 | Marine Sediment | MSRNEQQMYKDISDLTKALTRLVKLLEKLAKHQL* |
| Ga0066862_102890583 | 3300005521 | Marine | MSRNEQQMYRDISSLTKALERLVKVLEKLAKEQL* |
| Ga0078746_10204723 | 3300005821 | Marine Sediment | MTKHEQEMYRDISRLTKAVEKLVKILEQLAKQQND* |
| Ga0075441_101948482 | 3300006164 | Marine | MNRNEQQMYRDISSLTKALERLVKILEKLAKEQL* |
| Ga0075447_100994374 | 3300006191 | Marine | MNRNEQQMYKDISSLTKAVQRLVKLLEKLAKDQL* |
| Ga0098038_100085614 | 3300006735 | Marine | MNRNQQQMYKDISDLTKALTKLVKVIEKLAKQQL* |
| Ga0098038_100299916 | 3300006735 | Marine | MNKNEQQMYRDISELTKALTKLVKVIEKIAKQQQ* |
| Ga0098038_10084815 | 3300006735 | Marine | MNRNEQQMYKDISALTKALERLVKILEKMAKQQL* |
| Ga0098038_10092102 | 3300006735 | Marine | MNRNEQQMYKDISDLTKALTKLVKIIEKLAKQQL* |
| Ga0098038_10127828 | 3300006735 | Marine | MTRTQQQMYKDISDLTKALTKLVKVIEKLAKEQQQ* |
| Ga0098038_10206766 | 3300006735 | Marine | MNKNEQQMYRDISSLTKALEKLVKVIEQLAKKQL* |
| Ga0098038_10228703 | 3300006735 | Marine | MNKNEQQMYKDISSLTKALEKLVRVLTKLAKDQQ* |
| Ga0098038_10286724 | 3300006735 | Marine | MNRNEQQMYKDISDLTKALTKLVKILEKMAKQQL* |
| Ga0098038_10327622 | 3300006735 | Marine | MTRNEQQMYKDISQLTKAVTKLVKVLEKIIKEQNGR* |
| Ga0098038_10484143 | 3300006735 | Marine | MTRNEQQLYKDISELTKSLTRLAKILEKLAKSQL* |
| Ga0098038_10502051 | 3300006735 | Marine | EIMNRNEQQMYKDISSLTKALTKLVKILEKMAKQQL* |
| Ga0098038_10917952 | 3300006735 | Marine | MNRNQQQMYKDISDLTKALTKLAKIIEKLAKQQL* |
| Ga0098038_10999132 | 3300006735 | Marine | MTRNQQQMYKDISDLTKALTKLVKVIEKLAKQQQ* |
| Ga0098038_11039602 | 3300006735 | Marine | MTRNQQQMYKDISDLTKALTKLVKVIEKLAKEQQQ* |
| Ga0098038_11375203 | 3300006735 | Marine | MNRNQQQMYKDISDLTKALTKLVKILEKMAKQQL* |
| Ga0098038_11454232 | 3300006735 | Marine | MNRNEQQMYKDISSLTKALTKLVKILEKMAKQQL* |
| Ga0098038_11568833 | 3300006735 | Marine | MNRNEQQMYKDISNLTKALTKLVKVIEKLAKEQQL* |
| Ga0098038_11607672 | 3300006735 | Marine | MNRNEQQMYKDISALTKALEKLVKILTKLAKEQS* |
| Ga0098038_11785922 | 3300006735 | Marine | MTRNEQQMYKDISELTKALTKLVKVIEKLAKQQN* |
| Ga0098038_12354872 | 3300006735 | Marine | MNRNEQQMYKDISSLTKALERLVKVLEKIIKEQNS* |
| Ga0098037_10905392 | 3300006737 | Marine | MNRNEQQFYKDISQLTKAITKLVKVLEKIIKDQQ* |
| Ga0098037_11283322 | 3300006737 | Marine | MNKNEQQMYKDISALTKALEKLVKILTKLAKEQS* |
| Ga0098037_12028272 | 3300006737 | Marine | MTRNEQKMYKDISDLTKALTKLVKIIEKLAKQQL* |
| Ga0098037_12913631 | 3300006737 | Marine | MNRNEQQMYKDISNLTKALTKLVKVIEKLAKDQQL* |
