| Basic Information | |
|---|---|
| Family ID | F017698 |
| Family Type | Metagenome |
| Number of Sequences | 239 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 239 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 56.07 % |
| % of genes near scaffold ends (potentially truncated) | 60.25 % |
| % of genes from short scaffolds (< 2000 bps) | 83.68 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.967 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.778 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.678 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.536 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 239 Family Scaffolds |
|---|---|---|
| PF04519 | Bactofilin | 42.26 |
| PF12697 | Abhydrolase_6 | 3.35 |
| PF00561 | Abhydrolase_1 | 2.09 |
| PF04392 | ABC_sub_bind | 1.67 |
| PF00498 | FHA | 1.67 |
| PF13924 | Lipocalin_5 | 0.42 |
| PF02899 | Phage_int_SAM_1 | 0.42 |
| PF01544 | CorA | 0.42 |
| PF14525 | AraC_binding_2 | 0.42 |
| PF07690 | MFS_1 | 0.42 |
| PF00296 | Bac_luciferase | 0.42 |
| PF13414 | TPR_11 | 0.42 |
| PF02265 | S1-P1_nuclease | 0.42 |
| PF00589 | Phage_integrase | 0.42 |
| PF06537 | DHOR | 0.42 |
| PF06724 | DUF1206 | 0.42 |
| PF12728 | HTH_17 | 0.42 |
| PF09834 | DUF2061 | 0.42 |
| PF12071 | DUF3551 | 0.42 |
| PF13432 | TPR_16 | 0.42 |
| PF13458 | Peripla_BP_6 | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 239 Family Scaffolds |
|---|---|---|---|
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 42.26 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.67 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.42 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.42 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.42 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.42 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.97 % |
| Unclassified | root | N/A | 28.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01EQBWS | Not Available | 712 | Open in IMG/M |
| 3300000550|F24TB_11156596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 813 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1064929 | Not Available | 556 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10019789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1849 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10082123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 806 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10085648 | Not Available | 786 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10114846 | Not Available | 659 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1018675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 887 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1088660 | Not Available | 543 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10028854 | Not Available | 1307 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10065662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10086364 | Not Available | 667 | Open in IMG/M |
| 3300002906|JGI25614J43888_10137440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300002907|JGI25613J43889_10139084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10198335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300004463|Ga0063356_103626701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300004633|Ga0066395_10200811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1043 | Open in IMG/M |
| 3300005186|Ga0066676_10752299 | Not Available | 663 | Open in IMG/M |
| 3300005332|Ga0066388_100523076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1819 | Open in IMG/M |
| 3300005332|Ga0066388_100630164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1690 | Open in IMG/M |
| 3300005332|Ga0066388_101472799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1188 | Open in IMG/M |
| 3300005332|Ga0066388_101493317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1181 | Open in IMG/M |
| 3300005332|Ga0066388_102367265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 962 | Open in IMG/M |
| 3300005332|Ga0066388_102979035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300005332|Ga0066388_105245854 | Not Available | 657 | Open in IMG/M |
| 3300005332|Ga0066388_106741972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300005436|Ga0070713_101480745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300005445|Ga0070708_100355922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1380 | Open in IMG/M |
| 3300005445|Ga0070708_101292911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300005468|Ga0070707_100367888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 21 | 1397 | Open in IMG/M |
| 3300005468|Ga0070707_100560568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1104 | Open in IMG/M |
| 3300005468|Ga0070707_101400799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300005471|Ga0070698_100084620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3159 | Open in IMG/M |
| 3300005471|Ga0070698_100124200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2538 | Open in IMG/M |
| 3300005471|Ga0070698_100542131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1102 | Open in IMG/M |
| 3300005471|Ga0070698_100567541 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300005518|Ga0070699_100136435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2164 | Open in IMG/M |
| 3300005518|Ga0070699_100499804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1104 | Open in IMG/M |
| 3300005518|Ga0070699_101632850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300005536|Ga0070697_101152637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300005554|Ga0066661_10581490 | Not Available | 667 | Open in IMG/M |
| 3300005554|Ga0066661_10804093 | Not Available | 550 | Open in IMG/M |
| 3300005555|Ga0066692_10928886 | Not Available | 533 | Open in IMG/M |
| 3300005556|Ga0066707_10585553 | Not Available | 715 | Open in IMG/M |
| 3300005559|Ga0066700_10425456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 935 | Open in IMG/M |
| 3300005562|Ga0058697_10060583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1477 | Open in IMG/M |
| 3300005568|Ga0066703_10775440 | Not Available | 549 | Open in IMG/M |
