Basic Information | |
---|---|
Family ID | F017700 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 239 |
Average Sequence Length | 44 residues |
Representative Sequence | VSAVLTIAGYGFREAVRRKVFAVVVLLTAAFLALFWLANHYVF |
Number of Associated Samples | 203 |
Number of Associated Scaffolds | 239 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.06 % |
% of genes near scaffold ends (potentially truncated) | 98.33 % |
% of genes from short scaffolds (< 2000 bps) | 94.14 % |
Associated GOLD sequencing projects | 192 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.745 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.389 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.962 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.259 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 239 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 63.18 |
PF00583 | Acetyltransf_1 | 2.09 |
PF07992 | Pyr_redox_2 | 1.26 |
PF08734 | GYD | 1.26 |
PF03193 | RsgA_GTPase | 0.42 |
PF07452 | CHRD | 0.42 |
PF12679 | ABC2_membrane_2 | 0.42 |
PF02274 | ADI | 0.42 |
PF01048 | PNP_UDP_1 | 0.42 |
PF13508 | Acetyltransf_7 | 0.42 |
PF08543 | Phos_pyr_kin | 0.42 |
COG ID | Name | Functional Category | % Frequency in 239 Family Scaffolds |
---|---|---|---|
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.26 |
COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.42 |
COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.42 |
COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.42 |
COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.42 |
COG1162 | Ribosome biogenesis GTPase RsgA | Translation, ribosomal structure and biogenesis [J] | 0.42 |
COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 0.42 |
COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 0.42 |
COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.42 |
COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.42 |
COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
COG4874 | Uncharacterized conserved protein | Function unknown [S] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.74 % |
Unclassified | root | N/A | 1.26 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459006|GBPF9FW01EF0T8 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
2170459006|GBPF9FW02IWVKW | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
2170459008|GA8OVOZ02HVLWL | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2126487 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300000956|JGI10216J12902_100843958 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300000956|JGI10216J12902_110331399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300001205|C688J13580_1052577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300001205|C688J13580_1066338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
3300001333|A21PFW6_1083374 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300004479|Ga0062595_100831365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 766 | Open in IMG/M |
3300004480|Ga0062592_102430972 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300004643|Ga0062591_100504286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 1040 | Open in IMG/M |
3300005093|Ga0062594_102369000 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300005294|Ga0065705_10275393 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300005329|Ga0070683_100156351 | All Organisms → cellular organisms → Bacteria | 2162 | Open in IMG/M |
3300005329|Ga0070683_100878266 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300005330|Ga0070690_100377215 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300005332|Ga0066388_104612425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 701 | Open in IMG/M |
3300005336|Ga0070680_100070279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2876 | Open in IMG/M |
3300005337|Ga0070682_101826509 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300005341|Ga0070691_10243685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 961 | Open in IMG/M |
3300005353|Ga0070669_100982965 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300005356|Ga0070674_101555036 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300005364|Ga0070673_102320468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 510 | Open in IMG/M |
3300005406|Ga0070703_10520921 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300005435|Ga0070714_100014420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 6349 | Open in IMG/M |
3300005435|Ga0070714_101791163 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300005436|Ga0070713_101404898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
3300005440|Ga0070705_100427780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 987 | Open in IMG/M |
3300005447|Ga0066689_10766046 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300005458|Ga0070681_10408831 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300005458|Ga0070681_11883197 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300005529|Ga0070741_10983030 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300005532|Ga0070739_10528055 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005542|Ga0070732_10412570 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300005546|Ga0070696_100295649 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300005560|Ga0066670_10146900 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
3300005564|Ga0070664_101146302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 733 | Open in IMG/M |
3300005566|Ga0066693_10298776 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300005575|Ga0066702_10098121 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
3300005578|Ga0068854_101065545 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300005587|Ga0066654_10105763 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300005587|Ga0066654_10839122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 524 | Open in IMG/M |
3300005614|Ga0068856_101110388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 808 | Open in IMG/M |