| Ga0098035_10851682 | 3300006738 | Marine | MNRNEQQMYRDISSLTKALERLVKVLEKLAKEQL* |
| Ga0098042_100314918 | 3300006749 | Marine | MNRNQQQMYKDISDLTKALTRLVKVIEKLAKQQQ* |
| Ga0098042_10140552 | 3300006749 | Marine | MNRNEQQMYKDISDLTKALTRLVKLLEKMAKQQQ* |
| Ga0098042_10192542 | 3300006749 | Marine | MTRNEQQMYKDISDLTKSINRLVKLLEKIIKQQHE* |
| Ga0098042_10295503 | 3300006749 | Marine | MTRSQQQMYKDISDLTKALTKLVKVIEKLAKAQQ* |
| Ga0098042_11343111 | 3300006749 | Marine | MTRNQQQMYKDISDLTKALTKLVKVIEKLAKQQL* |
| Ga0098058_10664222 | 3300006750 | Marine | MNKNEQQMYRDISSLTKALERLVKVMEQLAKKQL* |
| Ga0098040_11442482 | 3300006751 | Marine | MNRNEQQMYKDISSLTKALERLVKVLEKLAKEQL* |
| Ga0098040_11862502 | 3300006751 | Marine | MTRNEQQMYKDISDLTKALTKLVKILEKMAKQQL* |
| Ga0098048_10091397 | 3300006752 | Marine | MNKNQQQMYSDISELTKAITKLIKTLEKIIKASG* |
| Ga0098048_10638402 | 3300006752 | Marine | MTKYEQEMYRDISQLTKAVEKLVKLLTKIAKEQND* |
| Ga0098048_10769043 | 3300006752 | Marine | YLNVLEIMNRNEQQMYKDISDLTKALTRLVKLLEKQIKQ* |
| Ga0098048_10874762 | 3300006752 | Marine | MNKNEQQMYRDISSLTKALERLVKILEKLAKEQL* |
| Ga0098048_11106542 | 3300006752 | Marine | MNRNEQQMYRDISSLTKALERLVKVIEQLAKKQL* |
| Ga0098048_11620723 | 3300006752 | Marine | MTRNEQQMYRDISSLTKALERLVKILEKLAKEQL* |
| Ga0098048_12625002 | 3300006752 | Marine | MTRNQQQMYKDISELTKALTKLVRVMEKLAKAQQ* |
| Ga0098039_12226673 | 3300006753 | Marine | MTKYEQEMYRDISRLTKAVEKLVKILEQLAKEQS* |
| Ga0098044_11494552 | 3300006754 | Marine | MTRNEQQMYRDISSLTKALEQLVKVLTKLAKEQS* |
| Ga0098044_12805031 | 3300006754 | Marine | IRIMNRNQQQMYKDISELTKALTKLVRIMEKLAKQQQ* |
| Ga0098044_14051882 | 3300006754 | Marine | MNRNEQQMYKDISALTKALERLVKILEKMAKQQL*QENNLK* |
| Ga0098054_10084524 | 3300006789 | Marine | MNRNEQQMYKDISNLTTALTKLVKLMEKIIKYQENIK* |
| Ga0098054_11423532 | 3300006789 | Marine | MNRNEQQMYKDISQLTKALTKLTKLVEKIIKQQEAE* |
| Ga0098054_12517252 | 3300006789 | Marine | MTKNEQQMYKDISSLTKAVQRLVKLLEKLIKDNA* |
| Ga0098054_13672112 | 3300006789 | Marine | MNKNEQQMYKDISELTKALTKLVRVMEKLAKAQQ* |
| Ga0098055_10751665 | 3300006793 | Marine | MTKNEQQMYKDISSLTKALERLVKILEKLAKEQL* |
| Ga0098055_11513562 | 3300006793 | Marine | MTRNEQQMYKDISDLTKALTRLVKLLEKMAKQQQ* |
| Ga0098055_11787703 | 3300006793 | Marine | MNRNEQQMYKDISNLTKALTKLVKIMEKIIKQQENL* |
| Ga0098055_11798383 | 3300006793 | Marine | MTRNEQQMYKDISQLTKALTKLAKLVEKIIKQQEGV* |
