NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F017700

Metagenome / Metatranscriptome Family F017700

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017700
Family Type Metagenome / Metatranscriptome
Number of Sequences 239
Average Sequence Length 44 residues
Representative Sequence VSAVLTIAGYGFREAVRRKVFAVVVLLTAAFLALFWLANHYVF
Number of Associated Samples 203
Number of Associated Scaffolds 239

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.06 %
% of genes near scaffold ends (potentially truncated) 98.33 %
% of genes from short scaffolds (< 2000 bps) 94.14 %
Associated GOLD sequencing projects 192
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.745 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.389 % of family members)
Environment Ontology (ENVO) Unclassified
(30.962 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.259 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 57.75%    β-sheet: 0.00%    Coil/Unstructured: 42.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 239 Family Scaffolds
PF00005ABC_tran 63.18
PF00583Acetyltransf_1 2.09
PF07992Pyr_redox_2 1.26
PF08734GYD 1.26
PF03193RsgA_GTPase 0.42
PF07452CHRD 0.42
PF12679ABC2_membrane_2 0.42
PF02274ADI 0.42
PF01048PNP_UDP_1 0.42
PF13508Acetyltransf_7 0.42
PF08543Phos_pyr_kin 0.42

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 239 Family Scaffolds
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 1.26
COG0351Hydroxymethylpyrimidine/phosphomethylpyrimidine kinaseCoenzyme transport and metabolism [H] 0.42
COG0524Sugar or nucleoside kinase, ribokinase familyCarbohydrate transport and metabolism [G] 0.42
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 0.42
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 0.42
COG1162Ribosome biogenesis GTPase RsgATranslation, ribosomal structure and biogenesis [J] 0.42
COG1834N-Dimethylarginine dimethylaminohydrolaseAmino acid transport and metabolism [E] 0.42
COG2235Arginine deiminaseAmino acid transport and metabolism [E] 0.42
COG2240Pyridoxal/pyridoxine/pyridoxamine kinaseCoenzyme transport and metabolism [H] 0.42
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 0.42
COG2870ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferaseCell wall/membrane/envelope biogenesis [M] 0.42
COG4874Uncharacterized conserved proteinFunction unknown [S] 0.42


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.74 %
UnclassifiedrootN/A1.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459006|GBPF9FW01EF0T8All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
2170459006|GBPF9FW02IWVKWAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
2170459008|GA8OVOZ02HVLWLAll Organisms → cellular organisms → Bacteria507Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2126487All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300000956|JGI10216J12902_100843958All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300000956|JGI10216J12902_110331399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300001205|C688J13580_1052577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300001205|C688J13580_1066338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300001333|A21PFW6_1083374All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300004479|Ga0062595_100831365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli766Open in IMG/M
3300004480|Ga0062592_102430972All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300004643|Ga0062591_100504286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli1040Open in IMG/M
3300005093|Ga0062594_102369000All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300005294|Ga0065705_10275393All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300005329|Ga0070683_100156351All Organisms → cellular organisms → Bacteria2162Open in IMG/M
3300005329|Ga0070683_100878266All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300005330|Ga0070690_100377215All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300005332|Ga0066388_104612425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli701Open in IMG/M
3300005336|Ga0070680_100070279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2876Open in IMG/M
3300005337|Ga0070682_101826509All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005341|Ga0070691_10243685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli961Open in IMG/M
3300005353|Ga0070669_100982965All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300005356|Ga0070674_101555036All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005364|Ga0070673_102320468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli510Open in IMG/M
3300005406|Ga0070703_10520921All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005435|Ga0070714_100014420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter6349Open in IMG/M
3300005435|Ga0070714_101791163All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300005436|Ga0070713_101404898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300005440|Ga0070705_100427780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli987Open in IMG/M
3300005447|Ga0066689_10766046All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300005458|Ga0070681_10408831All Organisms → cellular organisms → Bacteria1269Open in IMG/M
3300005458|Ga0070681_11883197All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005529|Ga0070741_10983030All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300005532|Ga0070739_10528055All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005542|Ga0070732_10412570All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300005546|Ga0070696_100295649All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300005560|Ga0066670_10146900All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300005564|Ga0070664_101146302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli733Open in IMG/M
3300005566|Ga0066693_10298776All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005575|Ga0066702_10098121All Organisms → cellular organisms → Bacteria1668Open in IMG/M