3300005614|Ga0068856_102051403 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300005617|Ga0068859_100997222 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300005718|Ga0068866_11242525 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300005764|Ga0066903_100171946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3171 | Open in IMG/M |
3300005840|Ga0068870_11427199 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005885|Ga0075284_1051961 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300005893|Ga0075278_1083170 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005902|Ga0075273_10052138 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300006031|Ga0066651_10719879 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300006032|Ga0066696_10687488 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300006173|Ga0070716_101276588 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300006175|Ga0070712_100244083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 1432 | Open in IMG/M |
3300006791|Ga0066653_10370715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 729 | Open in IMG/M |
3300006794|Ga0066658_10258690 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300006804|Ga0079221_11672163 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300006806|Ga0079220_10330632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 958 | Open in IMG/M |
3300006806|Ga0079220_11415833 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300006844|Ga0075428_101965120 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300006845|Ga0075421_101641800 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300006845|Ga0075421_102441297 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300006847|Ga0075431_100985462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 810 | Open in IMG/M |
3300006953|Ga0074063_12295202 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300006953|Ga0074063_13000156 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300006953|Ga0074063_13954396 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300007076|Ga0075435_100266252 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
3300009012|Ga0066710_102291996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
3300009088|Ga0099830_10968079 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300009090|Ga0099827_11177096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
3300009090|Ga0099827_11941009 | Not Available | 512 | Open in IMG/M |
3300009101|Ga0105247_10330064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1067 | Open in IMG/M |
3300009137|Ga0066709_100441627 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
3300009147|Ga0114129_12619032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300009177|Ga0105248_12897829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
3300009518|Ga0116128_1076885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1011 | Open in IMG/M |
3300009551|Ga0105238_10449772 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300009683|Ga0116224_10557610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
3300010043|Ga0126380_12100862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300010045|Ga0126311_10002170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9751 | Open in IMG/M |
3300010303|Ga0134082_10478930 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300010321|Ga0134067_10371661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
3300010322|Ga0134084_10365196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 554 | Open in IMG/M |
3300010366|Ga0126379_11729665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
3300010375|Ga0105239_11824444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
3300010376|Ga0126381_104978247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 510 | Open in IMG/M |
3300010396|Ga0134126_11470003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300010396|Ga0134126_11917863 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300010399|Ga0134127_11852099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
3300011000|Ga0138513_100059420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
3300011987|Ga0120164_1058382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
3300011994|Ga0120157_1079116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
3300012201|Ga0137365_11227747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300012206|Ga0137380_10377881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1261 | Open in IMG/M |
3300012206|Ga0137380_10760685 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300012207|Ga0137381_10625905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 937 | Open in IMG/M |
3300012208|Ga0137376_11259956 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300012211|Ga0137377_10676708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 967 | Open in IMG/M |
3300012356|Ga0137371_10334096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1178 | Open in IMG/M |
3300012357|Ga0137384_10247188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1489 | Open in IMG/M |
3300012896|Ga0157303_10009596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1433 | Open in IMG/M |
3300012957|Ga0164303_10458253 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300012960|Ga0164301_10666454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
3300012961|Ga0164302_11263340 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300012961|Ga0164302_11474319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
3300012971|Ga0126369_13217480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300012977|Ga0134087_10823625 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300012985|Ga0164308_10191600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1550 | Open in IMG/M |
3300012985|Ga0164308_10475694 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300012987|Ga0164307_10356342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1063 | Open in IMG/M |
3300013096|Ga0157307_1122649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
3300013102|Ga0157371_10067098 | All Organisms → cellular organisms → Bacteria | 2540 | Open in IMG/M |
3300013102|Ga0157371_10938728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
3300013105|Ga0157369_11901818 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300013296|Ga0157374_10954800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 876 | Open in IMG/M |