| 3300005598|Ga0066706_10730493 | Not Available | 786 | Open in IMG/M |
| 3300005618|Ga0068864_101691873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300005713|Ga0066905_100157926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1643 | Open in IMG/M |
| 3300005713|Ga0066905_100440178 | Not Available | 1068 | Open in IMG/M |
| 3300005713|Ga0066905_100442528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1066 | Open in IMG/M |
| 3300005713|Ga0066905_100952584 | Not Available | 754 | Open in IMG/M |
| 3300005713|Ga0066905_101369100 | Not Available | 639 | Open in IMG/M |
| 3300005713|Ga0066905_101726722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300005713|Ga0066905_102109513 | Not Available | 524 | Open in IMG/M |
| 3300005764|Ga0066903_100563271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1959 | Open in IMG/M |
| 3300005764|Ga0066903_100798407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1687 | Open in IMG/M |
| 3300005764|Ga0066903_101294312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1361 | Open in IMG/M |
| 3300005764|Ga0066903_103074594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300005764|Ga0066903_106378877 | Not Available | 615 | Open in IMG/M |
| 3300005764|Ga0066903_109119370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300006028|Ga0070717_10241041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1595 | Open in IMG/M |
| 3300006028|Ga0070717_10297883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1433 | Open in IMG/M |
| 3300006028|Ga0070717_10378289 | Not Available | 1269 | Open in IMG/M |
| 3300006028|Ga0070717_10554894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1040 | Open in IMG/M |
| 3300006028|Ga0070717_10700162 | Not Available | 920 | Open in IMG/M |
| 3300006028|Ga0070717_11160360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300006038|Ga0075365_10014765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4705 | Open in IMG/M |
| 3300006173|Ga0070716_101636967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300006175|Ga0070712_100561651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 962 | Open in IMG/M |
| 3300006791|Ga0066653_10094878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1347 | Open in IMG/M |
| 3300006797|Ga0066659_11552292 | Not Available | 555 | Open in IMG/M |
| 3300006800|Ga0066660_11208691 | Not Available | 593 | Open in IMG/M |
| 3300006845|Ga0075421_102613681 | Not Available | 524 | Open in IMG/M |
| 3300006846|Ga0075430_100028336 | All Organisms → cellular organisms → Bacteria | 4759 | Open in IMG/M |
| 3300006854|Ga0075425_100187286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2377 | Open in IMG/M |
| 3300006871|Ga0075434_101932393 | Not Available | 596 | Open in IMG/M |
| 3300006880|Ga0075429_101454305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300007076|Ga0075435_100916035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300009100|Ga0075418_10729812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1069 | Open in IMG/M |
| 3300009100|Ga0075418_12775210 | Not Available | 535 | Open in IMG/M |
| 3300009162|Ga0075423_10080630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3390 | Open in IMG/M |
| 3300009168|Ga0105104_10240090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 989 | Open in IMG/M |
| 3300009168|Ga0105104_10578089 | Not Available | 638 | Open in IMG/M |
| 3300010043|Ga0126380_10019901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3202 | Open in IMG/M |
| 3300010043|Ga0126380_11038101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300010047|Ga0126382_11375221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300010047|Ga0126382_12277586 | Not Available | 523 | Open in IMG/M |
| 3300010323|Ga0134086_10266564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300010361|Ga0126378_11354255 | Not Available | 805 | Open in IMG/M |
| 3300010361|Ga0126378_11920066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300010361|Ga0126378_11976681 | Not Available | 664 | Open in IMG/M |
| 3300010361|Ga0126378_13455311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300010366|Ga0126379_10692678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1112 | Open in IMG/M |
| 3300010863|Ga0124850_1000623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8274 | Open in IMG/M |
| 3300011120|Ga0150983_11206269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300012021|Ga0120192_10125488 | Not Available | 542 | Open in IMG/M |
| 3300012201|Ga0137365_10007351 | All Organisms → cellular organisms → Bacteria | 8782 | Open in IMG/M |
| 3300012202|Ga0137363_10325858 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300012202|Ga0137363_10699793 | Not Available | 858 | Open in IMG/M |
| 3300012202|Ga0137363_11637006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300012205|Ga0137362_10895976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
| 3300012205|Ga0137362_11639411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300012207|Ga0137381_11264775 | Not Available | 631 | Open in IMG/M |
| 3300012209|Ga0137379_11229580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300012211|Ga0137377_10186161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1994 | Open in IMG/M |
| 3300012211|Ga0137377_10799077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 876 | Open in IMG/M |
| 3300012361|Ga0137360_10389540 | Not Available | 1173 | Open in IMG/M |
| 3300012362|Ga0137361_10216419 | Not Available | 1737 | Open in IMG/M |
| 3300012362|Ga0137361_10825514 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012917|Ga0137395_10496001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 879 | Open in IMG/M |
| 3300012930|Ga0137407_10777629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 904 | Open in IMG/M |
| 3300012948|Ga0126375_10136595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1523 | Open in IMG/M |
| 3300012951|Ga0164300_10083092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1363 | Open in IMG/M |
| 3300012961|Ga0164302_10970430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300012971|Ga0126369_10568908 | Not Available | 1200 | Open in IMG/M |