| Ga0098055_12272723 | 3300006793 | Marine | MTRNEQQMYKDISNLTKALTKLAKLVEKIIKQQEGV* |
| Ga0070750_100179094 | 3300006916 | Aqueous | MNKNEQQMYRDISELTKSLTRLAKILEKLAKSQL* |
| Ga0070750_100263634 | 3300006916 | Aqueous | MTRNEQQMYKDISDLTKALTRLVKLLEKQIKHDR* |
| Ga0070750_101440061 | 3300006916 | Aqueous | MNRNEQQMYKDISALTKALEKLVKILTKLAKEQS*IKLNF |
| Ga0070750_103375772 | 3300006916 | Aqueous | MNRNQQQMYKDISDLTKALTKLVKVIEKLAKQQQL* |
| Ga0070746_101383074 | 3300006919 | Aqueous | MNRNQQQMYMDISDLTKALTKLVKVIEKLAKQQYE* |
| Ga0070746_103794613 | 3300006919 | Aqueous | MNRNEQQMYKDISELTKALTRLAKILEKIIKQQHE* |
| Ga0098060_10120122 | 3300006921 | Marine | MNRNEQQMYKDISSLTKALTKLVKVIEKLAKQQQI* |
| Ga0098060_11448662 | 3300006921 | Marine | LNVYEIMNRNEQQMYKDISDLTKALTKLVKILEKMAKQQL* |
| Ga0098060_11524633 | 3300006921 | Marine | MNRNEQQMYKDISNLTKALTKLVKVREKLAKEQQL* |
| Ga0098060_11626412 | 3300006921 | Marine | MNRNEQQMYRDISSLTKALERLIKVIEQLAKKQL* |
| Ga0098045_10258632 | 3300006922 | Marine | MNRNQQQMYKDISDLTKALTKLVKVIEKLAKEQQQ* |
| Ga0098053_10885782 | 3300006923 | Marine | MNRNEQQLYKDISSLTKALERLVKVLEKLAKEQL* |
| Ga0098051_11205263 | 3300006924 | Marine | MTRNEQQMYKDISSLTKALERLVKVLEQLAKEQL* |
| Ga0098051_11786022 | 3300006924 | Marine | MNRNQQQMYKDISELTKALTKLVRIMEKLAKQQQ* |
| Ga0098050_10815594 | 3300006925 | Marine | MNRNEQQMYKDISSLTKALERLVRILEKMAKQQL* |
| Ga0098050_11751142 | 3300006925 | Marine | MNSKVMNKNEQQMYRDISSLTKALERLVKVMEQLAKKQL* |
| Ga0098041_100696112 | 3300006928 | Marine | MNRNQQQMYKDISELTKAITKLVKTLEKIIKYQASE* |
| Ga0098041_10532243 | 3300006928 | Marine | MNKNEQQMYKDISELTKAITKLVKILEKIIKYQASE* |
| Ga0098041_10581333 | 3300006928 | Marine | MTRNQQQMYKDISDLTKALTKLVKVIEKLAKQQHD* |
| Ga0098041_10586172 | 3300006928 | Marine | MNRNEQQMYKDISALTKALERLVKVLTKLAKEQL* |
| Ga0098041_10928782 | 3300006928 | Marine | MNKNEQQMYRDISDLTKALTKLVKVLEKIVKVSG* |
| Ga0098041_11676141 | 3300006928 | Marine | YLNAYVTMNRNEQQLYKDISQLTKAITKLVKVLEKIIKDQQ* |
| Ga0098041_12895582 | 3300006928 | Marine | MNRNEQQMYKDISDLTKALTKLVKVIEKLAKQQV* |
| Ga0098036_10629352 | 3300006929 | Marine | MNRNEQQMYKDISALTKAIERLVKVLTKLAKEQL* |
| Ga0098036_10894582 | 3300006929 | Marine | MNKNEQQMYRDISSLTKALERLVKVIEQLAKKQL* |
| Ga0098036_11457793 | 3300006929 | Marine | MNRNQQQMYKDISDLTKALTKLVKVIEKLAKAQQ* |
| Ga0098036_12164982 | 3300006929 | Marine | MNRNQQQMYKDISDLTKALTKLVKVIEKLAKQQV* |