3300013296|Ga0157374_12015454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
3300013297|Ga0157378_12822833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
3300013307|Ga0157372_11476311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 783 | Open in IMG/M |
3300013768|Ga0120155_1111200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
3300014497|Ga0182008_10323438 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300014745|Ga0157377_11113794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
3300014968|Ga0157379_11960514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300015200|Ga0173480_11230995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 507 | Open in IMG/M |
3300015373|Ga0132257_100034035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 5555 | Open in IMG/M |
3300015373|Ga0132257_104215796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
3300015373|Ga0132257_104309567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 518 | Open in IMG/M |
3300015373|Ga0132257_104595950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300015374|Ga0132255_101234665 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
3300015374|Ga0132255_104416401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
3300017966|Ga0187776_10689744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
3300018028|Ga0184608_10352132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
3300018052|Ga0184638_1302516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 541 | Open in IMG/M |
3300018433|Ga0066667_11239914 | Not Available | 650 | Open in IMG/M |
3300018468|Ga0066662_11144818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 782 | Open in IMG/M |
3300018468|Ga0066662_11256872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
3300018482|Ga0066669_10039635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2875 | Open in IMG/M |
3300019361|Ga0173482_10528652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300019996|Ga0193693_1071644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300020015|Ga0193734_1052098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 750 | Open in IMG/M |
3300020059|Ga0193745_1080681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
3300020081|Ga0206354_11693999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300020082|Ga0206353_10770364 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300021510|Ga0222621_1115310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
3300022737|Ga0247747_1020807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 720 | Open in IMG/M |
3300023073|Ga0247744_1071094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
3300024187|Ga0247672_1027010 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300024310|Ga0247681_1059479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
3300025898|Ga0207692_11070783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
3300025905|Ga0207685_10244057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
3300025906|Ga0207699_10288834 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300025906|Ga0207699_10631748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
3300025907|Ga0207645_10955115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
3300025910|Ga0207684_10304214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1375 | Open in IMG/M |
3300025912|Ga0207707_10364059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1245 | Open in IMG/M |
3300025916|Ga0207663_11301224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
3300025917|Ga0207660_10387906 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300025918|Ga0207662_10895925 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300025921|Ga0207652_10199792 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
3300025921|Ga0207652_10532475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1057 | Open in IMG/M |
3300025922|Ga0207646_10331543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1375 | Open in IMG/M |
3300025923|Ga0207681_10409286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1097 | Open in IMG/M |
3300025924|Ga0207694_11652766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
3300025931|Ga0207644_10880469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
3300025933|Ga0207706_11016676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
3300025941|Ga0207711_10046039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3727 | Open in IMG/M |
3300025949|Ga0207667_11771499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
3300025960|Ga0207651_10518360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1033 | Open in IMG/M |
3300025960|Ga0207651_11763847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
3300025960|Ga0207651_12011184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300025960|Ga0207651_12029251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 517 | Open in IMG/M |
3300025986|Ga0207658_11887739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
3300026023|Ga0207677_11028337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 748 | Open in IMG/M |
3300026023|Ga0207677_11464627 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300026067|Ga0207678_10523788 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
3300026067|Ga0207678_11735745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
3300026075|Ga0207708_11562166 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300026078|Ga0207702_11008812 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300026116|Ga0207674_10842759 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300026312|Ga0209153_1314413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
3300026497|Ga0257164_1067787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
3300026542|Ga0209805_1302888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
3300026547|Ga0209156_10244622 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300026746|Ga0207454_101252 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300027725|Ga0209178_1293466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