| 3300012971|Ga0126369_11533976 | Not Available | 756 | Open in IMG/M |
| 3300012971|Ga0126369_12222410 | Not Available | 636 | Open in IMG/M |
| 3300015359|Ga0134085_10435728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
| 3300016270|Ga0182036_11111306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300016294|Ga0182041_10245888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1453 | Open in IMG/M |
| 3300016294|Ga0182041_10393975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1176 | Open in IMG/M |
| 3300016294|Ga0182041_10418456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1144 | Open in IMG/M |
| 3300016357|Ga0182032_11086436 | Not Available | 686 | Open in IMG/M |
| 3300016387|Ga0182040_11538838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300016422|Ga0182039_11540843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300017657|Ga0134074_1061825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1269 | Open in IMG/M |
| 3300018078|Ga0184612_10076970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1740 | Open in IMG/M |
| 3300018431|Ga0066655_10116671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1525 | Open in IMG/M |
| 3300018433|Ga0066667_11917236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300020579|Ga0210407_10724019 | Not Available | 771 | Open in IMG/M |
| 3300021405|Ga0210387_10304228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1403 | Open in IMG/M |
| 3300021444|Ga0213878_10075120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1348 | Open in IMG/M |
| 3300025910|Ga0207684_10143839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2051 | Open in IMG/M |
| 3300025910|Ga0207684_10719413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300025910|Ga0207684_11202328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300025922|Ga0207646_10316177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1411 | Open in IMG/M |
| 3300025939|Ga0207665_11305717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300026319|Ga0209647_1176874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 824 | Open in IMG/M |
| 3300027643|Ga0209076_1073717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 971 | Open in IMG/M |
| 3300028878|Ga0307278_10046625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1966 | Open in IMG/M |
| 3300028878|Ga0307278_10062182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1686 | Open in IMG/M |
| 3300031474|Ga0170818_101756980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300031543|Ga0318516_10009756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4599 | Open in IMG/M |
| 3300031543|Ga0318516_10024171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3145 | Open in IMG/M |
| 3300031543|Ga0318516_10805575 | Not Available | 530 | Open in IMG/M |
| 3300031544|Ga0318534_10041556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2553 | Open in IMG/M |
| 3300031544|Ga0318534_10113848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1553 | Open in IMG/M |
| 3300031544|Ga0318534_10653846 | Not Available | 595 | Open in IMG/M |
| 3300031545|Ga0318541_10043826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2274 | Open in IMG/M |
| 3300031545|Ga0318541_10191814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1129 | Open in IMG/M |
| 3300031546|Ga0318538_10011264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3731 | Open in IMG/M |
| 3300031546|Ga0318538_10284119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 891 | Open in IMG/M |
| 3300031564|Ga0318573_10010887 | All Organisms → cellular organisms → Bacteria | 3836 | Open in IMG/M |
| 3300031564|Ga0318573_10500112 | Not Available | 654 | Open in IMG/M |
| 3300031573|Ga0310915_10315010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1106 | Open in IMG/M |
| 3300031640|Ga0318555_10064221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1886 | Open in IMG/M |
| 3300031640|Ga0318555_10122465 | Not Available | 1382 | Open in IMG/M |
| 3300031640|Ga0318555_10326571 | Not Available | 831 | Open in IMG/M |
| 3300031640|Ga0318555_10405517 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300031668|Ga0318542_10129136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
| 3300031679|Ga0318561_10424052 | Not Available | 731 | Open in IMG/M |
| 3300031680|Ga0318574_10090856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1679 | Open in IMG/M |
| 3300031680|Ga0318574_10324794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 895 | Open in IMG/M |
| 3300031681|Ga0318572_10050867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2230 | Open in IMG/M |
| 3300031681|Ga0318572_10931391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300031682|Ga0318560_10041626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2228 | Open in IMG/M |
| 3300031713|Ga0318496_10344960 | Not Available | 823 | Open in IMG/M |
| 3300031719|Ga0306917_10032291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 3374 | Open in IMG/M |
| 3300031719|Ga0306917_10058155 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
| 3300031719|Ga0306917_10067840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2462 | Open in IMG/M |
| 3300031719|Ga0306917_10113603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1962 | Open in IMG/M |
| 3300031719|Ga0306917_10229793 | Not Available | 1415 | Open in IMG/M |
| 3300031719|Ga0306917_11553262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300031724|Ga0318500_10323554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300031724|Ga0318500_10382725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300031724|Ga0318500_10483324 | Not Available | 621 | Open in IMG/M |
| 3300031744|Ga0306918_10083440 | Not Available | 2230 | Open in IMG/M |
| 3300031744|Ga0306918_10279314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1281 | Open in IMG/M |
| 3300031744|Ga0306918_10874486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300031744|Ga0306918_11042481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300031747|Ga0318502_10801262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300031748|Ga0318492_10035190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2271 | Open in IMG/M |