| Ga0098036_12501351 | 3300006929 | Marine | IMNRNEQQMYKDISDLTKALTKLVKILEKMAKQQL* |
| Ga0098046_10416714 | 3300006990 | Marine | MNRNEQQMYKDISNLTKALTKLVKVIEKLAKEQQQ* |
| Ga0070747_10848472 | 3300007276 | Aqueous | MNKNQQQMYSDISELTKAITKLIKTLEKIIKATGQ* |
| Ga0099847_10305144 | 3300007540 | Aqueous | MSKNQQQMYSDISELTKAITKLIKTLEKIIKYQAND* |
| Ga0105744_10400932 | 3300007863 | Estuary Water | MNRNEQQMYKDISDLTKALTKLVKLLEKMAKQQL* |
| Ga0110931_10806233 | 3300007963 | Marine | MNRNEQQMYKDISDLTKALTKLVKVLEKIIKYQQ* |
| Ga0105748_103883273 | 3300007992 | Estuary Water | MTKYEQKMYEDISTIAKALTKLIKLIEKDMKR*IYF |
| Ga0098052_11633722 | 3300008050 | Marine | MSKNEQQMYKDISAIAKALTKLVRMIEKEMKQQRL* |
| Ga0098052_12151061 | 3300008050 | Marine | VFFKEIRIMNRNEQQMYKDISALTKALERLVKILEKMAKQQL* |
| Ga0098052_12670693 | 3300008050 | Marine | MTRNEQQMYKDISQLTKALTKLAKLVEKIIKQQEGYDR* |
| Ga0098052_13607292 | 3300008050 | Marine | MNRNEQQMYRDISSLTKALERLVKILEKLAKEQL*VK |
| Ga0114899_10106007 | 3300008217 | Deep Ocean | MNRNEQQMYKDISDLTKALTKLVKVIEKMAKQQL* |
| Ga0114899_10411914 | 3300008217 | Deep Ocean | MNKNEQQMYRDISRLTKAVERLVKILEKLAKAQS* |
| Ga0114899_11135331 | 3300008217 | Deep Ocean | MNKNEQQMYKDISNLTKALERLVKILEKLAKEQL* |
| Ga0114899_11413552 | 3300008217 | Deep Ocean | MNRNEQQMYKDISSLTRALERLVKVLEQMAKAQL* |
| Ga0114904_10061786 | 3300008218 | Deep Ocean | MNRNEQQMYKDISSLTRALERLVKVLEKIIKEQNS* |
| Ga0114905_10508892 | 3300008219 | Deep Ocean | MNRNQQQMYKDISDLTKALTKLVKVIEKMAKQQL* |
| Ga0114905_10821282 | 3300008219 | Deep Ocean | MNRNEQQMYRDISDLTKALTKLVKVLEKIIKYQQ* |
| Ga0114905_12153382 | 3300008219 | Deep Ocean | MNRNEQQMYKDISDLTKALTKLVKVLEKIVKYQQ* |
| Ga0114910_11533742 | 3300008220 | Deep Ocean | MNRNEQQMYKDISSLTKALERLVKILEKLAKEQS* |
| Ga0102814_103504521 | 3300009079 | Estuarine | MNRNEQQMYKDISTLTKALEKLVKILTKLAKEQL* |
| Ga0114993_104601423 | 3300009409 | Marine | MNRNDQQFYRDISDLTKAITKLVKVIEKIIKAQG* |
| Ga0114902_11074082 | 3300009413 | Deep Ocean | MNRNQQQMYKDISDLTKALTKLVKVIEKLAKQQYD* |
| Ga0114908_12264581 | 3300009418 | Deep Ocean | EIMNRNEQQMYRDISSLTKALERLVKVIEQLAKKQL* |
| Ga0114908_12305453 | 3300009418 | Deep Ocean | MTRNEQQFYKDISQLTKAITKLVKVLEKIIKEQS* |
| Ga0114994_110835322 | 3300009420 | Marine | MNVEKNLMNKNEQQMYKDISSLTKAVQRLVKLLEQMAKQQL* |
| Ga0114997_104049673 | 3300009425 | Marine | MNRLEQQMYKDISSLTKAVQRLVKILEKLAKEQNY* |