3300005578|Ga0068854_101065545All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300005587|Ga0066654_10105763All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300005587|Ga0066654_10839122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli524Open in IMG/M
3300005614|Ga0068856_101110388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli808Open in IMG/M
3300005614|Ga0068856_102051403All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005617|Ga0068859_100997222All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300005718|Ga0068866_11242525All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005764|Ga0066903_100171946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3171Open in IMG/M
3300005840|Ga0068870_11427199All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300005885|Ga0075284_1051961All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300005893|Ga0075278_1083170All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005902|Ga0075273_10052138All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300006031|Ga0066651_10719879All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300006032|Ga0066696_10687488All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300006173|Ga0070716_101276588All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300006175|Ga0070712_100244083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli1432Open in IMG/M
3300006791|Ga0066653_10370715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli729Open in IMG/M
3300006794|Ga0066658_10258690All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300006804|Ga0079221_11672163All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300006806|Ga0079220_10330632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli958Open in IMG/M
3300006806|Ga0079220_11415833All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300006844|Ga0075428_101965120All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300006845|Ga0075421_101641800All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300006845|Ga0075421_102441297All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300006847|Ga0075431_100985462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli810Open in IMG/M
3300006953|Ga0074063_12295202All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300006953|Ga0074063_13000156All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300006953|Ga0074063_13954396All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300007076|Ga0075435_100266252All Organisms → cellular organisms → Bacteria1461Open in IMG/M
3300009012|Ga0066710_102291996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria785Open in IMG/M
3300009088|Ga0099830_10968079All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300009090|Ga0099827_11177096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300009090|Ga0099827_11941009Not Available512Open in IMG/M
3300009101|Ga0105247_10330064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1067Open in IMG/M
3300009137|Ga0066709_100441627All Organisms → cellular organisms → Bacteria1817Open in IMG/M
3300009147|Ga0114129_12619032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300009177|Ga0105248_12897829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300009518|Ga0116128_1076885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1011Open in IMG/M
3300009551|Ga0105238_10449772All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300009683|Ga0116224_10557610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300010043|Ga0126380_12100862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300010045|Ga0126311_10002170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9751Open in IMG/M
3300010303|Ga0134082_10478930All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010321|Ga0134067_10371661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300010322|Ga0134084_10365196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium554Open in IMG/M
3300010366|Ga0126379_11729665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria730Open in IMG/M
3300010375|Ga0105239_11824444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium705Open in IMG/M
3300010376|Ga0126381_104978247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium510Open in IMG/M
3300010396|Ga0134126_11470003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300010396|Ga0134126_11917863All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300010399|Ga0134127_11852099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300011000|Ga0138513_100059420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300011987|Ga0120164_1058382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300011994|Ga0120157_1079116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300012201|Ga0137365_11227747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300012206|Ga0137380_10377881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1261Open in IMG/M
3300012206|Ga0137380_10760685All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300012207|Ga0137381_10625905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria937Open in IMG/M
3300012208|Ga0137376_11259956All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300012211|Ga0137377_10676708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria967Open in IMG/M
3300012356|Ga0137371_10334096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1178Open in IMG/M
3300012357|Ga0137384_10247188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1489Open in IMG/M
3300012896|Ga0157303_10009596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1433Open in IMG/M
3300012957|Ga0164303_10458253All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300012960|Ga0164301_10666454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria778Open in IMG/M