| 3300031751|Ga0318494_10163671 | Not Available | 1257 | Open in IMG/M |
| 3300031763|Ga0318537_10238737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300031765|Ga0318554_10801491 | Not Available | 526 | Open in IMG/M |
| 3300031777|Ga0318543_10027525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2183 | Open in IMG/M |
| 3300031777|Ga0318543_10255954 | Not Available | 781 | Open in IMG/M |
| 3300031778|Ga0318498_10143109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1088 | Open in IMG/M |
| 3300031779|Ga0318566_10065968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1743 | Open in IMG/M |
| 3300031780|Ga0318508_1192628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300031781|Ga0318547_10190079 | Not Available | 1223 | Open in IMG/M |
| 3300031782|Ga0318552_10055168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1891 | Open in IMG/M |
| 3300031782|Ga0318552_10204209 | Not Available | 1000 | Open in IMG/M |
| 3300031793|Ga0318548_10516442 | Not Available | 583 | Open in IMG/M |
| 3300031821|Ga0318567_10086504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1679 | Open in IMG/M |
| 3300031833|Ga0310917_10034815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3003 | Open in IMG/M |
| 3300031835|Ga0318517_10125986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1135 | Open in IMG/M |
| 3300031859|Ga0318527_10182303 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300031879|Ga0306919_10050839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2741 | Open in IMG/M |
| 3300031879|Ga0306919_10658179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 807 | Open in IMG/M |
| 3300031879|Ga0306919_10914208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300031890|Ga0306925_11473941 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300031896|Ga0318551_10852967 | Not Available | 531 | Open in IMG/M |
| 3300031897|Ga0318520_10861867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300031910|Ga0306923_10099392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3282 | Open in IMG/M |
| 3300031910|Ga0306923_10121746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2960 | Open in IMG/M |
| 3300031910|Ga0306923_10452341 | Not Available | 1456 | Open in IMG/M |
| 3300031910|Ga0306923_10664458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1163 | Open in IMG/M |
| 3300031912|Ga0306921_10093799 | All Organisms → cellular organisms → Bacteria | 3470 | Open in IMG/M |
| 3300031912|Ga0306921_12323643 | Not Available | 561 | Open in IMG/M |
| 3300031941|Ga0310912_10038154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3314 | Open in IMG/M |
| 3300031941|Ga0310912_10069321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2534 | Open in IMG/M |
| 3300031942|Ga0310916_10059424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2954 | Open in IMG/M |
| 3300031945|Ga0310913_10088799 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300031945|Ga0310913_10173436 | Not Available | 1499 | Open in IMG/M |
| 3300031945|Ga0310913_10269376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1198 | Open in IMG/M |
| 3300031946|Ga0310910_10167469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1690 | Open in IMG/M |
| 3300031954|Ga0306926_10026075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6801 | Open in IMG/M |
| 3300031954|Ga0306926_10648911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1284 | Open in IMG/M |
| 3300031954|Ga0306926_11753808 | Not Available | 706 | Open in IMG/M |
| 3300031954|Ga0306926_12255633 | Not Available | 604 | Open in IMG/M |
| 3300031959|Ga0318530_10097546 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300032001|Ga0306922_10198884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2151 | Open in IMG/M |
| 3300032010|Ga0318569_10368702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300032043|Ga0318556_10144641 | Not Available | 1224 | Open in IMG/M |
| 3300032068|Ga0318553_10200433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1040 | Open in IMG/M |
| 3300032076|Ga0306924_10089629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3460 | Open in IMG/M |
| 3300032076|Ga0306924_10157843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2598 | Open in IMG/M |
| 3300032076|Ga0306924_10408741 | Not Available | 1553 | Open in IMG/M |
| 3300032076|Ga0306924_10671245 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300032091|Ga0318577_10235061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 877 | Open in IMG/M |
| 3300032091|Ga0318577_10409708 | Not Available | 647 | Open in IMG/M |
| 3300032261|Ga0306920_100301766 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
| 3300032261|Ga0306920_101341273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300032261|Ga0306920_101350461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1023 | Open in IMG/M |
| 3300032261|Ga0306920_103697331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300033290|Ga0318519_10949686 | Not Available | 532 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.42% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.42% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.42% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.42% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.42% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_04563310 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MRQSLGNEIPDTAPYTEWLAIVGSIGVAVLVCAVLFSNGVLT |
| F24TB_111565962 | 3300000550 | Soil | MRQSLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGVLT* |
| AF_2010_repII_A01DRAFT_10649292 | 3300000580 | Forest Soil | MRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVVFSNGIVT* |
| AF_2010_repII_A1DRAFT_100197892 | 3300000597 | Forest Soil | MRESLEIPDTAAHVEWLAFVCAIVVAALFCAVLFSNGVLI* |
| AF_2010_repII_A1DRAFT_100821232 | 3300000597 | Forest Soil | EPLPMRESLKSQIPDTAPHIEWLAFVCAIVVAVLFCAVLFSNGVLT* |
| AF_2010_repII_A1DRAFT_100856482 | 3300000597 | Forest Soil | MADRRRKGGAMRESLGNEISAPYTEWLAVVGFIVVGCGLRVLFSNDILTRLHWSRH* |
| AF_2010_repII_A1DRAFT_101148461 | 3300000597 | Forest Soil | MRESLGNEIPDTAPYTEWLAIVGSIVLAVLVCAVLFSNGILT* |