| Ga0114915_10233242 | 3300009428 | Deep Ocean | MNKNEQQMYKDISSLTKAVQRLVKLLEKLAKEQS* |
| Ga0114915_10442195 | 3300009428 | Deep Ocean | LKQCEIMNRYEQEMYKDISSLTKAVPRLVKLLEKLAKDQL* |
| Ga0114932_100826794 | 3300009481 | Deep Subsurface | MNRNEQQMYKDISDLTKALTKLVKILEKMAKKQL* |
| Ga0114932_101578113 | 3300009481 | Deep Subsurface | MNRNEQQMYKDISSLTKALERLVKILEKIAKQQL* |
| Ga0114932_105358243 | 3300009481 | Deep Subsurface | MNRNEQQMYKDISSLTKALERLVKVLEQMAKAQL* |
| Ga0114932_106105612 | 3300009481 | Deep Subsurface | MNRNEQQMYKDISDLTKALTRLVKLLEKLAKHQL* |
| Ga0115003_107846761 | 3300009512 | Marine | IMNKNEQQMYKDISSLTKAVQRLVKLLEQMAKQQL* |
| Ga0115003_108621372 | 3300009512 | Marine | LKQYEIMNKNEQQMYKDISSLTKAVQRLVKLLEQMAKQQL* |
| Ga0115011_103204632 | 3300009593 | Marine | MNRNEQQMYKDISQLTKALTKLTKLVEKIIKQQEDIK* |
| Ga0115011_109833072 | 3300009593 | Marine | MNRNEQQMYRDISDLTKALTKLVKILERLAKEQL* |
| Ga0115011_113818952 | 3300009593 | Marine | MTRNEQQMYKDISNLTKALTKLTKLIEKIIKQQEGYDR* |
| Ga0114911_11513531 | 3300009603 | Deep Ocean | YEIMNRNEQQMYKDISSLTKALEKLVKVLTKLAKDQ* |
| Ga0114911_12095032 | 3300009603 | Deep Ocean | MTRNEQQMYKDISSLTKSLEKLVKVLTQLAKKDL* |
| Ga0114901_11283372 | 3300009604 | Deep Ocean | MTRNQQQMYKDISDLTKALTKLVKVIEKLAKEQQ* |
| Ga0114901_11616721 | 3300009604 | Deep Ocean | YETMNKNEQQMYKDISSLTKALEKLVKVLTKLAKDQ* |
| Ga0114906_11872623 | 3300009605 | Deep Ocean | MTRNEQQMYKDISQLTKAVTKLVKVLEKIIKEQNS* |
| Ga0114906_12721451 | 3300009605 | Deep Ocean | MNKNEQQMYRDISRLTTAAEPLVKILEKLANPHS* |
| Ga0114906_12982372 | 3300009605 | Deep Ocean | MNKNEQQMYKDISELTKALTRLAKILEKLMKQQL* |
| Ga0114912_11285592 | 3300009620 | Deep Ocean | MTRNQQQMYKDISDLTKALTKLVKVIEKMAKQQL* |
| Ga0114933_106878052 | 3300009703 | Deep Subsurface | MNKNEQQMYRDISDLTKALTKLVKVLEKIIKYQQ* |
| Ga0115000_103287732 | 3300009705 | Marine | MNRNEQQMYKDISSLTKAVQRLVKLLEQMAKAQL* |
| Ga0115001_106214842 | 3300009785 | Marine | MNRNEQQMYKDISSLTKAVQRLVKLLEQMAKQQL* |
| Ga0115012_116878852 | 3300009790 | Marine | MNRNEQQMYRDISSLTKALEKLVKVLEKLAKEQL* |
| Ga0098043_10442482 | 3300010148 | Marine | MNRNEQQMYKDISELTKSLTRLAKILEKLAKSQL* |
| Ga0098043_11111982 | 3300010148 | Marine | MNRNEQQMYRDISDLTKALTKLVKILEKLAKEQL* |
| Ga0098043_12211372 | 3300010148 | Marine | MTRNEQQLYKDISDLTKALTKLVKVIEKLAKQQL* |
| Ga0098049_10775283 | 3300010149 | Marine | MTRNEQQMYKDISQLTKALTKLAKLVEKIIKQQEGYDK* |