3300012961|Ga0164302_11263340All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300012961|Ga0164302_11474319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300012971|Ga0126369_13217480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300012977|Ga0134087_10823625All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300012985|Ga0164308_10191600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1550Open in IMG/M
3300012985|Ga0164308_10475694All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300012987|Ga0164307_10356342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1063Open in IMG/M
3300013096|Ga0157307_1122649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300013102|Ga0157371_10067098All Organisms → cellular organisms → Bacteria2540Open in IMG/M
3300013102|Ga0157371_10938728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300013105|Ga0157369_11901818All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300013296|Ga0157374_10954800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria876Open in IMG/M
3300013296|Ga0157374_12015454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300013297|Ga0157378_12822833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300013307|Ga0157372_11476311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium783Open in IMG/M
3300013768|Ga0120155_1111200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria760Open in IMG/M
3300014497|Ga0182008_10323438All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300014745|Ga0157377_11113794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300014968|Ga0157379_11960514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300015200|Ga0173480_11230995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium507Open in IMG/M
3300015373|Ga0132257_100034035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter5555Open in IMG/M
3300015373|Ga0132257_104215796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300015373|Ga0132257_104309567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium518Open in IMG/M
3300015373|Ga0132257_104595950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300015374|Ga0132255_101234665All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300015374|Ga0132255_104416401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300017966|Ga0187776_10689744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria721Open in IMG/M
3300018028|Ga0184608_10352132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300018052|Ga0184638_1302516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium541Open in IMG/M
3300018433|Ga0066667_11239914Not Available650Open in IMG/M
3300018468|Ga0066662_11144818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria782Open in IMG/M
3300018468|Ga0066662_11256872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria755Open in IMG/M
3300018482|Ga0066669_10039635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2875Open in IMG/M
3300019361|Ga0173482_10528652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300019996|Ga0193693_1071644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300020015|Ga0193734_1052098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium750Open in IMG/M
3300020059|Ga0193745_1080681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria706Open in IMG/M
3300020081|Ga0206354_11693999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300020082|Ga0206353_10770364All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300021510|Ga0222621_1115310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300022737|Ga0247747_1020807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria720Open in IMG/M
3300023073|Ga0247744_1071094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300024187|Ga0247672_1027010All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300024310|Ga0247681_1059479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300025898|Ga0207692_11070783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300025905|Ga0207685_10244057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria866Open in IMG/M
3300025906|Ga0207699_10288834All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300025906|Ga0207699_10631748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300025907|Ga0207645_10955115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300025910|Ga0207684_10304214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1375Open in IMG/M
3300025912|Ga0207707_10364059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1245Open in IMG/M
3300025916|Ga0207663_11301224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300025917|Ga0207660_10387906All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300025918|Ga0207662_10895925All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300025921|Ga0207652_10199792All Organisms → cellular organisms → Bacteria1799Open in IMG/M
3300025921|Ga0207652_10532475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1057Open in IMG/M
3300025922|Ga0207646_10331543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1375Open in IMG/M
3300025923|Ga0207681_10409286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1097Open in IMG/M
3300025924|Ga0207694_11652766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300025931|Ga0207644_10880469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300025933|Ga0207706_11016676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300025941|Ga0207711_10046039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3727Open in IMG/M
3300025949|Ga0207667_11771499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300025960|Ga0207651_10518360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1033Open in IMG/M
3300025960|Ga0207651_11763847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300025960|Ga0207651_12011184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300025960|Ga0207651_12029251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium517Open in IMG/M
3300025986|Ga0207658_11887739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300026023|Ga0207677_11028337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria748Open in IMG/M