3300027765|Ga0209073_10323247 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300027775|Ga0209177_10361747 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300027882|Ga0209590_10010629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4292 | Open in IMG/M |
3300027909|Ga0209382_11852335 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300028666|Ga0265336_10002725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7148 | Open in IMG/M |
3300028704|Ga0307321_1087806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
3300028715|Ga0307313_10292924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
3300028716|Ga0307311_10217802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300028718|Ga0307307_10039530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1361 | Open in IMG/M |
3300028754|Ga0307297_10076201 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300028755|Ga0307316_10172637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 775 | Open in IMG/M |
3300028796|Ga0307287_10228196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 706 | Open in IMG/M |
3300028800|Ga0265338_10787867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
3300028807|Ga0307305_10082578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1484 | Open in IMG/M |
3300028807|Ga0307305_10333689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
3300028812|Ga0247825_10397574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
3300028824|Ga0307310_10506741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
3300028828|Ga0307312_10055971 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
3300028828|Ga0307312_10644563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
3300028828|Ga0307312_10689422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
3300028880|Ga0307300_10117345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 816 | Open in IMG/M |
3300028885|Ga0307304_10601155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300030511|Ga0268241_10048054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 909 | Open in IMG/M |
3300031170|Ga0307498_10230279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
3300031184|Ga0307499_10338944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 506 | Open in IMG/M |
3300031199|Ga0307495_10198456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300031239|Ga0265328_10039712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1735 | Open in IMG/M |
3300031240|Ga0265320_10058521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1844 | Open in IMG/M |
3300031247|Ga0265340_10206474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 883 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1112507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
3300031251|Ga0265327_10329130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
3300031341|Ga0307418_1170031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
3300031548|Ga0307408_100567207 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300031744|Ga0306918_11252229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300031754|Ga0307475_11025975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
3300031819|Ga0318568_10210661 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300031819|Ga0318568_10505469 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300031854|Ga0310904_10446342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 857 | Open in IMG/M |
3300031897|Ga0318520_10677116 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300031901|Ga0307406_11267671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
3300031938|Ga0308175_100031632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4383 | Open in IMG/M |
3300031939|Ga0308174_10943609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
3300031947|Ga0310909_11326277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300031962|Ga0307479_11222682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
3300032060|Ga0318505_10450693 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300032089|Ga0318525_10701900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
3300032160|Ga0311301_11175867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 987 | Open in IMG/M |
3300032770|Ga0335085_10658714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1170 | Open in IMG/M |
3300032770|Ga0335085_11137691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
3300032783|Ga0335079_12155519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
3300033158|Ga0335077_10651746 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300033803|Ga0314862_0112490 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.28% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.02% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.77% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.51% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.51% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.51% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.51% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.67% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.67% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.26% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.26% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.26% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.26% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.26% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.26% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.26% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.84% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.84% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.84% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.42% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.42% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.42% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.42% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.42% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.42% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.42% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.42% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