| Ga0098049_10854801 | 3300010149 | Marine | MTRNQQQMYKDISALTKALTKLIKVIEKLAKAQQ* |
| Ga0098049_11875092 | 3300010149 | Marine | MNRNEQQMYKDISNLTKALTKLVKVIEKLAKAQQ* |
| Ga0098061_10142907 | 3300010151 | Marine | MTRNEQQMYKDISQLTKALTKLTKLVEKIIKQQEDIK* |
| Ga0098061_11911402 | 3300010151 | Marine | MNRNEQQMYRDISSLTKALERLVKVLEQLAKEQL* |
| Ga0098059_10167955 | 3300010153 | Marine | MNRNEQQMYKDISNLTKALTKLVKIMEKIIKQQEGV* |
| Ga0098059_10933393 | 3300010153 | Marine | MTRNEQNMYKDISDLTKALTKLIKVIEKLAKQQL* |
| Ga0098059_11674552 | 3300010153 | Marine | MNRNEQQMYRDISSLTKALEKLVKVIEQLAKKQL* |
| Ga0098059_11831543 | 3300010153 | Marine | MNKNEQQMYRDISSLTKALERLVKVLTKLAKEQS* |
| Ga0098059_12629041 | 3300010153 | Marine | MTRNEQQLYKDISSLTKALEKLVKVLTKLAKEQL* |
| Ga0098047_100671844 | 3300010155 | Marine | MTRNEQQMYKDISDLTKALTKLIKLIEKHMKYDR* |
| Ga0133547_105658315 | 3300010883 | Marine | MNRNDQQFYKDISDLTKAITKLVKVIEKIIKAQG* |
| Ga0114934_101435102 | 3300011013 | Deep Subsurface | MTRNEQQMYKDISSLTKALERLVKILEKMAKQQL* |
| Ga0114934_104632113 | 3300011013 | Deep Subsurface | VLEIMNRNEQQMYKDISDLTKALTKLVKVIEKLAKQQYD* |
| Ga0160422_108046913 | 3300012919 | Seawater | MTSNEQQMYKDISELTKSLNRLIKLLEKLAKQQLL* |
| Ga0160423_100142273 | 3300012920 | Surface Seawater | MTRNEQQMYKDISSLTKALEKLVKILTKLAKDQQ* |
| Ga0160423_100477507 | 3300012920 | Surface Seawater | MNRNEQQMYKDISDLTKALTKLVKLLEKMAKQQI* |
| Ga0160423_101622433 | 3300012920 | Surface Seawater | MTRNEQQMYKDISELTKSLNRLIKLLEKLAKQQLL* |
| Ga0163110_107188902 | 3300012928 | Surface Seawater | MNRNQQQMYKDISDLTKALTKLVKVIETLAKQDL* |
| Ga0163179_106788362 | 3300012953 | Seawater | MTRNEQQMYKDISDLTKALTKLVKLLEKMAKQQL* |
| Ga0163111_123049102 | 3300012954 | Surface Seawater | MTRNEQQMYKDISDLTKALTRLVKLLEKLAKHQL* |
| Ga0134300_10383704 | 3300014818 | Marine | LETMNKNEQQMYKDISSIAKALTRLIKLIEKDMR* |
| Ga0181375_10771331 | 3300017718 | Marine | MNSKVMNKNEQQMYRDISSLTKALEQLVKVLTKLAKEQS |
| Ga0181373_10296113 | 3300017721 | Marine | MTKYEQEMYRDISRLTKSVEKLVKILEQLAKEQND |
| Ga0181417_11167111 | 3300017730 | Seawater | DYKNKQEMNRNEQQMYKDISSLTKALEKLVKVLTKLAKEQ |
| Ga0181428_11284153 | 3300017738 | Seawater | MNRNEQQMYKDISNLTKALTKLVKLMEKVIKQQENYDR |
| Ga0181433_11657301 | 3300017739 | Seawater | KEMNRKEQQMYNDISDLTKALTKLVKVLTKLAKDQ |
| Ga0181418_10224625 | 3300017740 | Seawater | MTRNEQQMYKDISNLTKALTKLAKLVEKIIKQQEGYDR |