3300026023|Ga0207677_11464627All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300026067|Ga0207678_10523788All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300026067|Ga0207678_11735745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300026075|Ga0207708_11562166All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300026078|Ga0207702_11008812All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300026116|Ga0207674_10842759All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300026312|Ga0209153_1314413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300026497|Ga0257164_1067787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300026542|Ga0209805_1302888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300026547|Ga0209156_10244622All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300026746|Ga0207454_101252All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300027725|Ga0209178_1293466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300027765|Ga0209073_10323247All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300027775|Ga0209177_10361747All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300027882|Ga0209590_10010629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4292Open in IMG/M
3300027909|Ga0209382_11852335All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300028666|Ga0265336_10002725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7148Open in IMG/M
3300028704|Ga0307321_1087806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300028715|Ga0307313_10292924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300028716|Ga0307311_10217802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300028718|Ga0307307_10039530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1361Open in IMG/M
3300028754|Ga0307297_10076201All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300028755|Ga0307316_10172637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium775Open in IMG/M
3300028796|Ga0307287_10228196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter706Open in IMG/M
3300028800|Ga0265338_10787867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M
3300028807|Ga0307305_10082578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1484Open in IMG/M
3300028807|Ga0307305_10333689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300028812|Ga0247825_10397574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria973Open in IMG/M
3300028824|Ga0307310_10506741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300028828|Ga0307312_10055971All Organisms → cellular organisms → Bacteria2366Open in IMG/M
3300028828|Ga0307312_10644563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300028828|Ga0307312_10689422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300028880|Ga0307300_10117345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria816Open in IMG/M
3300028885|Ga0307304_10601155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300030511|Ga0268241_10048054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria909Open in IMG/M
3300031170|Ga0307498_10230279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300031184|Ga0307499_10338944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium506Open in IMG/M
3300031199|Ga0307495_10198456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300031239|Ga0265328_10039712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1735Open in IMG/M
3300031240|Ga0265320_10058521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1844Open in IMG/M
3300031247|Ga0265340_10206474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria883Open in IMG/M
(restricted) 3300031248|Ga0255312_1112507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300031251|Ga0265327_10329130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300031341|Ga0307418_1170031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300031548|Ga0307408_100567207All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300031744|Ga0306918_11252229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300031754|Ga0307475_11025975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300031819|Ga0318568_10210661All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300031819|Ga0318568_10505469All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300031854|Ga0310904_10446342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium857Open in IMG/M
3300031897|Ga0318520_10677116All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300031901|Ga0307406_11267671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300031938|Ga0308175_100031632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4383Open in IMG/M
3300031939|Ga0308174_10943609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria730Open in IMG/M
3300031947|Ga0310909_11326277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300031962|Ga0307479_11222682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300032060|Ga0318505_10450693All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300032089|Ga0318525_10701900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300032160|Ga0311301_11175867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300032770|Ga0335085_10658714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1170Open in IMG/M
3300032770|Ga0335085_11137691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria834Open in IMG/M
3300032783|Ga0335079_12155519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300033158|Ga0335077_10651746All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300033803|Ga0314862_0112490All Organisms → cellular organisms → Bacteria638Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.28%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.02%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.51%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.51%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.51%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.67%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.26%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.26%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.26%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.26%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.26%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.26%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.26%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.84%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.84%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.42%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.42%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.42%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.42%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.42%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.42%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.42%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.42%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459006Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cmEnvironmentalOpen in IMG/M
2170459008Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300001333Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005885Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401EnvironmentalOpen in IMG/M
3300005893Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202EnvironmentalOpen in IMG/M
3300005902Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011987Permafrost microbial communities from Nunavut, Canada - A20_80cm_0MEnvironmentalOpen in IMG/M
3300011994Permafrost microbial communities from Nunavut, Canada - A7_65cm_12MEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019996Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300023073Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026746Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028666Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaGHost-AssociatedOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031341Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-20EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
L01_076734702170459006Grass SoilLSTVAVIVDYGFREAVRRKVFAVVLVLTAVFLFLFWLANHYVF
L01_008178502170459006Grass SoilVTAVATIIGYGFREAVRRRVFAVVLLLTAGFLFLFW
F48_068237602170459008Grass SoilLSSVAVIVEYGFREALRRKVFAVVLVLTVVFLFLFWLANHYVFRELST
ICChiseqgaiiDRAFT_212648723300000033SoilMSDVAVVAGYGFREAVRRKVFAVVLVLTVXXLVLFWLANHYVFADLANI
JGI10216J12902_10084395813300000956SoilVSSIATIVGYGLREALRRKVFAVVLLLTAAFLFLYWLG
JGI10216J12902_11033139913300000956SoilVSAVWTIVGYGLREGMRRKVFAVVLLLTAGFLFLYWLANH
C688J13580_105257713300001205SoilLTSVLTIVLYGLQEALRRRVFAVVLALTLAFLVLYWIAN
C688J13580_106633823300001205SoilMSSIPTIVAYGLREALRRKVFAVVLFLTAGFLILYWLAN
A21PFW6_108337423300001333PermafrostVSAIPTIVGYGLREALRRKVFAVVLLLTIGFLGLYWLANHYVFRDVENISPP
Ga0062595_10083136513300004479SoilVSAVLTIAGYGFREAVRRKVFAVVVLLTAAFLALFWLANHYVF
Ga0062592_10243097223300004480SoilVSAIPIIVGYTLREALRRKVFTVVLLLTAGFLFLYWLANHYLFRDLSHIGAP
Ga0062591_10050428633300004643SoilVTGAWTIAGYALQEAIRRKVFAVVLVLTVVFIGLFWLGTDEAFE
Ga0062594_10236900023300005093SoilVSIVAVVAGYGFREAVRRRVFAVVLVLTVAFLALFWLANHYVFADLANIQPPQ
Ga0065705_1027539313300005294Switchgrass RhizosphereVRAVPTIAGYALREALRRKVFAVVLLLTTGFLSLYWLANHYLF
Ga0070683_10015635113300005329Corn RhizosphereVTAVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYV
Ga0070683_10087826623300005329Corn RhizosphereVSSVAVIVEYGFREAVRRKVFAVVILLTLAFLTLFWLANHYVFT
Ga0070690_10037721523300005330Switchgrass RhizosphereVTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVN
Ga0066388_10461242513300005332Tropical Forest SoilMTAVLTIAGYGLREALRRRVFAVVLALTVAFLALFWLGNRYV
Ga0070680_10007027913300005336Corn RhizosphereVTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRD
Ga0070682_10182650913300005337Corn RhizosphereVSSIPVIVGYGLREALRRKVFAVVLLLTLCFLGLYWLANHYVFRDV
Ga0070691_1024368513300005341Corn, Switchgrass And Miscanthus RhizosphereVISVLTIAGYGLREALRRKVFAVVLLLTAAFLGLFWLANHFVF
Ga0070669_10098296523300005353Switchgrass RhizosphereVSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANH
Ga0070674_10155503613300005356Miscanthus RhizosphereVSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNN
Ga0070673_10232046813300005364Switchgrass RhizosphereVSATLTIAAYGLREAVRRKVFVVVCVLSIAFVALYWIGARY
Ga0070703_1052092113300005406Corn, Switchgrass And Miscanthus RhizosphereVSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLGS
Ga0070714_100014420103300005435Agricultural SoilVNAIPIIVGYGLREALRRKVFAVVLLLTAGFLFLYWLANHYLFRDLSHIGAPNGIDA
Ga0070714_10179116313300005435Agricultural SoilVTVVLTIMGYGFREAVRRKVFVVVVLLTAAFLVLFWLATRYVFSRL
Ga0070713_10140489823300005436Corn, Switchgrass And Miscanthus RhizosphereVTPVWVIVGYGFREAVRRKMFAVVIVLTIGFLVLFWLANHYVFKDLTT
Ga0070705_10042778023300005440Corn, Switchgrass And Miscanthus RhizosphereVTAVLTIAGYGLREALRRKVFVVVCVLSVAFLVLYWLGTRYA
Ga0066689_1076604613300005447SoilVSAVLTIVGYGFREAVRRKVFAVVVLLTAAFLVLFWLANHYVFT
Ga0070681_1040883133300005458Corn RhizosphereLSSVVVIAGYGFREAVRRKVFTVVVLLTVVFLFLFWLANHYVF
Ga0070681_1188319713300005458Corn RhizosphereVTAVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLSTI
Ga0070741_1098303023300005529Surface SoilVKTVGVIVEYGFREAVRRKVFAVVLVLTIVFLFLFWLANHYVFRDIAHIS
Ga0070739_1052805513300005532Surface SoilVTAIAAIVEYGFREAVRRKMFAVVLVLTVLFLFLFWLANHYVF
Ga0070732_1041257023300005542Surface SoilMNAIPVIVGYVLREALRRRVFAVVLFLTAIFLVLFW
Ga0070696_10029564933300005546Corn, Switchgrass And Miscanthus RhizosphereVSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLGSPSPAIEPRT
Ga0066670_1014690013300005560SoilVSAVLTIAGYGFREAVRRKVFAVVVLLTAAFLFLFWLANHYVFTRLSTISPPA
Ga0070664_10114630213300005564Corn RhizosphereLSSVAVIVQYALREALRRKVFAVVLLLTAAFLVLFWLAT
Ga0066693_1029877623300005566SoilVNAVPVIVGYVLREALRRRVFAVVLLLTAAFLVLFWIANHY
Ga0066702_1009812113300005575SoilVTAVWVIVGYGFREAVRRKMFAVVLVLTVAFLFLFWLANHYVFRDLSTISPPS
Ga0068854_10106554513300005578Corn RhizosphereVTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGS
Ga0066654_1010576313300005587SoilVVLTIAGYGLREAVRRKVFAVVVLLTALFLALFWLANHYVF