| AP72_2010_repI_A10DRAFT_10186753 | 3300000651 | Forest Soil | VGAAMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVVFSNGIVT* |
| AF_2010_repII_A100DRAFT_10886601 | 3300000655 | Forest Soil | MRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVVFSNGIVT |
| AF_2010_repII_A001DRAFT_100288543 | 3300000793 | Forest Soil | MRESLGNEIPDTAPYTEWLAIVGSILVAVVVCAVLFSNGILT* |
| AF_2010_repII_A001DRAFT_100656622 | 3300000793 | Forest Soil | EPLPMRESLEIPDTAAHVEWLAFVCAIVVAALFCAVLFSNGVLI* |
| AF_2010_repII_A001DRAFT_100863642 | 3300000793 | Forest Soil | MRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT* |
| JGI25614J43888_101374402 | 3300002906 | Grasslands Soil | MRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGALT* |
| JGI25613J43889_101390841 | 3300002907 | Grasslands Soil | PVPMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGALT* |
| JGIcombinedJ51221_101983352 | 3300003505 | Forest Soil | MRASLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT* |
| Ga0063356_1036267012 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DTGPGADARIVGKIPDTAPYIEWLAIVCAIVVAVLFCAVLFSNGVLT* |
| Ga0066395_102008112 | 3300004633 | Tropical Forest Soil | MRESLRHEIPDTAPYTEWLAIVGSIIVAVVVCAVLFSNGILT* |
| Ga0066676_107522992 | 3300005186 | Soil | MRQSLGNEIPDTAPYTEWLAIVGSIGVAVLVCAVLFSNGVLT* |
| Ga0066388_1005230763 | 3300005332 | Tropical Forest Soil | MRESLESQIPDTAAHVEWLAFVSAIVVAALFCAVLFSNGVLI* |
| Ga0066388_1006301643 | 3300005332 | Tropical Forest Soil | MRESLECQIPDTAPHIEWLAFVCAIVVAALFCAVLFSNGVLT* |
| Ga0066388_1014727992 | 3300005332 | Tropical Forest Soil | MRESLGNEIPDTTPYTEWLTMVGSIVVAAVICAVLFSNGILT* |
| Ga0066388_1014933173 | 3300005332 | Tropical Forest Soil | MRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT* |
| Ga0066388_1023672652 | 3300005332 | Tropical Forest Soil | MADLRYAAMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNSILT* |
| Ga0066388_1029790352 | 3300005332 | Tropical Forest Soil | MRESLANEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT* |
| Ga0066388_1052458542 | 3300005332 | Tropical Forest Soil | MRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGVLT* |
| Ga0066388_1067419722 | 3300005332 | Tropical Forest Soil | VEVGAAMRESLGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT* |
| Ga0070713_1014807451 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRASLGNEIPDTAPYTEWLALVGSIVVAVLICAVLLSNGVLT* |
| Ga0070708_1003559222 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVSSGNEIPDTASQWLAIVGSILVAVLVCAVLFSNGILT* |
| Ga0070708_1012929112 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EVGAAMRESLGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT* |
| Ga0070707_1003678885 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAAMRESLGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT* |
| Ga0070707_1005605681 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RVSSGNEIPDTASQWLAIVGSILVAVMVCAVLFSNGIVT* |
| Ga0070707_1014007992 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SLGNEIPDTAPYTEWLALVGSIVVAVLICAVLLSNGVLT* |
| Ga0070698_1000846201 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DGRLKVEVGAAMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT* |
| Ga0070698_1001242002 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRESLGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT* |
| Ga0070698_1005421312 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MADLSRRGGAMRESSGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT* |
| Ga0070698_1005675412 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VDAAMRESLGNEIPDTAAYTEWLALVGSIAVAVLVCAVLFSNGILT* |
| Ga0070699_1001364353 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GGAMRQSLGNEIPDTAPYTEWLAIVGSIGVAVLVCAVLFSNGVLT* |
| Ga0070699_1004998041 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRASLRNEIPDTAPYTEWLALVGSIVVAVLVCAVLLSNGILT* |
| Ga0070699_1016328502 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GGAMRQSLGNEIPDTAPYTEWLAIVGSIGVAVLVCAVLF* |
| Ga0070697_1011526371 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MGGAMRGSLGNEIPDTTPYTEWLAIVGSIVVAVLVCAVLFSNGVLT* |
| Ga0066661_105814902 | 3300005554 | Soil | MRQSLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSDSILT* |
| Ga0066661_108040931 | 3300005554 | Soil | MREPLESQIPDTAPYIEWLAMAGSIIVAVLFCAALFSNS |
| Ga0066692_109288862 | 3300005555 | Soil | MRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLLSNGILT* |
| Ga0066707_105855531 | 3300005556 | Soil | MRQSLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT* |
| Ga0066700_104254561 | 3300005559 | Soil | VGAAMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT* |
| Ga0058697_100605831 | 3300005562 | Agave | MRETLGNESPDTAPCTEWLAIVGSIVVAVLVCAVLFSNGILT* |
| Ga0066703_107754401 | 3300005568 | Soil | MRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGA |
| Ga0066706_107304931 | 3300005598 | Soil | MRESLESQIPDTTPYIEWLAIVCSIVVAALFCAVLFS |
| Ga0068864_1016918732 | 3300005618 | Switchgrass Rhizosphere | MRESLGNEIPDMAAYTEWLALVGSIVVAVLVCAVLFSNGILT* |
| Ga0066905_1001579265 | 3300005713 | Tropical Forest Soil | MRESLESQIPDTAPHTEWLAFVCAVVVAVLFCAVLFSNGALT* |
| Ga0066905_1004401782 | 3300005713 | Tropical Forest Soil | MRESLECQIPDTAPHIEWLAFVCAIVVAVLFCAVLFSNGVLT* |
| Ga0066905_1004425282 | 3300005713 | Tropical Forest Soil | MRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT* |
| Ga0066905_1009525843 | 3300005713 | Tropical Forest Soil | MRESLGNEIPDTAPYTEWLAMVGSIVVAAVICAVLFSNGILT* |
| Ga0066905_1013691001 | 3300005713 | Tropical Forest Soil | MRESWGNQIPDTAPYTEWLAIVGSIVLAVLVCAVLFSN |
| Ga0066905_1017267222 | 3300005713 | Tropical Forest Soil | MRESLGNEIPDTTPYTEWLAIVGSIVVAALFCAVLFSNGVLT* |
| Ga0066905_1021095132 | 3300005713 | Tropical Forest Soil | MRESLGNEITDTAPYTEWLALVGSIVVAVLVCTVLFSNGILT* |
| Ga0066903_1005632712 | 3300005764 | Tropical Forest Soil | MADLGRKGGAMRELSGNEIPDTALYTEWLAIVGSIVVAAVVCAVLFSNGILT* |
| Ga0066903_1007984072 | 3300005764 | Tropical Forest Soil | VRESSGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT* |
| Ga0066903_1012943122 | 3300005764 | Tropical Forest Soil | MRESLGNEIPDTAPYTEWLAIVGSIVVAVAVCAVLFSNGILT* |
| Ga0066903_1030745941 | 3300005764 | Tropical Forest Soil | MRESSGNEIPDTAPYTEWLAIVGSIVAAVLVCAVLFSNGILT* |
| Ga0066903_1063788771 | 3300005764 | Tropical Forest Soil | MRESLGNEIPDTAPYTEWLAIVGSIVVAAVICAVLFSNGILT* |
| Ga0066903_1091193701 | 3300005764 | Tropical Forest Soil | GNEIPDTAPYTEWLAIVGSIVLAVLVCAVLFSNGILT* |
| Ga0070717_102410412 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDTGTVPMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGALT* |
| Ga0070717_102978832 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRESSGNEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT* |
| Ga0070717_103782892 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRASLGNEIPDTAPYTEWLALVGSIVVAVLVCAVL |
| Ga0070717_105548942 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRASLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLLSNGILT* |
| Ga0070717_107001623 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MADLVGAVMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVL |
| Ga0070717_111603602 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRESLRSEIPDTAPYTEWLAIVCSIVMAALFCAAMFSKGVLT* |
| Ga0075365_100147656 | 3300006038 | Populus Endosphere | MLEELEREIRDTAPYEEWLGVVGSIVVAALVCAVLFSGGILT* |
| Ga0070716_1016369672 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MREALESQIPDTAPYIEWLAMVGSIIVAVLFCAALFSNSILT* |
| Ga0070712_1005616512 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRESLESQIPDTTPYIEWLAMVGSIIVAVLFCAALFSNSILT* |
| Ga0066653_100948782 | 3300006791 | Soil | MRESSGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSDSILT* |
| Ga0066659_115522921 | 3300006797 | Soil | MRESLESQIPDTTPYIEWLAIVCSIVVAALFCAVLFSNGA |
| Ga0066660_112086912 | 3300006800 | Soil | MRESLGNEIPDTTPYTEWLAIVGSIVVAVLVCAVLFSNGVLT* |
| Ga0075421_1026136811 | 3300006845 | Populus Rhizosphere | MRETLGNETPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT* |
| Ga0075430_1000283363 | 3300006846 | Populus Rhizosphere | MAHTQMGDAMRDSWGSGIPDTELYTEWLTIVGSIVLAVLLCGVLFSQGALT* |
| Ga0075425_1001872862 | 3300006854 | Populus Rhizosphere | MRESLGNEIPDTAPYTEWLAIVGSILVAVLVCAVLFSNGILT* |
| Ga0075434_1019323932 | 3300006871 | Populus Rhizosphere | MRESLGHELPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT* |
| Ga0075429_1014543052 | 3300006880 | Populus Rhizosphere | MRESSGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT* |
| Ga0075435_1009160352 | 3300007076 | Populus Rhizosphere | VGAAMRESVGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT* |
| Ga0075418_107298121 | 3300009100 | Populus Rhizosphere | MLEELEREIRDTAPYEEWLGVVGSIVVAALVCAVLFSDGILT* |
| Ga0075418_127752101 | 3300009100 | Populus Rhizosphere | MRETLGNETPDTTPYTEWLAIVGSIVVAVLVCAVLFSNGILT* |
| Ga0075423_100806305 | 3300009162 | Populus Rhizosphere | LESQIPDTAPHIEWLAFVCAIMVAVLFCAVLFSNGVLT* |
| Ga0105104_102400901 | 3300009168 | Freshwater Sediment | GVLGAAMREFEGSGTPDTEPYAEWLAFVGSIVVAVLLCAVVFTQSSLT* |
| Ga0105104_105780891 | 3300009168 | Freshwater Sediment | MGGAMRESLESEIPDTAPYKEWLAVVGSIAVAVLIFVVLISNGVVVT* |
| Ga0126380_100199015 | 3300010043 | Tropical Forest Soil | MHEWLGSQIPDTAPYIEWLAIVCSVMAVLFCTVLFSHGVLT* |
| Ga0126380_110381012 | 3300010043 | Tropical Forest Soil | EWTQEPLPMRESLESQIPDTAAHVEWLAFVCAIVVAALFCAVLFSNGVLI* |
| Ga0126382_113752211 | 3300010047 | Tropical Forest Soil | GGAMRESLGNEIPDTAPYTEWLAPVGSIVVAVLVCAVLFSNGILT* |
| Ga0126382_122775861 | 3300010047 | Tropical Forest Soil | MRESLGNEIPGTAPYTEWLALVGSIVVAVLVCAVLFSNGILT |
| Ga0134086_102665642 | 3300010323 | Grasslands Soil | QIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGVLT* |
| Ga0126378_113542551 | 3300010361 | Tropical Forest Soil | MRESLGNEIPDTAPYTEWLAIVGSIVLEVLVCAVL |
| Ga0126378_119200661 | 3300010361 | Tropical Forest Soil | RLKVEVGAAMRESLGNEIPDTAPYTEWLALVSSIVVAVLVCAVLFSNGILT* |
| Ga0126378_119766812 | 3300010361 | Tropical Forest Soil | MRESLESQIPDTAPHIEWLAFVCAIMVAVLFCAVLKCRPN |
| Ga0126378_134553111 | 3300010361 | Tropical Forest Soil | RGGAMRESSGNEIPDTAPYTEWLAIVGSIVLAVLVCAVLFSNGILT* |
| Ga0126379_106926781 | 3300010366 | Tropical Forest Soil | EVGAAMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSDGIVT* |
| Ga0124850_100062310 | 3300010863 | Tropical Forest Soil | MAAKVEVGATMRESVGNEIPDTAPYTESLALVGSIIVAVLVC |
| Ga0150983_112062692 | 3300011120 | Forest Soil | EGGCDARIVGNEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT* |
| Ga0120192_101254882 | 3300012021 | Terrestrial | VHHVVDDVGGVGMGGAMRDTLDKRIPDTAPYKEWLAIVGSIAVAVLIFVVLFSNGVVVT* |
| Ga0137365_1000735112 | 3300012201 | Vadose Zone Soil | MRKSSGSEIPDTAPYVEWLAIVGSIVAAVLLCAVLFPNGVLT* |
| Ga0137363_103258582 | 3300012202 | Vadose Zone Soil | MRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGAL |
| Ga0137363_106997931 | 3300012202 | Vadose Zone Soil | MRESLGSEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT* |
| Ga0137363_116370062 | 3300012202 | Vadose Zone Soil | EVADKVEGGGAMRGSSGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT* |
| Ga0137362_108959762 | 3300012205 | Vadose Zone Soil | MRESLGSEIPDTAPYMEWLAIVCSIVVAALFCVVLFSNGVLT* |
| Ga0137362_116394111 | 3300012205 | Vadose Zone Soil | TQEPVPMRKSSGSEIPDTAPYVEWLAIVGSIVAAVLLCAVLFPNGVLT* |
| Ga0137381_112647751 | 3300012207 | Vadose Zone Soil | MRQSLGNEIPDTAPYTEWLAIVASIVVAVVVCAVLFSNGIL |
| Ga0137379_112295801 | 3300012209 | Vadose Zone Soil | SLGSEIPDTAPYTEWLAIVCSIVVAILVCAALFSNGALT* |
| Ga0137377_101861611 | 3300012211 | Vadose Zone Soil | SLGNEIPDTTPYTEWLAIVGSIVVAVLVCAVLFSNGVLT* |
| Ga0137377_107990771 | 3300012211 | Vadose Zone Soil | MRKSLGSQIPDTAPYMEWLAIVCSIVVAGLFCAVLFSNVVLT |
| Ga0137360_103895403 | 3300012361 | Vadose Zone Soil | MRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVL |
| Ga0137361_102164192 | 3300012362 | Vadose Zone Soil | MRESLGSEIPDTAPYTEWLAIVCSIVVAILVCAALFSNGALT* |
| Ga0137361_108255142 | 3300012362 | Vadose Zone Soil | MRESLGNEIPDTTPYTEWLAIVGSIVVAVLVCAVLFSNG |
| Ga0137395_104960011 | 3300012917 | Vadose Zone Soil | RTGEVADKVEGGGAMRVSSGNEIPDTAPYTQWLAIVGSIRVAVLVCAVLFSNGILT* |
| Ga0137407_107776292 | 3300012930 | Vadose Zone Soil | GNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT* |
| Ga0126375_101365953 | 3300012948 | Tropical Forest Soil | MRESLESQIPDTAPHIEWLAFVCAIVVAVLFCAVLFSNGVLT* |
| Ga0164300_100830921 | 3300012951 | Soil | MRESLESQIADTAAYTEWLAIVCSIVVAALFCAVLFSNGALT* |
| Ga0164302_109704301 | 3300012961 | Soil | SLGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT* |
| Ga0126369_105689081 | 3300012971 | Tropical Forest Soil | MRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNG |
| Ga0126369_115339761 | 3300012971 | Tropical Forest Soil | MLEWSGSQIPDMAPYIEWLAIVCSLNGGTVLFSHGVLT |
| Ga0126369_122224101 | 3300012971 | Tropical Forest Soil | MRASLGNEIPDTAPYTEWLAIVSSIVVAVLVCAVLFSNGIL |
| Ga0134085_104357281 | 3300015359 | Grasslands Soil | NEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT* |
| Ga0182036_111113062 | 3300016270 | Soil | GNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0182041_102458883 | 3300016294 | Soil | GDGRLKVEVGAAMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT |
| Ga0182041_103939753 | 3300016294 | Soil | RESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILI |
| Ga0182041_104184561 | 3300016294 | Soil | RRGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAAVVCAVLFSNGILT |
| Ga0182032_110864361 | 3300016357 | Soil | MRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLF |
| Ga0182040_115388382 | 3300016387 | Soil | WTQDPVPMRESLGSQIPDTAPYTEWLAIVCSIVVAALFCAVLFSNGVLT |
| Ga0182039_115408432 | 3300016422 | Soil | GNEIPDTAPYMEWLAIVGSILVAVLVCAVLFSNGILT |
| Ga0134074_10618251 | 3300017657 | Grasslands Soil | HREQQMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGALT |
| Ga0184612_100769704 | 3300018078 | Groundwater Sediment | MRESLGSGIPDTEPYTEWLAIVGSIVLAVLVCAIL |
| Ga0066655_101166712 | 3300018431 | Grasslands Soil | MRESLESQIPDTTPYIEWLAIVCSIVVAALFCAVLFSNGALT |
| Ga0066667_119172361 | 3300018433 | Grasslands Soil | MRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGALT |
| Ga0210407_107240191 | 3300020579 | Soil | VGAAMRASLGNEIPDTAPYTEWLALVGSIVVAVLICAVLLSNGV |
| Ga0210387_103042282 | 3300021405 | Soil | MRESLESQIPHTTPYIEWLAMVGSIIVAVLFCAALFSNSILT |
| Ga0213878_100751203 | 3300021444 | Bulk Soil | HCAERKGGGAMRESLGNEVSDTAPYTEWLALVGSIVVAVLVCAVLFSNGMLT |
| Ga0207684_101438393 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRESLRSEIPDTAPFTEWLAIVCSIVMAALFCAAMFSKGVLT |
| Ga0207684_107194132 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RWYKLIRMGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGVLT |
| Ga0207684_112023281 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LKVEVGAAMRASLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLLSNGILT |
| Ga0207646_103161772 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRESLGNEIPDTAAYTEWLALVGSIVVAVLVCAVLFSNGVLT |
| Ga0207665_113057171 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VGAVMRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT |
| Ga0209647_11768743 | 3300026319 | Grasslands Soil | MRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFS |
| Ga0209076_10737171 | 3300027643 | Vadose Zone Soil | GHRPVPMRESLESQIPDTAAYTEWLAIVCSIVVAALFCAVLFSNGALT |
| Ga0307278_100466252 | 3300028878 | Soil | MRESSGSEIPDTAPYMEWLAFVCSIVVAALFCAVLFSNVVLT |
| Ga0307278_100621823 | 3300028878 | Soil | MRESLGSEIPDTAPYMEWLAIVCSIAVAALFCAVLFSNGVLT |
| Ga0170818_1017569801 | 3300031474 | Forest Soil | GRLKVEVGAAMRASLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT |
| Ga0318516_100097563 | 3300031543 | Soil | MRESLGNEIPDTAPYTEWLAIVGSIVVAAVVCAVLFSNGILT |
| Ga0318516_100241715 | 3300031543 | Soil | MRESLESQIPDTAPHIEWLAFVCAIVVAVLFCAVLFSNAS |
| Ga0318516_108055751 | 3300031543 | Soil | MRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0318534_100415561 | 3300031544 | Soil | MRKSSGSEIPDTAPYVEWLAIVGSIVVAVLLCAVLFSNGVLT |
| Ga0318534_101138481 | 3300031544 | Soil | GSAMRESSGNEIPDTAPYTEWLAIVGSIVVAALVCAVLFSNGILT |
| Ga0318534_106538462 | 3300031544 | Soil | MRESLGNEIPDTAPYTEWLALVGSIVVAVVVCAVLF |
| Ga0318541_100438261 | 3300031545 | Soil | MRELSGNEIPDTAPYMEWLAIVGSILVAVLVCAVLFSNGILT |
| Ga0318541_101918141 | 3300031545 | Soil | EIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILI |
| Ga0318538_100112641 | 3300031546 | Soil | MRESLKSQIPDTAPHIEWLAFVCAIVVAVLFCAVLFSNAS |
| Ga0318538_102841192 | 3300031546 | Soil | MRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILI |
| Ga0318573_100108877 | 3300031564 | Soil | MRESLGNEIPDTAPYTEWLALVDSIVVAVLVCAVLFSNGILT |
| Ga0318573_105001121 | 3300031564 | Soil | AGQEMADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0310915_103150103 | 3300031573 | Soil | GGAMRESLGNELPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT |
| Ga0318555_100642211 | 3300031640 | Soil | MRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFS |
| Ga0318555_101224651 | 3300031640 | Soil | MRKSSGSEIPDTAPYVEWLAIVGSIVVAVLLCAVLFSNGV |
| Ga0318555_103265712 | 3300031640 | Soil | MRESLGNEIPDTAPYPEWLAPVGSIVVAVLVCAVLFSNG |
| Ga0318555_104055171 | 3300031640 | Soil | MRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT |
| Ga0318542_101291361 | 3300031668 | Soil | MRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSN |
| Ga0318561_104240521 | 3300031679 | Soil | MRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLF |
| Ga0318574_100908561 | 3300031680 | Soil | WQTQGRRGGAMRESLGNEIPDTEPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0318574_103247941 | 3300031680 | Soil | MRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLF |
| Ga0318572_100508673 | 3300031681 | Soil | MRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0318572_109313912 | 3300031681 | Soil | CGSARAMRELSGNEIPDTAPYMEWLAIVGSILVAVLVCAVLFSNGILT |
| Ga0318560_100416266 | 3300031682 | Soil | GGAMRESLGNEIPDTAPYMEWLALVGSIVVAVVVCAVLFSNGILT |
| Ga0318496_103449601 | 3300031713 | Soil | MVDLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCA |
| Ga0306917_100322911 | 3300031719 | Soil | MRESLGNEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT |
| Ga0306917_100581557 | 3300031719 | Soil | RRKGGGAMRESLGNEIPDTAPYTEWLALVDSIVVAVLVCAVLFSNGILT |
| Ga0306917_100678402 | 3300031719 | Soil | MRESLGNEIPDTAPYTEWLAIVGSIVVAVVVCAVLFSNGILT |
| Ga0306917_101136031 | 3300031719 | Soil | RESSGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0306917_102297931 | 3300031719 | Soil | MRELSGNEIPDTAPYMEWLAIVGSILVAVLVCAVLFSNGI |
| Ga0306917_115532622 | 3300031719 | Soil | GGAAMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT |
| Ga0318500_103235541 | 3300031724 | Soil | LKVIRGGGVMRESLGNEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT |
| Ga0318500_103827252 | 3300031724 | Soil | EMADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0318500_104833241 | 3300031724 | Soil | MRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGIL |
| Ga0306918_100834401 | 3300031744 | Soil | MVDLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAV |
| Ga0306918_102793144 | 3300031744 | Soil | RESVGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0306918_108744861 | 3300031744 | Soil | ESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT |
| Ga0306918_110424812 | 3300031744 | Soil | SSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0318502_108012622 | 3300031747 | Soil | NEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT |
| Ga0318492_100351901 | 3300031748 | Soil | MHEWLGSQIPDTAPYIEWLAIVCSVMAVLFCTVLF |
| Ga0318494_101636713 | 3300031751 | Soil | MRKSSGSEIPDTAPYVEWLAIVGSIVVAVLLCAVLFSNGVL |
| Ga0318537_102387372 | 3300031763 | Soil | RESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0318554_108014912 | 3300031765 | Soil | RKGGGAMRESLGNEIPDTAPYTEWLALVDSIVVAVLVCAVLFSNGILT |
| Ga0318543_100275251 | 3300031777 | Soil | MRESLGNEIPDTAPYTEWLALVGSIVVAALVCAVLFSNGILT |
| Ga0318543_102559542 | 3300031777 | Soil | MADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCA |
| Ga0318498_101431091 | 3300031778 | Soil | LRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0318566_100659681 | 3300031779 | Soil | MRESLGNEIPDTAPYMEWLALVGSIVVAVVVCAVLFSNGILT |
| Ga0318508_11926281 | 3300031780 | Soil | RLKVIRGGGVMRESLGNEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT |
| Ga0318547_101900793 | 3300031781 | Soil | MRESLGNEIPDTAPYTEWLAIVGSIIVAVVVCAVLFSNGILT |
| Ga0318552_100551686 | 3300031782 | Soil | LGNEIPDTAPYTEWLALVGSIVVAVVVCAVLFSNGILT |
| Ga0318552_102042092 | 3300031782 | Soil | MHNWLGSQIPDTAPYIEWLAIVCSVMAVLFCTVLFSLGVLT |
| Ga0318548_105164421 | 3300031793 | Soil | MRESLGNEIPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGI |
| Ga0318567_100865044 | 3300031821 | Soil | MVDLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0310917_100348154 | 3300031833 | Soil | MRESLGNEIPDTAPYTEWLALVGSIVAAVLVCAVLFSNGILT |
| Ga0318517_101259863 | 3300031835 | Soil | RESSGNEIPDTAPYTEWLAIVGSIVVAALVCAVLFSNGILT |
| Ga0318527_101823031 | 3300031859 | Soil | MRESLGNEIPDTAPYTEWLALVGSIVVAVVVCAVL |
| Ga0306919_100508397 | 3300031879 | Soil | EIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT |
| Ga0306919_106581791 | 3300031879 | Soil | LSGNEIPDTAPYMEWLAIVGSILVAVLVCAVLFSNGILT |
| Ga0306919_109142082 | 3300031879 | Soil | ESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0306925_114739411 | 3300031890 | Soil | RLKVEVGAAMRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGIVT |
| Ga0318551_108529672 | 3300031896 | Soil | NEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT |
| Ga0318520_108618673 | 3300031897 | Soil | MRESLGNEIPDTAPYTEWLALVGSIAVLVCAVLFSDGILT |
| Ga0306923_100993921 | 3300031910 | Soil | AMRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0306923_101217463 | 3300031910 | Soil | MADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0306923_104523415 | 3300031910 | Soil | MRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGIL |
| Ga0306923_106644581 | 3300031910 | Soil | AMRESSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILI |
| Ga0306921_100937991 | 3300031912 | Soil | MRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT |
| Ga0306921_123236432 | 3300031912 | Soil | MRESLGNEIPDTAPYTEWLALVGSIVVAVVVCAVLFSNGILT |
| Ga0310912_100381545 | 3300031941 | Soil | MRESSGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0310912_100693211 | 3300031941 | Soil | MHEWLGSQIPDTAPYIEWLAIVCSVMAVLFCTVLFSHGVLT |
| Ga0310916_100594244 | 3300031942 | Soil | MRESSGNEIPDTAPYTEWLAIVGSILVAVLVCAVLFSNGILT |
| Ga0310913_100887994 | 3300031945 | Soil | MRESLGNEIPDTAPYTEWLALVGSIVVAVLVCAALFSNGILT |
| Ga0310913_101734364 | 3300031945 | Soil | MADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVL |
| Ga0310913_102693761 | 3300031945 | Soil | SSENEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILI |
| Ga0310910_101674692 | 3300031946 | Soil | MRESLGNELPDTAPYTEWLAIVGSIIVAVLVCAVLFSNGILT |
| Ga0306926_100260758 | 3300031954 | Soil | MRESLGNEIPDTEPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0306926_106489111 | 3300031954 | Soil | VPMRKSSGSEIPDTAPYVEWLAIVGSIVVAVLLCAVLFSNGVLT |
| Ga0306926_117538081 | 3300031954 | Soil | MRESLGNEIPDTAPYTEWLAIVGSIVVAVVVCAVL |
| Ga0306926_122556332 | 3300031954 | Soil | AMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0318530_100975462 | 3300031959 | Soil | MRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGI |
| Ga0306922_101988843 | 3300032001 | Soil | MRESLGNEIPDTAPYTEWLAIVGSIVVALLVCAVLFSTAS |
| Ga0318569_103687022 | 3300032010 | Soil | MRESLGNEIPDTAPYTERLALVGSIVVAVLVCAVLF |
| Ga0318556_101446412 | 3300032043 | Soil | MHEWLGSQIPDTAPYIEWLAIVCSVRAVLFCTVLFSH |
| Ga0318553_102004333 | 3300032068 | Soil | EIPDTAPYTEWLAIVGSIVVAAVVCAVLFSNGILT |
| Ga0306924_100896294 | 3300032076 | Soil | VGAAMREPLGNEIPDTAPYTEWLTIVESIVVAVLVCAVLFSNGILT |
| Ga0306924_101578431 | 3300032076 | Soil | MRESSGNEIPDTAPYTEWLAIVGSIVVAALVCAVLFSNGILT |
| Ga0306924_104087415 | 3300032076 | Soil | MADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAV |
| Ga0306924_106712451 | 3300032076 | Soil | MRESLGNEIPDTAPYTEWLAIVGSIVVAAVICAVLFSNGIL |
| Ga0318577_102350612 | 3300032091 | Soil | GQEMADLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0318577_104097081 | 3300032091 | Soil | MRESVGNEIPDTAPYTEWLALVGSIVVAVLVCAVLFSN |
| Ga0306920_1003017661 | 3300032261 | Soil | GNDIPDTAPYTEWLALVGSIVVAVLVCAVLFSNGILT |
| Ga0306920_1013412731 | 3300032261 | Soil | DLRSKGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVLVCAVLFSNGILT |
| Ga0306920_1013504613 | 3300032261 | Soil | ARRGGAMRESLGNEIPDTAPYTEWLAIVGSIVVAVVVCAVLFSNGILT |
| Ga0306920_1036973311 | 3300032261 | Soil | GNEIPDTAPYTEWLAIVGSIAVAVLVCAVLFSNGILT |
| Ga0318519_109496862 | 3300033290 | Soil | GNEIPDTAPYTEWLALVGSIVVAVLVCAALFSNGILT |
| ⦗Top⦘ |