| Ga0181399_11617071 | 3300017742 | Seawater | MNSKVMNRNEQQMYRDISSLTKALERLVKILEKLAKEQL |
| Ga0181407_11544212 | 3300017753 | Seawater | MNRNEQQMYKDISNLTKALTKLVKVLEKIVKYQAND |
| Ga0181408_11312513 | 3300017760 | Seawater | VLEIMNRNEQQLYKDISSLTKALEKLVRVLTKLAKQDL |
| Ga0181413_12687872 | 3300017765 | Seawater | HCLNVLETMNKNEQQMYQDISAIAKALTKIVKIKEKEMKR |
| Ga0187217_13050621 | 3300017770 | Seawater | NVLEIMNRNEQQMYRDISSLTKALERLVKILEKLAKEQL |
| Ga0181425_11962312 | 3300017771 | Seawater | MNRNEQQMYKDISNLTKALTKLVKVIEKLAKQQQI |
| Ga0181386_12420222 | 3300017773 | Seawater | LNVLEIMNRNQQQMYKDISDLTKALTKLVKILEKMAKQQL |
| Ga0181432_11741111 | 3300017775 | Seawater | IMNRNEQQMYRDISSLTKALERLVKILEKLAKEQL |
| Ga0181423_11912731 | 3300017781 | Seawater | IMNRNEQQMYKDISALTKALERLVKILEKMAKQQL |
| Ga0188881_100163022 | 3300019146 | Freshwater Lake | MNRNEQQMYEDISRLTKAVERLVKLIEQMAKEELKNNDRRPN |
| Ga0211617_101239623 | 3300020401 | Marine | MTSNEQQMYKDISELTKALTRLAKILEKILKQQHE |
| Ga0211472_100170406 | 3300020409 | Marine | MNRNEQQMYKDISELTKALTRLAKILEKLMKQQYE |
| Ga0211708_102700633 | 3300020436 | Marine | YLNVLEIMNRNEQQMYKDISDLTKALTKLVKILEKLAKEQL |
| Ga0206678_102432043 | 3300021084 | Seawater | MNSKVMNRYEQQMYRDISSLTKALERLVKILEKLAKEQL |
| Ga0222717_102373442 | 3300021957 | Estuarine Water | MNSKVMNRNEQQMYRDISSLTKALERLIKVIEQLAKKQL |
| Ga0212030_10160302 | 3300022053 | Aqueous | MSKNQQQMYSDISELTKAITKLIKTLEKIIKYQAND |
| Ga0209992_100567534 | 3300024344 | Deep Subsurface | MNRNQQQMYKDISDLTKALTKLVKVIEKLAKQQYD |
| Ga0209992_103621431 | 3300024344 | Deep Subsurface | HYLNVYEIMNRNEQQMYKDISSLTKALERLVKVLEQMAKAQL |
| Ga0208667_10488502 | 3300025070 | Marine | MNRNEQQMYKDISNLTKALTKLVKVIEKLAKEQQQXIYFI |
| Ga0207890_10244362 | 3300025079 | Marine | MTKHEQEMYRDISRLTKAVEKLVKILERLAKQQND |
| Ga0208791_10262753 | 3300025083 | Marine | MNRNQQQMYKDISDLTKALTKLVKVIEKLAKEQQQ |
| Ga0208157_100355512 | 3300025086 | Marine | MTRNEQQMYKDISQLTKAVTKLVKVLEKIIKEQNGR |
| Ga0208157_10070255 | 3300025086 | Marine | MTRNQQQMYKDISDLTKALTKLVKVIEKLAKEQQQ |
| Ga0208157_10458022 | 3300025086 | Marine | MTRTQQQMYKDISDLTKALTKLVKVIEKLAKEQQQ |
| Ga0208157_11002151 | 3300025086 | Marine | MNRNEQQMYKDISALTKALERLVKILEKMAKQQLXQENNLK |
| Ga0208434_10622423 | 3300025098 | Marine | MTKYEQEMYRDISQLTKAVEKLVKLLTKIAKEQND |
| Ga0208669_10076888 | 3300025099 | Marine | MNRNEQQMYKDISSLTKALTKLVKVIEKLAKQQQI |