Ga0066654_1083912213300005587SoilVTAALTIAGYGLREALRRKVFVVVCLLTVAFVALYWVGNR
Ga0068856_10111038813300005614Corn RhizosphereVSDVLTIAGYGIRESIRRRVFVVVAILTLLSGALY
Ga0068856_10205140313300005614Corn RhizosphereVLVIVEYGFREAVRRKMFAVVLVLTALFLFLYWLANH
Ga0068859_10099722213300005617Switchgrass RhizosphereVSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLG
Ga0068866_1124252523300005718Miscanthus RhizosphereMRAIPTIAGYALREALRRKVFAVVLLLTTGFLSLYWLANHYLFRDVNSLG
Ga0066903_10017194673300005764Tropical Forest SoilVSAVLTIGGYGLREAIRRKVFAVVVLLTAIYLVLFWLANHYVF
Ga0068870_1142719923300005840Miscanthus RhizosphereVSAIPIIVGYTLREALRRKVFTVVLLLTAGFLFLYWLANH
Ga0075284_105196123300005885Rice Paddy SoilVDSVGAIVVYGFREAVRRKVFAVVVVLTAIFLFLFW
Ga0075278_108317023300005893Rice Paddy SoilVSAVLTIMGYGFREAVRRKVFAVVVLLTAIFLTLFWLATDY
Ga0075273_1005213813300005902Rice Paddy SoilVSAVLTIMGYGFREAVRRKVFAVVVLLTAIFLTLFWLATDYVFSRLSTITPP
Ga0066651_1071987913300006031SoilMRGVGTIVRYGLEEALRRKVFAVVLLLTLCFLGLYWLANHYAFRDLSGVG
Ga0066696_1068748823300006032SoilMSSVAVIVEYGFREAVRRRVFAVVVLLTVVFLFLFWLANHY
Ga0070716_10127658823300006173Corn, Switchgrass And Miscanthus RhizosphereVTGVGTIVRYGLEEALRRKVFVVVLLLTLAFLGLYALANHYAFANL
Ga0070712_10024408313300006175Corn, Switchgrass And Miscanthus RhizosphereVSNVVVVAGYGFREAVRRKVFAVVLVLTVAFLFLFWLANH
Ga0066653_1037071513300006791SoilVTAIWTIAGYGLREALRRKVFVVVCFLTVAFLGLY
Ga0066658_1025869013300006794SoilVNSIVTIVGYGLREALRRKVFAVVLVLTAGFLILYWLANHYIFRDISGISPPG
Ga0079221_1167216323300006804Agricultural SoilVTPVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLSTI
Ga0079220_1033063213300006806Agricultural SoilVSSVLTIAGYGLREALRRKVFVVVLFLTAGFLGLFW
Ga0079220_1141583313300006806Agricultural SoilVTVVLTIAGYGLREAVRRKVFVVVVLLTALFLALFWLANHYVFDSLSTITP
Ga0075428_10196512013300006844Populus RhizosphereVYGLREALRRKVFVVVLLLTLGFLGLYWLANHYVFRDVQNIAPPAGID
Ga0075421_10164180023300006845Populus RhizosphereVNGVWTIVVYGLREALRRKVFAVVLLLTAGFLFLYWLANHYAFRDVENIQPPAGI
Ga0075421_10244129713300006845Populus RhizosphereVYGLREALRRKVFVVVLLLTLGFLGLYWLANHYVFRDVQNISPPAGI
Ga0075431_10098546213300006847Populus RhizosphereMTGALAIVGYVLRESVRRRVFYVVLALTAAFLALY
Ga0074063_1229520223300006953SoilMSNVAVVAGYGFREAVRRRVFAVVLVLTVAFLVLFWLANHYVFADL
Ga0074063_1300015613300006953SoilVSSVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHY
Ga0074063_1395439623300006953SoilMTAVLAIAGYGFREALRRKVFAVVVVLTALFLALLWVACYFA
Ga0075435_10026625213300007076Populus RhizosphereVSAIPIIVGYTLREALRRKVFTVVLLLTAGFLVLYWLANHYLFRD
Ga0066710_10229199623300009012Grasslands SoilMSPVLTIAGYGLREALRRRVFGVVLILTVGFLTLFWLGVHFLYEN
Ga0099830_1096807913300009088Vadose Zone SoilVNAVLVVAGYGLREALRRRVFGVVVVLTSAFLFLFWLGTRF
Ga0099827_1117709623300009090Vadose Zone SoilVTAVWTIAGYGLREAIRRKVFVVVLLLTAGFLALYWVGN
Ga0099827_1194100923300009090Vadose Zone SoilAIPTIVAYGLREALRRKVFAVVLVLTAGFLGLYWLANHYAFRDVENIQQHVVRNGLR*
Ga0105247_1033006413300009101Switchgrass RhizosphereVTAVLTIAGYGFREAVRRKVFAVVIVLTACFLALFWLANHYVFTRL
Ga0066709_10044162743300009137Grasslands SoilLSAIPVIVGYVLREALRRPVFAVVLLLTAVFLVLLWVA
Ga0114129_1261903223300009147Populus RhizosphereVSGIVTIAAYGLREALRRRVFAVVVLLTVAFLVLFWLGNRY
Ga0105248_1289782923300009177Switchgrass RhizosphereVTAVLTIAGYGFREAVRRKVFAVVIVLTACFLALFWLANHYVFRDVATITP
Ga0116128_107688523300009518PeatlandLSGVAVIVEYGFREAVRRKVFAVVVLLTAIFLVLFWL
Ga0105238_1044977213300009551Corn RhizosphereVIAVATIVEYGFREAVRRRVFTVVLLLTAVFLFLFWLANHFVFTQLGNITPP
Ga0116224_1055761013300009683Peatlands SoilVIVEYGFREAVRRRVFTVVLLLTAVFLVLFWLANHYVFSELSTISPPR
Ga0126380_1210086213300010043Tropical Forest SoilMSNVAVVAGYGFREAVRRRVFAVVLVLTVAFLVLF
Ga0126311_10002170113300010045Serpentine SoilVSVVWTIVGYGLREAMRRKIFAVVLLLTAGFLFLYWLAN
Ga0134082_1047893023300010303Grasslands SoilVSVVLTIMGYGFREAVRRKVFAVVVVLTAIFLALFWLATHYVFS
Ga0134067_1037166123300010321Grasslands SoilVSSVAVIVEYGFREAVRRKVFAVVLILTALFLFLFWLANHYVFAELGTIQPPR
Ga0134084_1036519623300010322Grasslands SoilVLTIAGYGLREALRRRVFGVVLILTVGFLTLFWLGVHFLYENLG
Ga0126379_1172966513300010366Tropical Forest SoilVSAALTIAGYGFREAVRRKVFTVVIVLTAAYLVLFWLANHYVFT
Ga0105239_1182444423300010375Corn RhizosphereVTATLTIAGYGLREALRRKVFAVVCVLSVGFVVLYWLGVH*
Ga0126381_10497824713300010376Tropical Forest SoilMTAVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLAAHYVFSRIST
Ga0134126_1147000313300010396Terrestrial SoilVLVIVEYGFREAVRRKMFAVVLVLTALFLFLYWLANHYVFDQLSQI
Ga0134126_1191786323300010396Terrestrial SoilVSAVLTIAGYGFREAVRRKVFAVVVLLTAAFLFLFWLANHYVFTRLSTIS
Ga0134127_1185209913300010399Terrestrial SoilVSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLSTITP
Ga0138513_10005942013300011000SoilVSSILVIVGYGLREALRRKVFAFVLLLTLCFLGLYWLANHYVFRDVENI
Ga0120164_105838223300011987PermafrostVSAIPTIVGYGLREALRRKVFAVVLFLTLGFLGLYWLANHYVFRDVENISPPVGVG
Ga0120157_107911623300011994PermafrostVTAIWTIAGYGLREALRRKVFVVVCLLTLAFLALYW
Ga0137365_1122774713300012201Vadose Zone SoilVSSVLTIAGYGLREALRRKVFAVVLLLTVGFLVLFW
Ga0137380_1037788133300012206Vadose Zone SoilVSFVLTIAGYGLREALRRKVFAVVLLLTVGFLVLFWLAN
Ga0137380_1076068523300012206Vadose Zone SoilVSVVLTIMGYGFREAVRRKVFAVVVVLTAIFLALFWLAT
Ga0137381_1062590513300012207Vadose Zone SoilVSSVLTIAGYGLREALRRRVFGVVLILTVGFLTLFWLGVHF
Ga0137376_1125995613300012208Vadose Zone SoilVRPVLTVAGYGLREALRRKVFAVVCLLTVAFLALYW
Ga0137377_1067670813300012211Vadose Zone SoilVTAIWTIAGYGLREALRRKVFVVVCFLTIAFLGLY
Ga0137371_1033409623300012356Vadose Zone SoilMSAIPTIVAYSLREALRRKVFVVVLLLTLGFLGLYWLGNHYVFRDVGSIVPP
Ga0137384_1024718813300012357Vadose Zone SoilVTAIWTIAGYGLREALRRKVFVVVCFLTIAFLALYWLGARYA
Ga0157303_1000959613300012896SoilVNGVWTIVVYGLREALRRKVFAVVLLLTAGFLFLYW
Ga0164303_1045825323300012957SoilVTAVWTIAGYGLREALRRKVFVVVCFLTVAFLSLYWLGV
Ga0164301_1066645423300012960SoilVSAVLTIAGYGFREAVRRKVFAVVIVLTACFLALF
Ga0164302_1126334013300012961SoilVRAVPVIAAYALREALRRRVFAVVLVLTLFFLFLFWLGT
Ga0164302_1147431923300012961SoilVSAILTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFSDVNNLGSPSPAI
Ga0126369_1321748013300012971Tropical Forest SoilVTAVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFT
Ga0134087_1082362513300012977Grasslands SoilVTAVLTIAGYGLREALRRKVFVVVCLLTVAFVILY
Ga0164308_1019160033300012985SoilVSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLG*
Ga0164308_1047569423300012985SoilVSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLS
Ga0164307_1035634223300012987SoilVSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLGSPSP
Ga0157307_112264923300013096SoilVNGVWTIVVYGLREALRRKVFAVVLLLTAGFLFLYWLANHYAFRDVE
Ga0157371_1006709823300013102Corn RhizosphereVSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLY*
Ga0157371_1093872823300013102Corn RhizosphereVSAVWTIVGYGLREGMRRKVFAGVLLLTAGFLFLYWLANHYV
Ga0157369_1190181823300013105Corn RhizosphereVTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLA
Ga0157374_1095480013300013296Miscanthus RhizosphereVTSVLTIAGYGLREALRRKVFAVVLLLTAAFLGLFWLANHFVFENL
Ga0157374_1201545423300013296Miscanthus RhizosphereVSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLCWLAAH
Ga0157378_1282283323300013297Miscanthus RhizosphereVSIVAVVAGYGFREAVRRRVFAVVLVLTVAFLALFW
Ga0157372_1147631123300013307Corn RhizosphereVSSIPVIVGYGLREALRRKVFAVVLLLTLCFLVLYWLANHYVFRDV
Ga0120155_111120013300013768PermafrostVSAIPTIVGYGLREALRRKVFAVVLLLTIGFLGLYWLANHYVFRD
Ga0182008_1032343823300014497RhizosphereVTAVLTIAGYGFREAVRRKVFLIVLALTALFLFLFWLVN
Ga0157377_1111379413300014745Miscanthus RhizosphereVSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFRDVNNLGSPSPA
Ga0157379_1196051413300014968Switchgrass RhizosphereVSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLF
Ga0173480_1123099523300015200SoilVSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLST
Ga0132257_10003403513300015373Arabidopsis RhizosphereVRAVPTIIGYGLREALRRKVFAVVLLLTAGFLFLYWLANHYAF
Ga0132257_10421579613300015373Arabidopsis RhizosphereVSTIAVIAGYGLREALRRKVFVVVLFLTLGFLGLY
Ga0132257_10430956723300015373Arabidopsis RhizosphereVRVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLS
Ga0132257_10459595013300015373Arabidopsis RhizosphereVNAIPIIVGYGLREALRRKVFAVVLLLTAGFLFLYWLANHYL
Ga0132255_10123466523300015374Arabidopsis RhizosphereVSHVWTIAAYGLREALRRKVFVVVLVLTACFLFLYWLANHYAFRDVENIQP
Ga0132255_10441640113300015374Arabidopsis RhizosphereVSTIAVIAGYGLREALRRKVFVVVLFLTLGFLGLYWLANHYVFRDVQNIS
Ga0187776_1068974413300017966Tropical PeatlandLSSVAAIVEYGFREAVRRKVFLVVVLLTAVFLVLFWLANHFVFSQLQNIT
Ga0184605_1044182423300018027Groundwater SedimentVTAVWTIVRYGLQEALRRKVFVVVLVLTAGFLGLYALGNHYAFRDLAGA
Ga0184608_1035213213300018028Groundwater SedimentVTAIATIVGYGLREALRRKVFAVVLLLTLGFLGLYWLANHYVFRDAENISPP
Ga0184638_130251613300018052Groundwater SedimentVTAIWTIAGYGLREALRRKVFVVVCFLTVAFLGLYWL
Ga0066667_1123991423300018433Grasslands SoilVSELGTIAGYSLREDLRRKAFAVVLLLMALFLFLYWLGDP
Ga0066662_1114481823300018468Grasslands SoilMSAVWVIVGYGFREAVRRKMFAVVLVLTVAFLFLFWLANHYVFRDLSTIS
Ga0066662_1125687223300018468Grasslands SoilVTGVWTIVRYGLEEALRRKVFVVVLLLTLAFLGLYALANHYAF
Ga0066669_1003963513300018482Grasslands SoilVSSVLTIAGYGFREALRRKVFVVVLVLTASFLALYWLANHYIFRDIAH
Ga0173482_1052865213300019361SoilVSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTRLSTIQPPA
Ga0193693_107164423300019996SoilVSAIVTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLGSPSPAIEPRT
Ga0193734_105209813300020015SoilVTAVATIVGYGLREALRRKVFAVVLLLTLGFLGLYWLANHYVFRDVEN
Ga0193745_108068123300020059SoilVTAVLTIAGYGLREALRRKVFVVVCVLSVAFLVLY
Ga0206354_1169399923300020081Corn, Switchgrass And Miscanthus RhizosphereVTAVLTIMGYGFREAVRRKVFAVVVQLTAAFLVLFWLATHYVFTRL
Ga0206353_1077036413300020082Corn, Switchgrass And Miscanthus RhizosphereVIAVATIVEYGFREAVRRRVFTVVLLLTAVFLFLFWLANHF
Ga0222621_111531023300021510Groundwater SedimentVSSIPVIVGYGLREALRRKVFAVVLLLTLCFLGLYWLANHY
Ga0247747_102080713300022737SoilVNGVWTIVVYGLREALRRKVFAVVLLLTAGFLFLYWLANHYAFRDV
Ga0247744_107109413300023073SoilVNGVWTIVVYGLREALRRKVFAVVLLLTAGFLFLYWL
Ga0247672_102701013300024187SoilVTVVLTIMGYGFREAVRRKVFVVVVLLTAAFLVLFWLATRYVFSRLETITPPAGVQ
Ga0247681_105947923300024310SoilVSAVWTIVGYGLREGMRRKVFAVVLLLTAGFLFLYWLANHYV
Ga0207692_1107078323300025898Corn, Switchgrass And Miscanthus RhizosphereMTAVATIIGYGFREAVRRRVFAVVLVLTAGFLFLFWLANHYV
Ga0207685_1024405713300025905Corn, Switchgrass And Miscanthus RhizosphereVTAVLTIAGYGFREAVRRKVFAVVIVLTACFLALFWLANHYVFTRLSTITP
Ga0207699_1028883413300025906Corn, Switchgrass And Miscanthus RhizosphereVSVVLTIMGYGFREAVRRRVFVVVILLTAAFLVLFWLA
Ga0207699_1063174813300025906Corn, Switchgrass And Miscanthus RhizosphereVSNVVVVAGYGFREAVRRKVFAVVLVLTVAFLFLFWLANHYVFADLTNI
Ga0207645_1095511513300025907Miscanthus RhizosphereVSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLGSPSPAIEP
Ga0207684_1030421413300025910Corn, Switchgrass And Miscanthus RhizosphereMRDVLTIAGYGLREALRRKVFVVVLLLTVAFLTLFWL
Ga0207707_1036405933300025912Corn RhizosphereVTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGSPSP
Ga0207663_1130122423300025916Corn, Switchgrass And Miscanthus RhizosphereVSGVAVIVEYGFREAVRRKVFAVVLLLTVLFLFLFWLANHFVFRQ
Ga0207660_1038790613300025917Corn RhizosphereVTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGSPSPAIEPRT
Ga0207662_1089592523300025918Switchgrass RhizosphereVTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGSPS
Ga0207652_1019979243300025921Corn RhizosphereMTSVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDV
Ga0207652_1053247513300025921Corn RhizosphereVSAIPIIVGYTLREALRRKVFTVVLLLTGGFLFLYWLA
Ga0207646_1033154313300025922Corn, Switchgrass And Miscanthus RhizosphereMRDVLTIAGYGLREALRRKVFVVVLLVTAAFLALF
Ga0207681_1040928633300025923Switchgrass RhizosphereVSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHY
Ga0207694_1165276623300025924Corn RhizosphereVTAVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFC
Ga0207644_1088046923300025931Switchgrass RhizosphereVTAVLTIAGYGFREAVRRKVFAVVIVLTACFLALFWLANHYVFTRLSTI
Ga0207706_1101667613300025933Corn RhizosphereLSSVAVIAGYGFREAVRRRVFTVVVLLTVVFLFLFWL
Ga0207711_1004603913300025941Switchgrass RhizosphereVTAVLTIAGYGLREALRRKVFVVVCVLSIAFLVLYWL
Ga0207667_1177149923300025949Corn RhizosphereVTVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLA
Ga0207651_1051836013300025960Switchgrass RhizosphereVSAIPTIAGYALREALRRKVFAVVLLLTAGFLFLYWLANHYLFADVNNLGSPSPAIEPR
Ga0207651_1176384723300025960Switchgrass RhizosphereVTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLF
Ga0207651_1201118423300025960Switchgrass RhizosphereVSSIPTIVVYGLREALRRKVFAVVLLLTAGFLSLYWLANHY
Ga0207651_1202925123300025960Switchgrass RhizosphereVSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHYVFTR
Ga0207658_1188773923300025986Switchgrass RhizosphereVTAVLTIAGYGLREALRRKVFVVVCVLSIAFLILYWL
Ga0207677_1102833723300026023Miscanthus RhizosphereVTAVLTIMGYGFREAVRRRVFAVVVLLTAAFLVLFWLATHYVFTR
Ga0207677_1146462713300026023Miscanthus RhizosphereVTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGSPSPAIEP
Ga0207678_1052378813300026067Corn RhizosphereVTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGSP
Ga0207678_1173574513300026067Corn RhizosphereVSSVAVIVEYGFREAVRRKVFAVVILLTLAFLTLFWLANHYVF
Ga0207708_1156216623300026075Corn, Switchgrass And Miscanthus RhizosphereVTATLTIAGYGLREALRRKVFAVVCVLSVGFVVLYWLG
Ga0207702_1100881223300026078Corn RhizosphereVLVIVEYGFREAVRRKMFAVVLVLTALFLFLYWLANHYV
Ga0207674_1084275923300026116Corn RhizosphereVTAGLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLATHY
Ga0209153_131441323300026312SoilVSSIWVIVGYGFREAVRRKMFAVVIVLTIGFLFLFWLANHFVFRD
Ga0257164_106778713300026497SoilVTAIWTIAGYGLREALRRKVFVVVCFLTIAFLALYWLG
Ga0209805_130288823300026542SoilVTAVWVIVGYGFREAVRRKMFAVVLVLTVAFLFLFWLANHYVFRDLST
Ga0209156_1024462213300026547SoilVSAVLTIVGYGFREAVRRKVFAVVVLLTAAFLVLFWLANHYVFTRLE
Ga0207454_10125223300026746SoilVTAVLTIAGYGLREALRRKVFVVVCVLSIAFLVLYWLG
Ga0209178_129346623300027725Agricultural SoilVTAVWVIVGYGFREAVRRKMFAVVLVLTVAFLFLFWLANHYVFRDLS
Ga0209073_1032324723300027765Agricultural SoilVSAVLTIAGYGFREAVRRKVFAVVVLLTAVFLFLFWLANHYVFTRLS
Ga0209177_1036174723300027775Agricultural SoilVTAVLTIAGYALREALRRKVFLVVLLLTAGFLTLYWLANHYLFRDVNNLGSPSPAI
Ga0209590_1001062913300027882Vadose Zone SoilVSAVPVIVGYVLREALRRRVFAVVLLLTAIFLVLF
Ga0209382_1185233523300027909Populus RhizosphereVSAVPVIAGYALREALRRKVFAVVLVLTLVFLVLYWLAT
Ga0265336_10002725143300028666RhizosphereVTAVLTIAGYGFREALRRKVFAVVLVLTAMFLVLIAVACHFV
Ga0307321_108780623300028704SoilVSSIPVIVGYGLREALRRKVFAVVLLLTLCFLGLYWLANHYVFRDVENIT
Ga0307313_1029292423300028715SoilVSAIPTIVVYGLREALRRKVFAVVLLLTAGFLFLYWLANHYAFRDI
Ga0307311_1021780213300028716SoilMRAVLTIVRYGLEEALRRKVFAVVLLLTLGFLGLFW
Ga0307307_1003953033300028718SoilVSLVLTIAGYGFREALRRKVFVVVLLLTAAFLALYWLANHYI
Ga0307297_1007620113300028754SoilVSSIPVIVGYGLREALRRKVFAVVLLLTICFLVLYWLANHYVFRDVENITP
Ga0307316_1017263723300028755SoilVSSIPVIVGYGLREALRRKVFAVVLLLTLCFLGLYWLANHYVFRDVENITPPA
Ga0307287_1022819613300028796SoilVTAILTIAGYALREALRRKVFAVVLVLTAGFLVLYWLANHYLFRDVDNLGSPSPAIDPRTFAG
Ga0265338_1078786723300028800RhizosphereVTAVLAIVAYGFREGVRRKVFAVVVILTAIFLFLFWLANHF
Ga0307305_1008257813300028807SoilVRAIPTIAGYALREALRRKVFVVVLLLTAGFLVLYSLANHYVFQDI
Ga0307305_1033368923300028807SoilVTAILTIAGYGLREALRRKVFVVVCFLSVAFLGLY
Ga0247825_1039757423300028812SoilVNGVWTIVVYGLREALRRKVFAVVLLLTAGFLFLY
Ga0307310_1050674123300028824SoilMNAIPVIVGYGLREALRRKVFAVVLLLTAGFLFLYWLANHYAFRDI
Ga0307312_1005597113300028828SoilMNAIPVIVGYGLREALRRKVFAIVLLLTAGFLFLY
Ga0307312_1064456323300028828SoilVTGVAAIVRYGLQEAVRRKVFAVVLVLTALFLFLYWLGNHYVFGELAQ
Ga0307312_1068942223300028828SoilVTAIWTIAGYGLREALRRKVFVVVCFLTIAFLALY
Ga0307300_1011734513300028880SoilVTPILTIAGYGLREALRRKVFVVVCFLSVAFLGLYWLG
Ga0307304_1060115513300028885SoilMRAVLTIVRYGLEEALRRKVFAVVLLLTLGFLGLFWLGNHYA
Ga0268241_1004805423300030511SoilVSSVVVIAVYGLREALRRKVFVVVLLLTLGFLALYWLANHYVFRDVENLGAP
Ga0307498_1023027923300031170SoilVTAVLTIAGYGLREALRRKVFVVVCVLSIAFLVLYW
Ga0307499_1033894413300031184SoilVSVVLTIMGYGFREAVRRKVFAVVVLLTAAFLVLFWLA
Ga0307495_1019845613300031199SoilVSVVLTIMGYGFREAVRRKVFAVVILLTAAFLALFWLATH
Ga0265328_1003971243300031239RhizosphereLSSFAAIVEYGFREAVRRKVFAVVVLLTAVFLVLFWLANHFVF
Ga0265320_1005852153300031240RhizosphereLSSFAAIVEYGFREAVRRKVFAVVVLLTAVFLVLFWL
Ga0265340_1020647423300031247RhizosphereVTSVWVIVGYGFREAVRRKMFAVVVVLTVFFLALFWLANHYV
(restricted) Ga0255312_111250713300031248Sandy SoilMSSVRVIAGYGFREAVRRKMFAVVVVLTVAFLFLFWLANHYVFRDLSTITPPSDV
Ga0265327_1032913023300031251RhizosphereVTSIWVIVGYGFREAVRRKMFAVVLVLTVGFLGLFWLANHFVFRDL
Ga0307418_117003113300031341Salt MarshLTSVAAIVGYGFREAVRRRVFAVVVFLTAVFLVLFWLANHYVFRELAQISP
Ga0307408_10056720713300031548RhizosphereLSAVWTIVGYGLREALRRKVFAVVLLLTAGFLFLYWLANHY
Ga0306918_1125222923300031744SoilLTSVAAIVGYGFREAVRRKVFAVVIVLTVVFLFLFAL
Ga0307475_1102597523300031754Hardwood Forest SoilVTPVLVIVGYGFREAVRRKMFAVVIVLTIAFLFLFWLANHYVFKDL
Ga0318568_1021066123300031819SoilVNPVLTIMGYGFREAVRRKMFTVVVLLTAAFLVLFWLAVRYVFGRIGSI
Ga0318568_1050546923300031819SoilVNNVMVIAGYGFREAVRRKVFAVVLLLTLAFLALFWLANHYVFGQLQNI
Ga0310904_1044634213300031854SoilVRAIPTIAGYALREALRRKVFAVVLLLTAGFLSLYWLANHYLFADVNNLGSPSPAI
Ga0318520_1067711613300031897SoilMSSVAIIAGYGFREAVRRKVFAVVLLLTLLFLVLFWLANHYVFRDLGNIQPPQDV
Ga0307406_1126767113300031901RhizosphereLSAVWTIVGYGLREALRRKVFAVVLLLTAGFLFLYW
Ga0308175_10003163293300031938SoilVSSVAVIVEYGFREAVRRKVFAVVLLLTVLFLFLFWLANHYVFAQLDQ
Ga0308174_1094360913300031939SoilMSAVVPIVEYGFREAVRRKVFTVVLLLTLAFLFLF
Ga0310909_1132627723300031947SoilMSNVMVIAGYGFREAVRRKVFAVVLLLTLGFLALFWLANHY
Ga0307479_1122268213300031962Hardwood Forest SoilVSGVAVIVQYALREAARRKVLAVVLVLTALFLVLFW
Ga0318505_1045069323300032060SoilVNNVMVIAGYGFREAVRRKVFAVVLLLTLAFLALFWLANHY
Ga0318525_1070190023300032089SoilVSVVLTIMGYGFREAVRRKVFAVVVLLTAIFLFLFWLATHYVFS
Ga0311301_1117586713300032160Peatlands SoilVIVEYGFREAVRRRVFTVVLLLTAVFLVLFWLANHYVFS
Ga0335085_1065871413300032770SoilVTAMWVIVGYGFREAVRRKMFAVVVVLTVFFLGLFWLAN
Ga0335085_1113769113300032770SoilMSAVLTIVGYGFREAVRRKVFAVVILLTAAFLVLFWLAVHYVFSRLSTITPPAG
Ga0335079_1215551913300032783SoilVSAVLTIAGYGFREAVRRKVFAVVLVLAAVFLFLFWLASH
Ga0335077_1065174623300033158SoilVSVVPTIMGYGFREAVRRKVFLVVILLTAAFLVLFWLATRYVFSRLSTIQ
Ga0314862_0112490_1_1053300033803PeatlandVSNVAVVVGYGFHEAVRRRVFIVVLVLTIGFLGLF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.