2170459008 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300001333 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illumina | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300011987 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M | Environmental | Open in IMG/M |
3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
3300023073 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5 | Environmental | Open in IMG/M |
3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026746 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K2-12 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031341 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-20 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
L01_07673470 | 2170459006 | Grass Soil | LSTVAVIVDYGFREAVRRKVFAVVLVLTAVFLFLFWLANHYVF |
L01_00817850 | 2170459006 | Grass Soil | VTAVATIIGYGFREAVRRRVFAVVLLLTAGFLFLFW |
F48_06823760 | 2170459008 | Grass Soil | LSSVAVIVEYGFREALRRKVFAVVLVLTVVFLFLFWLANHYVFRELST |
ICChiseqgaiiDRAFT_21264872 | 3300000033 | Soil | MSDVAVVAGYGFREAVRRKVFAVVLVLTVXXLVLFWLANHYVFADLANI |
JGI10216J12902_1008439581 | 3300000956 | Soil | VSSIATIVGYGLREALRRKVFAVVLLLTAAFLFLYWLG |
JGI10216J12902_1103313991 | 3300000956 | Soil | VSAVWTIVGYGLREGMRRKVFAVVLLLTAGFLFLYWLANH |
C688J13580_10525771 | 3300001205 | Soil | LTSVLTIVLYGLQEALRRRVFAVVLALTLAFLVLYWIAN |
C688J13580_10663382 | 3300001205 | Soil | MSSIPTIVAYGLREALRRKVFAVVLFLTAGFLILYWLAN |
A21PFW6_10833742 | 3300001333 | Permafrost | VSAIPTIVGYGLREALRRKVFAVVLLLTIGFLGLYWLANHYVFRDVENISPP |
Ga0062595_1008313651 | 3300004479 | Soil | VSAVLTIAGYGFREAVRRKVFAVVVLLTAAFLALFWLANHYVF |
Ga0062592_1024309722 | 3300004480 | Soil | VSAIPIIVGYTLREALRRKVFTVVLLLTAGFLFLYWLANHYLFRDLSHIGAP |
Ga0062591_1005042863 | 3300004643 | Soil | VTGAWTIAGYALQEAIRRKVFAVVLVLTVVFIGLFWLGTDEAFE |
Ga0062594_1023690002 | 3300005093 | Soil | VSIVAVVAGYGFREAVRRRVFAVVLVLTVAFLALFWLANHYVFADLANIQPPQ |
Ga0065705_102753931 | 3300005294 | Switchgrass Rhizosphere | VRAVPTIAGYALREALRRKVFAVVLLLTTGFLSLYWLANHYLF |
Ga0070683_1001563511 | 3300005329 | Corn Rhizosphere | VTAVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYV |
Ga0070683_1008782662 | 3300005329 | Corn Rhizosphere | VSSVAVIVEYGFREAVRRKVFAVVILLTLAFLTLFWLANHYVFT |
Ga0070690_1003772152 | 3300005330 | Switchgrass Rhizosphere | VTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVN |
Ga0066388_1046124251 | 3300005332 | Tropical Forest Soil | MTAVLTIAGYGLREALRRRVFAVVLALTVAFLALFWLGNRYV |
Ga0070680_1000702791 | 3300005336 | Corn Rhizosphere | VTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRD |
Ga0070682_1018265091 | 3300005337 | Corn Rhizosphere | VSSIPVIVGYGLREALRRKVFAVVLLLTLCFLGLYWLANHYVFRDV |
Ga0070691_102436851 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VISVLTIAGYGLREALRRKVFAVVLLLTAAFLGLFWLANHFVF |
Ga0070669_1009829652 | 3300005353 | Switchgrass Rhizosphere | VSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANH |
Ga0070674_1015550361 | 3300005356 | Miscanthus Rhizosphere | VSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNN |
Ga0070673_1023204681 | 3300005364 | Switchgrass Rhizosphere | VSATLTIAAYGLREAVRRKVFVVVCVLSIAFVALYWIGARY |
Ga0070703_105209211 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLGS |
Ga0070714_10001442010 | 3300005435 | Agricultural Soil | VNAIPIIVGYGLREALRRKVFAVVLLLTAGFLFLYWLANHYLFRDLSHIGAPNGIDA |
Ga0070714_1017911631 | 3300005435 | Agricultural Soil | VTVVLTIMGYGFREAVRRKVFVVVVLLTAAFLVLFWLATRYVFSRL |
Ga0070713_1014048982 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VTPVWVIVGYGFREAVRRKMFAVVIVLTIGFLVLFWLANHYVFKDLTT |
Ga0070705_1004277802 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAVLTIAGYGLREALRRKVFVVVCVLSVAFLVLYWLGTRYA |
Ga0066689_107660461 | 3300005447 | Soil | VSAVLTIVGYGFREAVRRKVFAVVVLLTAAFLVLFWLANHYVFT |
Ga0070681_104088313 | 3300005458 | Corn Rhizosphere | LSSVVVIAGYGFREAVRRKVFTVVVLLTVVFLFLFWLANHYVF |
Ga0070681_118831971 | 3300005458 | Corn Rhizosphere | VTAVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLSTI |
Ga0070741_109830302 | 3300005529 | Surface Soil | VKTVGVIVEYGFREAVRRKVFAVVLVLTIVFLFLFWLANHYVFRDIAHIS |
Ga0070739_105280551 | 3300005532 | Surface Soil | VTAIAAIVEYGFREAVRRKMFAVVLVLTVLFLFLFWLANHYVF |
Ga0070732_104125702 | 3300005542 | Surface Soil | MNAIPVIVGYVLREALRRRVFAVVLFLTAIFLVLFW |
Ga0070696_1002956493 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLGSPSPAIEPRT |
Ga0066670_101469001 | 3300005560 | Soil | VSAVLTIAGYGFREAVRRKVFAVVVLLTAAFLFLFWLANHYVFTRLSTISPPA |
Ga0070664_1011463021 | 3300005564 | Corn Rhizosphere | LSSVAVIVQYALREALRRKVFAVVLLLTAAFLVLFWLAT |
Ga0066693_102987762 | 3300005566 | Soil | VNAVPVIVGYVLREALRRRVFAVVLLLTAAFLVLFWIANHY |
Ga0066702_100981211 | 3300005575 | Soil | VTAVWVIVGYGFREAVRRKMFAVVLVLTVAFLFLFWLANHYVFRDLSTISPPS |
Ga0068854_1010655451 | 3300005578 | Corn Rhizosphere | VTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGS |
Ga0066654_101057631 | 3300005587 | Soil | VVLTIAGYGLREAVRRKVFAVVVLLTALFLALFWLANHYVF |
Ga0066654_108391221 | 3300005587 | Soil | VTAALTIAGYGLREALRRKVFVVVCLLTVAFVALYWVGNR |
Ga0068856_1011103881 | 3300005614 | Corn Rhizosphere | VSDVLTIAGYGIRESIRRRVFVVVAILTLLSGALY |
Ga0068856_1020514031 | 3300005614 | Corn Rhizosphere | VLVIVEYGFREAVRRKMFAVVLVLTALFLFLYWLANH |
Ga0068859_1009972221 | 3300005617 | Switchgrass Rhizosphere | VSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLG |
Ga0068866_112425252 | 3300005718 | Miscanthus Rhizosphere | MRAIPTIAGYALREALRRKVFAVVLLLTTGFLSLYWLANHYLFRDVNSLG |
Ga0066903_1001719467 | 3300005764 | Tropical Forest Soil | VSAVLTIGGYGLREAIRRKVFAVVVLLTAIYLVLFWLANHYVF |
Ga0068870_114271992 | 3300005840 | Miscanthus Rhizosphere | VSAIPIIVGYTLREALRRKVFTVVLLLTAGFLFLYWLANH |
Ga0075284_10519612 | 3300005885 | Rice Paddy Soil | VDSVGAIVVYGFREAVRRKVFAVVVVLTAIFLFLFW |
Ga0075278_10831702 | 3300005893 | Rice Paddy Soil | VSAVLTIMGYGFREAVRRKVFAVVVLLTAIFLTLFWLATDY |
Ga0075273_100521381 | 3300005902 | Rice Paddy Soil | VSAVLTIMGYGFREAVRRKVFAVVVLLTAIFLTLFWLATDYVFSRLSTITPP |
Ga0066651_107198791 | 3300006031 | Soil | MRGVGTIVRYGLEEALRRKVFAVVLLLTLCFLGLYWLANHYAFRDLSGVG |
Ga0066696_106874882 | 3300006032 | Soil | MSSVAVIVEYGFREAVRRRVFAVVVLLTVVFLFLFWLANHY |
Ga0070716_1012765882 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGVGTIVRYGLEEALRRKVFVVVLLLTLAFLGLYALANHYAFANL |
Ga0070712_1002440831 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSNVVVVAGYGFREAVRRKVFAVVLVLTVAFLFLFWLANH |
Ga0066653_103707151 | 3300006791 | Soil | VTAIWTIAGYGLREALRRKVFVVVCFLTVAFLGLY |
Ga0066658_102586901 | 3300006794 | Soil | VNSIVTIVGYGLREALRRKVFAVVLVLTAGFLILYWLANHYIFRDISGISPPG |
Ga0079221_116721632 | 3300006804 | Agricultural Soil | VTPVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLSTI |
Ga0079220_103306321 | 3300006806 | Agricultural Soil | VSSVLTIAGYGLREALRRKVFVVVLFLTAGFLGLFW |
Ga0079220_114158331 | 3300006806 | Agricultural Soil | VTVVLTIAGYGLREAVRRKVFVVVVLLTALFLALFWLANHYVFDSLSTITP |
Ga0075428_1019651201 | 3300006844 | Populus Rhizosphere | VYGLREALRRKVFVVVLLLTLGFLGLYWLANHYVFRDVQNIAPPAGID |
Ga0075421_1016418002 | 3300006845 | Populus Rhizosphere | VNGVWTIVVYGLREALRRKVFAVVLLLTAGFLFLYWLANHYAFRDVENIQPPAGI |
Ga0075421_1024412971 | 3300006845 | Populus Rhizosphere | VYGLREALRRKVFVVVLLLTLGFLGLYWLANHYVFRDVQNISPPAGI |
Ga0075431_1009854621 | 3300006847 | Populus Rhizosphere | MTGALAIVGYVLRESVRRRVFYVVLALTAAFLALY |
Ga0074063_122952022 | 3300006953 | Soil | MSNVAVVAGYGFREAVRRRVFAVVLVLTVAFLVLFWLANHYVFADL |
Ga0074063_130001561 | 3300006953 | Soil | VSSVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHY |
Ga0074063_139543962 | 3300006953 | Soil | MTAVLAIAGYGFREALRRKVFAVVVVLTALFLALLWVACYFA |
Ga0075435_1002662521 | 3300007076 | Populus Rhizosphere | VSAIPIIVGYTLREALRRKVFTVVLLLTAGFLVLYWLANHYLFRD |
Ga0066710_1022919962 | 3300009012 | Grasslands Soil | MSPVLTIAGYGLREALRRRVFGVVLILTVGFLTLFWLGVHFLYEN |
Ga0099830_109680791 | 3300009088 | Vadose Zone Soil | VNAVLVVAGYGLREALRRRVFGVVVVLTSAFLFLFWLGTRF |
Ga0099827_111770962 | 3300009090 | Vadose Zone Soil | VTAVWTIAGYGLREAIRRKVFVVVLLLTAGFLALYWVGN |
Ga0099827_119410092 | 3300009090 | Vadose Zone Soil | AIPTIVAYGLREALRRKVFAVVLVLTAGFLGLYWLANHYAFRDVENIQQHVVRNGLR* |
Ga0105247_103300641 | 3300009101 | Switchgrass Rhizosphere | VTAVLTIAGYGFREAVRRKVFAVVIVLTACFLALFWLANHYVFTRL |
Ga0066709_1004416274 | 3300009137 | Grasslands Soil | LSAIPVIVGYVLREALRRPVFAVVLLLTAVFLVLLWVA |
Ga0114129_126190322 | 3300009147 | Populus Rhizosphere | VSGIVTIAAYGLREALRRRVFAVVVLLTVAFLVLFWLGNRY |
Ga0105248_128978292 | 3300009177 | Switchgrass Rhizosphere | VTAVLTIAGYGFREAVRRKVFAVVIVLTACFLALFWLANHYVFRDVATITP |
Ga0116128_10768852 | 3300009518 | Peatland | LSGVAVIVEYGFREAVRRKVFAVVVLLTAIFLVLFWL |
Ga0105238_104497721 | 3300009551 | Corn Rhizosphere | VIAVATIVEYGFREAVRRRVFTVVLLLTAVFLFLFWLANHFVFTQLGNITPP |
Ga0116224_105576101 | 3300009683 | Peatlands Soil | VIVEYGFREAVRRRVFTVVLLLTAVFLVLFWLANHYVFSELSTISPPR |
Ga0126380_121008621 | 3300010043 | Tropical Forest Soil | MSNVAVVAGYGFREAVRRRVFAVVLVLTVAFLVLF |
Ga0126311_1000217011 | 3300010045 | Serpentine Soil | VSVVWTIVGYGLREAMRRKIFAVVLLLTAGFLFLYWLAN |
Ga0134082_104789302 | 3300010303 | Grasslands Soil | VSVVLTIMGYGFREAVRRKVFAVVVVLTAIFLALFWLATHYVFS |
Ga0134067_103716612 | 3300010321 | Grasslands Soil | VSSVAVIVEYGFREAVRRKVFAVVLILTALFLFLFWLANHYVFAELGTIQPPR |
Ga0134084_103651962 | 3300010322 | Grasslands Soil | VLTIAGYGLREALRRRVFGVVLILTVGFLTLFWLGVHFLYENLG |
Ga0126379_117296651 | 3300010366 | Tropical Forest Soil | VSAALTIAGYGFREAVRRKVFTVVIVLTAAYLVLFWLANHYVFT |
Ga0105239_118244442 | 3300010375 | Corn Rhizosphere | VTATLTIAGYGLREALRRKVFAVVCVLSVGFVVLYWLGVH* |
Ga0126381_1049782471 | 3300010376 | Tropical Forest Soil | MTAVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLAAHYVFSRIST |
Ga0134126_114700031 | 3300010396 | Terrestrial Soil | VLVIVEYGFREAVRRKMFAVVLVLTALFLFLYWLANHYVFDQLSQI |
Ga0134126_119178632 | 3300010396 | Terrestrial Soil | VSAVLTIAGYGFREAVRRKVFAVVVLLTAAFLFLFWLANHYVFTRLSTIS |
Ga0134127_118520991 | 3300010399 | Terrestrial Soil | VSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLSTITP |
Ga0138513_1000594201 | 3300011000 | Soil | VSSILVIVGYGLREALRRKVFAFVLLLTLCFLGLYWLANHYVFRDVENI |
Ga0120164_10583822 | 3300011987 | Permafrost | VSAIPTIVGYGLREALRRKVFAVVLFLTLGFLGLYWLANHYVFRDVENISPPVGVG |
Ga0120157_10791162 | 3300011994 | Permafrost | VTAIWTIAGYGLREALRRKVFVVVCLLTLAFLALYW |
Ga0137365_112277471 | 3300012201 | Vadose Zone Soil | VSSVLTIAGYGLREALRRKVFAVVLLLTVGFLVLFW |
Ga0137380_103778813 | 3300012206 | Vadose Zone Soil | VSFVLTIAGYGLREALRRKVFAVVLLLTVGFLVLFWLAN |
Ga0137380_107606852 | 3300012206 | Vadose Zone Soil | VSVVLTIMGYGFREAVRRKVFAVVVVLTAIFLALFWLAT |
Ga0137381_106259051 | 3300012207 | Vadose Zone Soil | VSSVLTIAGYGLREALRRRVFGVVLILTVGFLTLFWLGVHF |
Ga0137376_112599561 | 3300012208 | Vadose Zone Soil | VRPVLTVAGYGLREALRRKVFAVVCLLTVAFLALYW |
Ga0137377_106767081 | 3300012211 | Vadose Zone Soil | VTAIWTIAGYGLREALRRKVFVVVCFLTIAFLGLY |
Ga0137371_103340962 | 3300012356 | Vadose Zone Soil | MSAIPTIVAYSLREALRRKVFVVVLLLTLGFLGLYWLGNHYVFRDVGSIVPP |
Ga0137384_102471881 | 3300012357 | Vadose Zone Soil | VTAIWTIAGYGLREALRRKVFVVVCFLTIAFLALYWLGARYA |
Ga0157303_100095961 | 3300012896 | Soil | VNGVWTIVVYGLREALRRKVFAVVLLLTAGFLFLYW |
Ga0164303_104582532 | 3300012957 | Soil | VTAVWTIAGYGLREALRRKVFVVVCFLTVAFLSLYWLGV |
Ga0164301_106664542 | 3300012960 | Soil | VSAVLTIAGYGFREAVRRKVFAVVIVLTACFLALF |
Ga0164302_112633401 | 3300012961 | Soil | VRAVPVIAAYALREALRRRVFAVVLVLTLFFLFLFWLGT |
Ga0164302_114743192 | 3300012961 | Soil | VSAILTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFSDVNNLGSPSPAI |
Ga0126369_132174801 | 3300012971 | Tropical Forest Soil | VTAVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFT |
Ga0134087_108236251 | 3300012977 | Grasslands Soil | VTAVLTIAGYGLREALRRKVFVVVCLLTVAFVILY |
Ga0164308_101916003 | 3300012985 | Soil | VSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLG* |
Ga0164308_104756942 | 3300012985 | Soil | VSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLS |
Ga0164307_103563422 | 3300012987 | Soil | VSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLGSPSP |
Ga0157307_11226492 | 3300013096 | Soil | VNGVWTIVVYGLREALRRKVFAVVLLLTAGFLFLYWLANHYAFRDVE |
Ga0157371_100670982 | 3300013102 | Corn Rhizosphere | VSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLY* |
Ga0157371_109387282 | 3300013102 | Corn Rhizosphere | VSAVWTIVGYGLREGMRRKVFAGVLLLTAGFLFLYWLANHYV |
Ga0157369_119018182 | 3300013105 | Corn Rhizosphere | VTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLA |
Ga0157374_109548001 | 3300013296 | Miscanthus Rhizosphere | VTSVLTIAGYGLREALRRKVFAVVLLLTAAFLGLFWLANHFVFENL |
Ga0157374_120154542 | 3300013296 | Miscanthus Rhizosphere | VSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLCWLAAH |
Ga0157378_128228332 | 3300013297 | Miscanthus Rhizosphere | VSIVAVVAGYGFREAVRRRVFAVVLVLTVAFLALFW |
Ga0157372_114763112 | 3300013307 | Corn Rhizosphere | VSSIPVIVGYGLREALRRKVFAVVLLLTLCFLVLYWLANHYVFRDV |
Ga0120155_11112001 | 3300013768 | Permafrost | VSAIPTIVGYGLREALRRKVFAVVLLLTIGFLGLYWLANHYVFRD |
Ga0182008_103234382 | 3300014497 | Rhizosphere | VTAVLTIAGYGFREAVRRKVFLIVLALTALFLFLFWLVN |
Ga0157377_111137941 | 3300014745 | Miscanthus Rhizosphere | VSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFRDVNNLGSPSPA |
Ga0157379_119605141 | 3300014968 | Switchgrass Rhizosphere | VSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLF |
Ga0173480_112309952 | 3300015200 | Soil | VSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLST |
Ga0132257_1000340351 | 3300015373 | Arabidopsis Rhizosphere | VRAVPTIIGYGLREALRRKVFAVVLLLTAGFLFLYWLANHYAF |
Ga0132257_1042157961 | 3300015373 | Arabidopsis Rhizosphere | VSTIAVIAGYGLREALRRKVFVVVLFLTLGFLGLY |
Ga0132257_1043095672 | 3300015373 | Arabidopsis Rhizosphere | VRVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLS |
Ga0132257_1045959501 | 3300015373 | Arabidopsis Rhizosphere | VNAIPIIVGYGLREALRRKVFAVVLLLTAGFLFLYWLANHYL |
Ga0132255_1012346652 | 3300015374 | Arabidopsis Rhizosphere | VSHVWTIAAYGLREALRRKVFVVVLVLTACFLFLYWLANHYAFRDVENIQP |
Ga0132255_1044164011 | 3300015374 | Arabidopsis Rhizosphere | VSTIAVIAGYGLREALRRKVFVVVLFLTLGFLGLYWLANHYVFRDVQNIS |
Ga0187776_106897441 | 3300017966 | Tropical Peatland | LSSVAAIVEYGFREAVRRKVFLVVVLLTAVFLVLFWLANHFVFSQLQNIT |
Ga0184605_104418242 | 3300018027 | Groundwater Sediment | VTAVWTIVRYGLQEALRRKVFVVVLVLTAGFLGLYALGNHYAFRDLAGA |
Ga0184608_103521321 | 3300018028 | Groundwater Sediment | VTAIATIVGYGLREALRRKVFAVVLLLTLGFLGLYWLANHYVFRDAENISPP |
Ga0184638_13025161 | 3300018052 | Groundwater Sediment | VTAIWTIAGYGLREALRRKVFVVVCFLTVAFLGLYWL |
Ga0066667_112399142 | 3300018433 | Grasslands Soil | VSELGTIAGYSLREDLRRKAFAVVLLLMALFLFLYWLGDP |
Ga0066662_111448182 | 3300018468 | Grasslands Soil | MSAVWVIVGYGFREAVRRKMFAVVLVLTVAFLFLFWLANHYVFRDLSTIS |
Ga0066662_112568722 | 3300018468 | Grasslands Soil | VTGVWTIVRYGLEEALRRKVFVVVLLLTLAFLGLYALANHYAF |
Ga0066669_100396351 | 3300018482 | Grasslands Soil | VSSVLTIAGYGFREALRRKVFVVVLVLTASFLALYWLANHYIFRDIAH |
Ga0173482_105286521 | 3300019361 | Soil | VSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLSTIQPPA |
Ga0193693_10716442 | 3300019996 | Soil | VSAIVTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLGSPSPAIEPRT |
Ga0193734_10520981 | 3300020015 | Soil | VTAVATIVGYGLREALRRKVFAVVLLLTLGFLGLYWLANHYVFRDVEN |
Ga0193745_10806812 | 3300020059 | Soil | VTAVLTIAGYGLREALRRKVFVVVCVLSVAFLVLY |
Ga0206354_116939992 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAVLTIMGYGFREAVRRKVFAVVVQLTAAFLVLFWLATHYVFTRL |
Ga0206353_107703641 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VIAVATIVEYGFREAVRRRVFTVVLLLTAVFLFLFWLANHF |
Ga0222621_11153102 | 3300021510 | Groundwater Sediment | VSSIPVIVGYGLREALRRKVFAVVLLLTLCFLGLYWLANHY |
Ga0247747_10208071 | 3300022737 | Soil | VNGVWTIVVYGLREALRRKVFAVVLLLTAGFLFLYWLANHYAFRDV |
Ga0247744_10710941 | 3300023073 | Soil | VNGVWTIVVYGLREALRRKVFAVVLLLTAGFLFLYWL |
Ga0247672_10270101 | 3300024187 | Soil | VTVVLTIMGYGFREAVRRKVFVVVVLLTAAFLVLFWLATRYVFSRLETITPPAGVQ |
Ga0247681_10594792 | 3300024310 | Soil | VSAVWTIVGYGLREGMRRKVFAVVLLLTAGFLFLYWLANHYV |
Ga0207692_110707832 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAVATIIGYGFREAVRRRVFAVVLVLTAGFLFLFWLANHYV |
Ga0207685_102440571 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAVLTIAGYGFREAVRRKVFAVVIVLTACFLALFWLANHYVFTRLSTITP |
Ga0207699_102888341 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVVLTIMGYGFREAVRRRVFVVVILLTAAFLVLFWLA |
Ga0207699_106317481 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VSNVVVVAGYGFREAVRRKVFAVVLVLTVAFLFLFWLANHYVFADLTNI |
Ga0207645_109551151 | 3300025907 | Miscanthus Rhizosphere | VSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLGSPSPAIEP |
Ga0207684_103042141 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDVLTIAGYGLREALRRKVFVVVLLLTVAFLTLFWL |
Ga0207707_103640593 | 3300025912 | Corn Rhizosphere | VTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGSPSP |
Ga0207663_113012242 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGVAVIVEYGFREAVRRKVFAVVLLLTVLFLFLFWLANHFVFRQ |
Ga0207660_103879061 | 3300025917 | Corn Rhizosphere | VTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGSPSPAIEPRT |
Ga0207662_108959252 | 3300025918 | Switchgrass Rhizosphere | VTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGSPS |
Ga0207652_101997924 | 3300025921 | Corn Rhizosphere | MTSVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDV |
Ga0207652_105324751 | 3300025921 | Corn Rhizosphere | VSAIPIIVGYTLREALRRKVFTVVLLLTGGFLFLYWLA |
Ga0207646_103315431 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDVLTIAGYGLREALRRKVFVVVLLVTAAFLALF |
Ga0207681_104092863 | 3300025923 | Switchgrass Rhizosphere | VSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHY |
Ga0207694_116527662 | 3300025924 | Corn Rhizosphere | VTAVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFC |
Ga0207644_108804692 | 3300025931 | Switchgrass Rhizosphere | VTAVLTIAGYGFREAVRRKVFAVVIVLTACFLALFWLANHYVFTRLSTI |
Ga0207706_110166761 | 3300025933 | Corn Rhizosphere | LSSVAVIAGYGFREAVRRRVFTVVVLLTVVFLFLFWL |
Ga0207711_100460391 | 3300025941 | Switchgrass Rhizosphere | VTAVLTIAGYGLREALRRKVFVVVCVLSIAFLVLYWL |
Ga0207667_117714992 | 3300025949 | Corn Rhizosphere | VTVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLA |
Ga0207651_105183601 | 3300025960 | Switchgrass Rhizosphere | VSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLGSPSPAIEPR |
Ga0207651_117638472 | 3300025960 | Switchgrass Rhizosphere | VTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLF |
Ga0207651_120111842 | 3300025960 | Switchgrass Rhizosphere | VSSIPTIVVYGLREALRRKVFAVVLLLTAGFLSLYWLANHY |
Ga0207651_120292512 | 3300025960 | Switchgrass Rhizosphere | VSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTR |
Ga0207658_118877392 | 3300025986 | Switchgrass Rhizosphere | VTAVLTIAGYGLREALRRKVFVVVCVLSIAFLILYWL |
Ga0207677_110283372 | 3300026023 | Miscanthus Rhizosphere | VTAVLTIMGYGFREAVRRRVFAVVVLLTAAFLVLFWLATHYVFTR |
Ga0207677_114646271 | 3300026023 | Miscanthus Rhizosphere | VTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGSPSPAIEP |
Ga0207678_105237881 | 3300026067 | Corn Rhizosphere | VTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGSP |
Ga0207678_117357451 | 3300026067 | Corn Rhizosphere | VSSVAVIVEYGFREAVRRKVFAVVILLTLAFLTLFWLANHYVF |
Ga0207708_115621662 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VTATLTIAGYGLREALRRKVFAVVCVLSVGFVVLYWLG |
Ga0207702_110088122 | 3300026078 | Corn Rhizosphere | VLVIVEYGFREAVRRKMFAVVLVLTALFLFLYWLANHYV |
Ga0207674_108427592 | 3300026116 | Corn Rhizosphere | VTAGLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHY |
Ga0209153_13144132 | 3300026312 | Soil | VSSIWVIVGYGFREAVRRKMFAVVIVLTIGFLFLFWLANHFVFRD |
Ga0257164_10677871 | 3300026497 | Soil | VTAIWTIAGYGLREALRRKVFVVVCFLTIAFLALYWLG |
Ga0209805_13028882 | 3300026542 | Soil | VTAVWVIVGYGFREAVRRKMFAVVLVLTVAFLFLFWLANHYVFRDLST |
Ga0209156_102446221 | 3300026547 | Soil | VSAVLTIVGYGFREAVRRKVFAVVVLLTAAFLVLFWLANHYVFTRLE |
Ga0207454_1012522 | 3300026746 | Soil | VTAVLTIAGYGLREALRRKVFVVVCVLSIAFLVLYWLG |
Ga0209178_12934662 | 3300027725 | Agricultural Soil | VTAVWVIVGYGFREAVRRKMFAVVLVLTVAFLFLFWLANHYVFRDLS |
Ga0209073_103232472 | 3300027765 | Agricultural Soil | VSAVLTIAGYGFREAVRRKVFAVVVLLTAVFLFLFWLANHYVFTRLS |
Ga0209177_103617472 | 3300027775 | Agricultural Soil | VTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGSPSPAI |
Ga0209590_100106291 | 3300027882 | Vadose Zone Soil | VSAVPVIVGYVLREALRRRVFAVVLLLTAIFLVLF |
Ga0209382_118523352 | 3300027909 | Populus Rhizosphere | VSAVPVIAGYALREALRRKVFAVVLVLTLVFLVLYWLAT |
Ga0265336_1000272514 | 3300028666 | Rhizosphere | VTAVLTIAGYGFREALRRKVFAVVLVLTAMFLVLIAVACHFV |
Ga0307321_10878062 | 3300028704 | Soil | VSSIPVIVGYGLREALRRKVFAVVLLLTLCFLGLYWLANHYVFRDVENIT |
Ga0307313_102929242 | 3300028715 | Soil | VSAIPTIVVYGLREALRRKVFAVVLLLTAGFLFLYWLANHYAFRDI |
Ga0307311_102178021 | 3300028716 | Soil | MRAVLTIVRYGLEEALRRKVFAVVLLLTLGFLGLFW |
Ga0307307_100395303 | 3300028718 | Soil | VSLVLTIAGYGFREALRRKVFVVVLLLTAAFLALYWLANHYI |
Ga0307297_100762011 | 3300028754 | Soil | VSSIPVIVGYGLREALRRKVFAVVLLLTICFLVLYWLANHYVFRDVENITP |
Ga0307316_101726372 | 3300028755 | Soil | VSSIPVIVGYGLREALRRKVFAVVLLLTLCFLGLYWLANHYVFRDVENITPPA |
Ga0307287_102281961 | 3300028796 | Soil | VTAILTIAGYALREALRRKVFAVVLVLTAGFLVLYWLANHYLFRDVDNLGSPSPAIDPRTFAG |
Ga0265338_107878672 | 3300028800 | Rhizosphere | VTAVLAIVAYGFREGVRRKVFAVVVILTAIFLFLFWLANHF |
Ga0307305_100825781 | 3300028807 | Soil | VRAIPTIAGYALREALRRKVFVVVLLLTAGFLVLYSLANHYVFQDI |
Ga0307305_103336892 | 3300028807 | Soil | VTAILTIAGYGLREALRRKVFVVVCFLSVAFLGLY |
Ga0247825_103975742 | 3300028812 | Soil | VNGVWTIVVYGLREALRRKVFAVVLLLTAGFLFLY |
Ga0307310_105067412 | 3300028824 | Soil | MNAIPVIVGYGLREALRRKVFAVVLLLTAGFLFLYWLANHYAFRDI |
Ga0307312_100559711 | 3300028828 | Soil | MNAIPVIVGYGLREALRRKVFAIVLLLTAGFLFLY |
Ga0307312_106445632 | 3300028828 | Soil | VTGVAAIVRYGLQEAVRRKVFAVVLVLTALFLFLYWLGNHYVFGELAQ |
Ga0307312_106894222 | 3300028828 | Soil | VTAIWTIAGYGLREALRRKVFVVVCFLTIAFLALY |
Ga0307300_101173451 | 3300028880 | Soil | VTPILTIAGYGLREALRRKVFVVVCFLSVAFLGLYWLG |
Ga0307304_106011551 | 3300028885 | Soil | MRAVLTIVRYGLEEALRRKVFAVVLLLTLGFLGLFWLGNHYA |
Ga0268241_100480542 | 3300030511 | Soil | VSSVVVIAVYGLREALRRKVFVVVLLLTLGFLALYWLANHYVFRDVENLGAP |
Ga0307498_102302792 | 3300031170 | Soil | VTAVLTIAGYGLREALRRKVFVVVCVLSIAFLVLYW |
Ga0307499_103389441 | 3300031184 | Soil | VSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLA |
Ga0307495_101984561 | 3300031199 | Soil | VSVVLTIMGYGFREAVRRKVFAVVILLTAAFLALFWLATH |
Ga0265328_100397124 | 3300031239 | Rhizosphere | LSSFAAIVEYGFREAVRRKVFAVVVLLTAVFLVLFWLANHFVF |
Ga0265320_100585215 | 3300031240 | Rhizosphere | LSSFAAIVEYGFREAVRRKVFAVVVLLTAVFLVLFWL |
Ga0265340_102064742 | 3300031247 | Rhizosphere | VTSVWVIVGYGFREAVRRKMFAVVVVLTVFFLALFWLANHYV |
(restricted) Ga0255312_11125071 | 3300031248 | Sandy Soil | MSSVRVIAGYGFREAVRRKMFAVVVVLTVAFLFLFWLANHYVFRDLSTITPPSDV |
Ga0265327_103291302 | 3300031251 | Rhizosphere | VTSIWVIVGYGFREAVRRKMFAVVLVLTVGFLGLFWLANHFVFRDL |
Ga0307418_11700311 | 3300031341 | Salt Marsh | LTSVAAIVGYGFREAVRRRVFAVVVFLTAVFLVLFWLANHYVFRELAQISP |
Ga0307408_1005672071 | 3300031548 | Rhizosphere | LSAVWTIVGYGLREALRRKVFAVVLLLTAGFLFLYWLANHY |
Ga0306918_112522292 | 3300031744 | Soil | LTSVAAIVGYGFREAVRRKVFAVVIVLTVVFLFLFAL |
Ga0307475_110259752 | 3300031754 | Hardwood Forest Soil | VTPVLVIVGYGFREAVRRKMFAVVIVLTIAFLFLFWLANHYVFKDL |
Ga0318568_102106612 | 3300031819 | Soil | VNPVLTIMGYGFREAVRRKMFTVVVLLTAAFLVLFWLAVRYVFGRIGSI |
Ga0318568_105054692 | 3300031819 | Soil | VNNVMVIAGYGFREAVRRKVFAVVLLLTLAFLALFWLANHYVFGQLQNI |
Ga0310904_104463421 | 3300031854 | Soil | VRAIPTIAGYALREALRRKVFAVVLLLTAGFLSLYWLANHYLFADVNNLGSPSPAI |
Ga0318520_106771161 | 3300031897 | Soil | MSSVAIIAGYGFREAVRRKVFAVVLLLTLLFLVLFWLANHYVFRDLGNIQPPQDV |
Ga0307406_112676711 | 3300031901 | Rhizosphere | LSAVWTIVGYGLREALRRKVFAVVLLLTAGFLFLYW |
Ga0308175_1000316329 | 3300031938 | Soil | VSSVAVIVEYGFREAVRRKVFAVVLLLTVLFLFLFWLANHYVFAQLDQ |
Ga0308174_109436091 | 3300031939 | Soil | MSAVVPIVEYGFREAVRRKVFTVVLLLTLAFLFLF |
Ga0310909_113262772 | 3300031947 | Soil | MSNVMVIAGYGFREAVRRKVFAVVLLLTLGFLALFWLANHY |
Ga0307479_112226821 | 3300031962 | Hardwood Forest Soil | VSGVAVIVQYALREAARRKVLAVVLVLTALFLVLFW |
Ga0318505_104506932 | 3300032060 | Soil | VNNVMVIAGYGFREAVRRKVFAVVLLLTLAFLALFWLANHY |
Ga0318525_107019002 | 3300032089 | Soil | VSVVLTIMGYGFREAVRRKVFAVVVLLTAIFLFLFWLATHYVFS |
Ga0311301_111758671 | 3300032160 | Peatlands Soil | VIVEYGFREAVRRRVFTVVLLLTAVFLVLFWLANHYVFS |
Ga0335085_106587141 | 3300032770 | Soil | VTAMWVIVGYGFREAVRRKMFAVVVVLTVFFLGLFWLAN |
Ga0335085_111376911 | 3300032770 | Soil | MSAVLTIVGYGFREAVRRKVFAVVILLTAAFLVLFWLAVHYVFSRLSTITPPAG |
Ga0335079_121555191 | 3300032783 | Soil | VSAVLTIAGYGFREAVRRKVFAVVLVLAAVFLFLFWLASH |
Ga0335077_106517462 | 3300033158 | Soil | VSVVPTIMGYGFREAVRRKVFLVVILLTAAFLVLFWLATRYVFSRLSTIQ |
Ga0314862_0112490_1_105 | 3300033803 | Peatland | VSNVAVVVGYGFHEAVRRRVFIVVLVLTIGFLGLF |
⦗Top⦘ |