| Ga0208669_10525672 | 3300025099 | Marine | MNRNEQQMYKDISNLTKALTKLVKIMEKIIKQQEGV |
| Ga0208669_10621191 | 3300025099 | Marine | HYLNVLEIMNRNEQQMYKDISDLTKALTKLIKLIEKQMKH |
| Ga0208013_11237041 | 3300025103 | Marine | MNRNEQQMYKDISNLTKALTKLVKIMEKIIKQQENL |
| Ga0208013_11487013 | 3300025103 | Marine | MNRNEQQMYKDISQLTKALTKLTKLVEKIIKQQEAEXQKN |
| Ga0208793_10883673 | 3300025108 | Marine | MNRNEQQMYKDISELTKAITKLVKTLEKIIKYQASE |
| Ga0208793_11340334 | 3300025108 | Marine | MTKYEQKMYEDISTIAKALTKLIKLIEKDMKRXIY |
| Ga0208158_10341683 | 3300025110 | Marine | MTRNQQQMYKDISDLTKALTKLVKVIEKLAKQQHD |
| Ga0208158_10596223 | 3300025110 | Marine | MNRNQQQMYKDISELTKAITKLVKTLEKIIKYQASE |
| Ga0208158_11432961 | 3300025110 | Marine | MNKNEQQMYKDISELTKAITKLVKILEKIIKYQASE |
| Ga0209348_10779551 | 3300025127 | Marine | MTSNEQQMYKDISELTKSLNRLIKLLEKLAKQQLL |
| Ga0208919_10966243 | 3300025128 | Marine | MNRNQQQMYKDISELTKAITKLVKILEKIIKYQASE |
| Ga0208299_100315419 | 3300025133 | Marine | MNRNEQQMYKDISNLTTALTKLVKLMEKIIKYQENIK |
| Ga0209634_11260262 | 3300025138 | Marine | MTKHEQEMYRDISRLTKALEQLVKLLTKIAKEQND |
| Ga0209645_11226194 | 3300025151 | Marine | LEIMNRNEQQMYKDISALTKALEKLVKILTKLAKEQS |
| Ga0209337_12611803 | 3300025168 | Marine | MTKYEQEMYRDISRLTKALEQLVKLLTKIAKEQND |
| Ga0208182_10306412 | 3300025251 | Deep Ocean | MNRNEQQMYKDISSLTRALERLVKVLEKIIKEQNS |
| Ga0208134_10793103 | 3300025652 | Aqueous | MTKHEQEMYRDISRLTKAVEKLVKILEQLAKQQND |
| Ga0208134_11096472 | 3300025652 | Aqueous | MNKNQQQMYSDISELTKAITKLIKTLEKIIKATGQ |
| Ga0209711_102535482 | 3300027788 | Marine | MNVEKNLMNKNEQQMYKDISSLTKAVQRLVKLLEQMAKQQL |
| Ga0209404_106695601 | 3300027906 | Marine | KVMNKNEQQMYRDISSLTKALERLVKVIEQLAKKQL |
| Ga0256382_10411281 | 3300028022 | Seawater | LNVLEIMNRNEQQMYKDISALTKALEKLVKILTKLAKEQS |
| Ga0183748_11323501 | 3300029319 | Marine | LEIMNRNEQQMYKDISDLTKALTKLVKILEKMAKQQL |
| Ga0183757_10595452 | 3300029787 | Marine | MNRNEQQMYKDISNLTKALTKLVKVIEKLAKEQQQ |
| Ga0315322_106372123 | 3300031766 | Seawater | MNSKVMNRNEQQMYKDISSLTKALERLVKVMEQLAKKQL |
| Ga0315331_109044412 | 3300031774 | Seawater | MTRNEQQMYKDISNLTKALTKLAKLVEKIIKQQEGV |
| Ga0315316_101394453 | 3300032011 | Seawater | MNKNQQQMYSDISELTKAITKLVKTLEKIIKATGQ |
| Ga0314858_064274_794_904 | 3300033742 | Sea-Ice Brine | RDMNRNDQQFYRDISDLTKAITKLVKVIEKIIKAQG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |