NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F017674

Metagenome / Metatranscriptome Family F017674

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017674
Family Type Metagenome / Metatranscriptome
Number of Sequences 239
Average Sequence Length 43 residues
Representative Sequence MKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIRSTASSIGIRN
Number of Associated Samples 187
Number of Associated Scaffolds 239

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 32.64 %
% of genes from short scaffolds (< 2000 bps) 88.70 %
Associated GOLD sequencing projects 174
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.590 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.481 % of family members)
Environment Ontology (ENVO) Unclassified
(34.728 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(54.812 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 50.68%    β-sheet: 0.00%    Coil/Unstructured: 49.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 239 Family Scaffolds
PF00005ABC_tran 8.79
PF09966DUF2200 7.11
PF03773ArsP_1 4.18
PF02777Sod_Fe_C 1.26
PF05016ParE_toxin 0.84
PF02537CRCB 0.84
PF13505OMP_b-brl 0.84
PF00950ABC-3 0.84
PF01545Cation_efflux 0.42
PF13202EF-hand_5 0.42
PF01934HepT-like 0.42
PF00296Bac_luciferase 0.42
PF02371Transposase_20 0.42
PF01494FAD_binding_3 0.42
PF02492cobW 0.42
PF11700ATG22 0.42
PF08693SKG6 0.42
PF13091PLDc_2 0.42
PF02627CMD 0.42
PF00106adh_short 0.42
PF01297ZnuA 0.42

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 239 Family Scaffolds
COG0701Uncharacterized membrane protein YraQ, UPF0718 familyFunction unknown [S] 4.18
COG0605Superoxide dismutaseInorganic ion transport and metabolism [P] 1.26
COG4606ABC-type enterochelin transport system, permease componentInorganic ion transport and metabolism [P] 0.84
COG1108ABC-type Mn2+/Zn2+ transport system, permease componentInorganic ion transport and metabolism [P] 0.84
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.84
COG0609ABC-type Fe3+-siderophore transport system, permease componentInorganic ion transport and metabolism [P] 0.84
COG0239Fluoride ion exporter CrcB/FEX, affects chromosome condensationCell cycle control, cell division, chromosome partitioning [D] 0.84
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.42
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.42
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.42
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.42
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.42
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.42
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.42
COG2361HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.42
COG2445Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 familyGeneral function prediction only [R] 0.42
COG3547TransposaseMobilome: prophages, transposons [X] 0.42
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.42
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.42


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.59 %
UnclassifiedrootN/A18.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_42137Not Available616Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101883772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1325Open in IMG/M
3300000956|JGI10216J12902_110314648Not Available508Open in IMG/M
3300002092|JGI24218J26658_1000026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii194311Open in IMG/M
3300002568|C688J35102_119073771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium634Open in IMG/M
3300004463|Ga0063356_103714619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium657Open in IMG/M
3300004463|Ga0063356_104893858Not Available576Open in IMG/M
3300005165|Ga0066869_10149568All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005176|Ga0066679_10454452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii838Open in IMG/M
3300005327|Ga0070658_10212426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1635Open in IMG/M
3300005327|Ga0070658_10647544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium917Open in IMG/M
3300005328|Ga0070676_10076442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2021Open in IMG/M
3300005328|Ga0070676_10156409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi1463Open in IMG/M
3300005330|Ga0070690_100296653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1158Open in IMG/M
3300005334|Ga0068869_100198559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1580Open in IMG/M
3300005335|Ga0070666_11396126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium523Open in IMG/M
3300005345|Ga0070692_10798464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium644Open in IMG/M
3300005347|Ga0070668_100479823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1073Open in IMG/M
3300005347|Ga0070668_101777857Not Available567Open in IMG/M
3300005353|Ga0070669_101043852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium702Open in IMG/M
3300005354|Ga0070675_100349695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1311Open in IMG/M
3300005354|Ga0070675_101438887Not Available636Open in IMG/M
3300005356|Ga0070674_101321252All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005367|Ga0070667_100892459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium827Open in IMG/M
3300005367|Ga0070667_102085410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2534Open in IMG/M
3300005438|Ga0070701_10604061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria727Open in IMG/M
3300005441|Ga0070700_100509748Not Available927Open in IMG/M
3300005441|Ga0070700_100662329All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300005455|Ga0070663_100146541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1807Open in IMG/M
3300005456|Ga0070678_100806764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae852Open in IMG/M
3300005466|Ga0070685_10718380All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300005467|Ga0070706_101209892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium694Open in IMG/M
3300005519|Ga0077119_10215732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium816Open in IMG/M
3300005540|Ga0066697_10324340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii901Open in IMG/M
3300005548|Ga0070665_100348839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1485Open in IMG/M
3300005548|Ga0070665_102589376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium508Open in IMG/M
3300005552|Ga0066701_10853250All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300005555|Ga0066692_10445897All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300005558|Ga0066698_10716418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria658Open in IMG/M
3300005560|Ga0066670_10505117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi743Open in IMG/M
3300005560|Ga0066670_10998541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae511Open in IMG/M
3300005575|Ga0066702_10839669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300005578|Ga0068854_101727118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium573Open in IMG/M
3300005586|Ga0066691_10563848Not Available678Open in IMG/M
3300005614|Ga0068856_100170318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2190Open in IMG/M
3300005617|Ga0068859_100257316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1836Open in IMG/M
3300005617|Ga0068859_101980802Not Available643Open in IMG/M
3300005618|Ga0068864_100193189All Organisms → cellular organisms → Bacteria → Proteobacteria1867Open in IMG/M
3300005718|Ga0068866_10747401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium675Open in IMG/M
3300005719|Ga0068861_100034913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii3721Open in IMG/M
3300005840|Ga0068870_11422006Not Available509Open in IMG/M
3300005841|Ga0068863_100444718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1271Open in IMG/M
3300005841|Ga0068863_102292944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium550Open in IMG/M
3300005842|Ga0068858_102597631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium500Open in IMG/M
3300005844|Ga0068862_100394505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1293Open in IMG/M
3300005937|Ga0081455_10044758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii3857Open in IMG/M
3300005983|Ga0081540_1002241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium15920Open in IMG/M
3300005983|Ga0081540_1006936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium8165Open in IMG/M
3300005983|Ga0081540_1010271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii6356Open in IMG/M
3300005983|Ga0081540_1010610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6220Open in IMG/M
3300005983|Ga0081540_1089743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1355Open in IMG/M
3300005983|Ga0081540_1291606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria562Open in IMG/M
3300006038|Ga0075365_10091233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2076Open in IMG/M
3300006038|Ga0075365_10683549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium725Open in IMG/M
3300006038|Ga0075365_10853830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium642Open in IMG/M
3300006177|Ga0075362_10123495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1227Open in IMG/M
3300006177|Ga0075362_10743253Not Available513Open in IMG/M
3300006178|Ga0075367_10036171All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2861Open in IMG/M
3300006178|Ga0075367_10075057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2039Open in IMG/M
3300006178|Ga0075367_10477347Not Available790Open in IMG/M
3300006195|Ga0075366_10595282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium685Open in IMG/M
3300006575|Ga0074053_11759760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium archetypum552Open in IMG/M
3300006605|Ga0074057_10868392Not Available562Open in IMG/M
3300006606|Ga0074062_12549435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1231Open in IMG/M
3300006797|Ga0066659_10516322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii960Open in IMG/M
3300006844|Ga0075428_102171983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium573Open in IMG/M
3300007255|Ga0099791_10619163Not Available530Open in IMG/M
3300009011|Ga0105251_10202694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae894Open in IMG/M
3300009012|Ga0066710_103865786Not Available561Open in IMG/M
3300009094|Ga0111539_11175337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium891Open in IMG/M
3300009094|Ga0111539_13319731Not Available518Open in IMG/M
3300009098|Ga0105245_12275781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae596Open in IMG/M
3300009137|Ga0066709_100602248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1565Open in IMG/M
3300009148|Ga0105243_12043982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium608Open in IMG/M
3300009148|Ga0105243_13037784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium509Open in IMG/M
3300009156|Ga0111538_12983422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.591Open in IMG/M
3300009162|Ga0075423_11786141All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300009177|Ga0105248_10972964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium958Open in IMG/M
3300009789|Ga0126307_10409935All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300009789|Ga0126307_10629215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium866Open in IMG/M
3300009797|Ga0105080_1031741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium600Open in IMG/M
3300009806|Ga0105081_1060398Not Available573Open in IMG/M
3300009840|Ga0126313_10970674All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300010036|Ga0126305_10458810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae846Open in IMG/M
3300010037|Ga0126304_10734987All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300010038|Ga0126315_10042887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA00022421Open in IMG/M
3300010040|Ga0126308_10167680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1396Open in IMG/M
3300010041|Ga0126312_11385019Not Available521Open in IMG/M
3300010042|Ga0126314_10341051Not Available1074Open in IMG/M
3300010044|Ga0126310_10633869Not Available801Open in IMG/M
3300010045|Ga0126311_10154510Not Available1637Open in IMG/M
3300010045|Ga0126311_10381780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae1080Open in IMG/M
3300010045|Ga0126311_11794074Not Available520Open in IMG/M
3300010166|Ga0126306_11383903Not Available582Open in IMG/M
3300010326|Ga0134065_10113508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium913Open in IMG/M
3300010359|Ga0126376_12709802All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300010360|Ga0126372_11214769All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300010373|Ga0134128_10576034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1253Open in IMG/M
3300010396|Ga0134126_12800338All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300010397|Ga0134124_11683857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.666Open in IMG/M
3300010399|Ga0134127_10792838All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300010399|Ga0134127_10925841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium928Open in IMG/M
3300010401|Ga0134121_10569474All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1054Open in IMG/M
3300011003|Ga0138514_100094698Not Available644Open in IMG/M
3300011422|Ga0137425_1091966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae729Open in IMG/M
3300012201|Ga0137365_10033801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3921Open in IMG/M
3300012203|Ga0137399_10420113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1117Open in IMG/M
3300012211|Ga0137377_11785257Not Available535Open in IMG/M
3300012212|Ga0150985_108604216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium797Open in IMG/M
3300012212|Ga0150985_109327557All Organisms → cellular organisms → Bacteria1447Open in IMG/M
3300012212|Ga0150985_112883674Not Available901Open in IMG/M
3300012212|Ga0150985_117010709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium606Open in IMG/M
3300012212|Ga0150985_122944845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae573Open in IMG/M
3300012469|Ga0150984_101951832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011533Open in IMG/M
3300012469|Ga0150984_106270664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium895Open in IMG/M
3300012469|Ga0150984_106815011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium527Open in IMG/M
3300012469|Ga0150984_109063087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium565Open in IMG/M
3300012685|Ga0137397_10288865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1222Open in IMG/M
3300012891|Ga0157305_10255377Not Available529Open in IMG/M
3300012903|Ga0157289_10012659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1682Open in IMG/M
3300012918|Ga0137396_10332141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1125Open in IMG/M
3300012922|Ga0137394_10267096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1463Open in IMG/M
3300012925|Ga0137419_11809518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria523Open in IMG/M
3300012941|Ga0162652_100028742Not Available822Open in IMG/M
3300012943|Ga0164241_11193940Not Available562Open in IMG/M
3300012957|Ga0164303_10990380Not Available597Open in IMG/M
3300012975|Ga0134110_10370953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria630Open in IMG/M
3300012977|Ga0134087_10798896Not Available511Open in IMG/M
3300012981|Ga0168316_101391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii7934Open in IMG/M
3300012985|Ga0164308_11746904Not Available578Open in IMG/M
3300014150|Ga0134081_10277145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria595Open in IMG/M
3300014326|Ga0157380_11509256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae725Open in IMG/M
3300015077|Ga0173483_10944526Not Available512Open in IMG/M
3300015241|Ga0137418_10904525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria648Open in IMG/M
3300015261|Ga0182006_1330445All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300015357|Ga0134072_10471771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium510Open in IMG/M
3300015359|Ga0134085_10044480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1764Open in IMG/M
3300015371|Ga0132258_11574980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1659Open in IMG/M
3300017792|Ga0163161_11217162All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300018000|Ga0184604_10098203All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300018000|Ga0184604_10105969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium877Open in IMG/M
3300018028|Ga0184608_10285401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium726Open in IMG/M
3300018053|Ga0184626_10007949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4101Open in IMG/M
3300018061|Ga0184619_10130151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1142Open in IMG/M
3300018072|Ga0184635_10211199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium773Open in IMG/M
3300018076|Ga0184609_10337012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium704Open in IMG/M
3300018422|Ga0190265_12222965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium651Open in IMG/M
3300018429|Ga0190272_10344952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1182Open in IMG/M
3300018429|Ga0190272_11900903All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300018433|Ga0066667_10128521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1746Open in IMG/M
3300018466|Ga0190268_10065269Not Available1527Open in IMG/M
3300018466|Ga0190268_10292743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium971Open in IMG/M
3300018469|Ga0190270_12287056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium archetypum601Open in IMG/M
3300018469|Ga0190270_12665448Not Available562Open in IMG/M
3300018476|Ga0190274_10075378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2568Open in IMG/M
3300018476|Ga0190274_11466508Not Available773Open in IMG/M
3300018476|Ga0190274_12528275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae611Open in IMG/M
3300018476|Ga0190274_12759825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium588Open in IMG/M
3300018920|Ga0190273_10125682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1487Open in IMG/M
3300018920|Ga0190273_10175531Not Available1311Open in IMG/M
3300019361|Ga0173482_10436341Not Available619Open in IMG/M
3300019377|Ga0190264_10159929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1177Open in IMG/M
3300019377|Ga0190264_10166010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1164Open in IMG/M
3300019377|Ga0190264_10360275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae919Open in IMG/M
3300019767|Ga0190267_11689986All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300022756|Ga0222622_11126512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium577Open in IMG/M
3300022878|Ga0247761_1011992All Organisms → cellular organisms → Bacteria1471Open in IMG/M
3300022891|Ga0247770_1179235All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300022903|Ga0247774_1057388All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300022911|Ga0247783_1246913All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300023267|Ga0247771_1011355All Organisms → cellular organisms → Bacteria2735Open in IMG/M
3300023274|Ga0247763_1024505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1744Open in IMG/M
3300024055|Ga0247794_10152070All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300025885|Ga0207653_10445596All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300025899|Ga0207642_10503269All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300025900|Ga0207710_10256428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi875Open in IMG/M
3300025900|Ga0207710_10534034All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300025903|Ga0207680_10124402All Organisms → cellular organisms → Bacteria → Proteobacteria1691Open in IMG/M
3300025908|Ga0207643_10016279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4055Open in IMG/M
3300025908|Ga0207643_10263072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1065Open in IMG/M
3300025908|Ga0207643_11109393Not Available510Open in IMG/M
3300025910|Ga0207684_11432695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium564Open in IMG/M
3300025920|Ga0207649_10336351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1114Open in IMG/M
3300025923|Ga0207681_10273152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1328Open in IMG/M
3300025933|Ga0207706_10166943All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1934Open in IMG/M
3300025935|Ga0207709_10184309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1477Open in IMG/M
3300025938|Ga0207704_11820880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium523Open in IMG/M
3300025972|Ga0207668_10550835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium999Open in IMG/M
3300026067|Ga0207678_10191651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1747Open in IMG/M
3300026118|Ga0207675_100896845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium903Open in IMG/M
3300026118|Ga0207675_101310646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae745Open in IMG/M
3300026142|Ga0207698_11356618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium726Open in IMG/M
3300026333|Ga0209158_1112678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1025Open in IMG/M
3300026538|Ga0209056_10119900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2092Open in IMG/M
3300027903|Ga0209488_10791562All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300028379|Ga0268266_10235216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1689Open in IMG/M
3300028380|Ga0268265_10031641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3822Open in IMG/M
3300028380|Ga0268265_10067196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2774Open in IMG/M
3300028380|Ga0268265_11337641All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300028380|Ga0268265_12343314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium540Open in IMG/M
3300028679|Ga0302169_10215175Not Available501Open in IMG/M
3300028710|Ga0307322_10141183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium638Open in IMG/M
3300028714|Ga0307309_10097811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium697Open in IMG/M
3300028793|Ga0307299_10180286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae795Open in IMG/M
3300028796|Ga0307287_10183191All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300028802|Ga0307503_10614568Not Available601Open in IMG/M
3300028803|Ga0307281_10027423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1690Open in IMG/M
3300028819|Ga0307296_10185164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1129Open in IMG/M
3300028824|Ga0307310_10246539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium857Open in IMG/M
3300028878|Ga0307278_10005220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium6231Open in IMG/M
3300029987|Ga0311334_10524854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae954Open in IMG/M
3300030905|Ga0308200_1152466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium535Open in IMG/M
3300031039|Ga0102760_10901546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium630Open in IMG/M
3300031058|Ga0308189_10061364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1081Open in IMG/M
3300031058|Ga0308189_10316773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium616Open in IMG/M
3300031094|Ga0308199_1139939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium568Open in IMG/M
3300031456|Ga0307513_10747099Not Available684Open in IMG/M
3300031507|Ga0307509_10092278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3096Open in IMG/M
3300031548|Ga0307408_102216430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae531Open in IMG/M
3300031730|Ga0307516_10040461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi4640Open in IMG/M
3300031824|Ga0307413_10381076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1099Open in IMG/M
3300031901|Ga0307406_11898022Not Available531Open in IMG/M
3300031903|Ga0307407_10903260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae678Open in IMG/M
3300031938|Ga0308175_100014945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium5996Open in IMG/M
3300031995|Ga0307409_101361342Not Available736Open in IMG/M
3300031996|Ga0308176_10229285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1767Open in IMG/M
3300032005|Ga0307411_10539303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium993Open in IMG/M
3300032126|Ga0307415_100296611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium paxllaeri1337Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.48%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil5.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.02%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.18%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere3.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.35%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.51%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.09%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.09%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.09%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.09%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.67%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.26%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.26%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza1.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.84%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.84%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.84%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.84%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.84%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic0.42%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.42%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.42%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.42%
Arabidopsis RootHost-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root0.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.42%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002092Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenomeEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005519Combined assembly of arab plate scrape CL_Col (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009797Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20EnvironmentalOpen in IMG/M
3300009806Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012981Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DT8EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022878Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L111-311C-4EnvironmentalOpen in IMG/M
3300022891Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L136-409B-6EnvironmentalOpen in IMG/M
3300022903Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6EnvironmentalOpen in IMG/M
3300022911Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5EnvironmentalOpen in IMG/M
3300023267Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L197-509C-6EnvironmentalOpen in IMG/M
3300023274Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L141-409B-4EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028679Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031039Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_003744602199352025SoilTAAFVAVFILWVVDVNFNGSRYTDAVTRMIREAVSSIGVR
INPhiseqgaiiFebDRAFT_10188377233300000364SoilMKAVGATFVXLFVLWVVXVXFNGSQYTXXAXRMIRPIASSIGSRF*
JGI10216J12902_11031464813300000956SoilMKAIAATFVALFVLWVVDVNFNGARYTDAAMRMIRSMASSIGIRN*
JGI24218J26658_1000026633300002092LenticMKAITAAFVAVFILWVVDVNLNGSRYTDAVTRMVRSAVSSIGVRT*
C688J35102_11907377113300002568SoilMKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIRHTASSIGIRN*
Ga0063356_10371461923300004463Arabidopsis Thaliana RhizosphereMKAIAAAFVALFILWVVDVNLNGGRYTYVVMQMIRSAASSIGIGN*
Ga0063356_10489385823300004463Arabidopsis Thaliana RhizosphereMKAITAAFVALFILWVVDVNLNGARYTAVVMQMIRAAASSIGIGN*
Ga0066869_1014956813300005165SoilMKAITAAFVAVFILWVFDVNLNGSRYTDAVTRMIRAAGSSIGVR*
Ga0066679_1045445213300005176SoilMKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIQQVASSIGIRT*
Ga0070658_1021242633300005327Corn RhizosphereMKAITAAFVAVFILWVVDVNLNGSRYTNVVVQMIRATVSSR*
Ga0070658_1064754423300005327Corn RhizosphereMKAIAAAFVALFVLWVVDVNFNGARYTDAAMRMYRSTVASIGVRN*
Ga0070676_1007644233300005328Miscanthus RhizosphereMKAVAAAFVALFILWVVDVNLNGGRYTEVVMQMIRSAASSSGIRN*
Ga0070676_1015640923300005328Miscanthus RhizosphereMKAVAAAFVALFILWVVDVNLNGARYTAAVMQMIRPLAASIGIRS*
Ga0070690_10029665313300005330Switchgrass RhizosphereMKAIAAAFVALFVLWVVDVNFNGSQYTDAAVRMIRPIASAFSRF*
Ga0068869_10019855913300005334Miscanthus RhizosphereMKAIAATFVALFVLWVVDVNFNGGRYTDAAMRMIRHTASSIGI*
Ga0070666_1139612623300005335Switchgrass RhizosphereMKAVTAAFVAVFILWVVDVNLNGGRYTGVVWQLVRAAALSLGFRI*
Ga0070692_1079846413300005345Corn, Switchgrass And Miscanthus RhizosphereMKAVTAAFVALFILWVVDVNLNGGRYTNALMQMIRPMASSIGIRN*
Ga0070668_10047982313300005347Switchgrass RhizosphereMKAVAATFVALFVLWVVDVNFNGGRYTDAAMRMIRSTATSIGI*
Ga0070668_10177785723300005347Switchgrass RhizosphereMKAVAAAFVAVFVLWVVDVNFNSGRYTNAAVQMIRPAASSIGIRI*
Ga0070669_10104385223300005353Switchgrass RhizosphereHRYECMKAITAAFVAVFILWVVDVNLNGSRYTDAVTRMIRAAVSSIGVRN*
Ga0070675_10034969533300005354Miscanthus RhizospherePHRYECMKAITAAFVAVFILWVVDVNLNGSRYTDAVTRMIRAAVSSIGVRN*
Ga0070675_10143888713300005354Miscanthus RhizospherePHRYECMKAITAAFVAVFILWVVDVNLNGSRYTDAVTRMIRSAVASIGVRN*
Ga0070674_10132125223300005356Miscanthus RhizosphereMKAITAAFVAVFILWVVDVNLNGSRYTDAVTRMIRSAVASIGVRN*
Ga0070667_10089245913300005367Switchgrass RhizosphereMKAITAAFVAVFILWVVDVNLNGSRYTDAVTRMIRAAVSSIGVRN*
Ga0070667_10208541013300005367Switchgrass RhizosphereMKAVTAAFVAVFILWVVDVNLNGGRYTGVVWQLVRAAALSLG
Ga0070701_1060406123300005438Corn, Switchgrass And Miscanthus RhizosphereMKALAAAFVALFVLWVVDVNFNGARYTDAAMRMIRATATSIGIRN*
Ga0070700_10050974813300005441Corn, Switchgrass And Miscanthus RhizosphereKAVTAAFVAVFILWVVDVNLNGGRYTDVVWQLVRAAALSLGFRI*
Ga0070700_10066232923300005441Corn, Switchgrass And Miscanthus RhizosphereMKALAAAFVALFVLWVVDVNFNGARYTDAAMRMYRSTVASIGVRN*
Ga0070663_10014654123300005455Corn RhizosphereMKAVAAAFVALFVLWVVDVNFNGGRYTDVAMRMIGPVASSIGIRN*
Ga0070678_10080676433300005456Miscanthus RhizosphereWPHPHRYECMKAITAAFVAVFILWVVDVNLNGSRYTDAVTRMIRSAVASIGVRN*
Ga0070685_1071838013300005466Switchgrass RhizosphereMKALAAAFVALFVLWVVDVNFNGARYTDAAMRMIRATATSIG
Ga0070706_10120989213300005467Corn, Switchgrass And Miscanthus RhizosphereVTAAFVALFILWVVDVNLNGGRYTDVVMGMIRSVASSIGVRN*
Ga0077119_1021573213300005519Arabidopsis RootMKAITAAFVAVFILWVVDVNLNGSRYTNVVVQMIRATVSSIRT*
Ga0066697_1032434013300005540SoilMKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIQQVASSIGIR
Ga0070665_10034883933300005548Switchgrass RhizosphereMKAVTSALIAVFILWVVDVNFNGGRYTDVVLQVIRAAASSLGFRI*
Ga0070665_10258937623300005548Switchgrass RhizosphereMKAVAAAFVALFILWVVDVNLNGYTAAVMQMIRPLAASIGIRS*
Ga0066701_1085325023300005552SoilMKAIAAAFVALFVLWVVDVNFNGARYTDAAMRMIRATASSIGIRN*
Ga0066692_1044589733300005555SoilMKAVAAAFVAVFVLWVVDVNFNGARYTDAAMRMIRSTASSIGVRI*
Ga0066698_1071641813300005558SoilMKAIAATFVALFVLWVVDVNFNGARYTDAAMRMIRSTASSIG
Ga0066670_1050511733300005560SoilLFVLWVVDVNFNGARYTDAAMRMIQQVASSIGIRT*
Ga0066670_1099854133300005560SoilMKAIAAAFVALFVLWVVDVNFNGARYTDAAMRMIR
Ga0066702_1083966913300005575SoilMKAIAAAFVALFVLWVVDVNFNGARYTDAAMRMIQQVASSIGIRT*
Ga0068854_10172711813300005578Corn RhizosphereITAAFVAVFILWVVDVNLNGSRYTNVVVQMIRATVSSIRT*
Ga0066691_1056384823300005586SoilMKAVAAAFVALLVLWVVDVNFNGARYSDAAMRMIQQVASSIGIRT*
Ga0068856_10017031853300005614Corn RhizosphereLFVLWVVDVNFNGARYTDAAMRMIRATATSIGIRN*
Ga0068859_10025731643300005617Switchgrass RhizosphereMKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIRHTASSIGI*
Ga0068859_10198080223300005617Switchgrass RhizosphereMKAVAAAFVALFILWVVDVNLNGARYTAAVMQMIRPLA
Ga0068864_10019318953300005618Switchgrass RhizosphereFVLWVVDVNFNGARYTDAAMRMYRSTVASIGVRN*
Ga0068866_1074740123300005718Miscanthus RhizosphereTFVALFVLWVVDVNFNGGRYTDAAMRMIRSTATSIGI*
Ga0068861_10003491333300005719Switchgrass RhizosphereMKAIAAAFVALFVLWVVDVNFNGARYTDAAMRMIRATATSIGIRN*
Ga0068870_1142200613300005840Miscanthus RhizosphereITAAFVAVFILWVVDVNLNGSRYTDAVTRMIRAAVSSIGVRN*
Ga0068863_10044471843300005841Switchgrass RhizosphereMKAVAAAFVALFILWVVDVNLNGGRYTEVVMQMIRSAASS
Ga0068863_10229294423300005841Switchgrass RhizosphereMKAVTAAFVALFILWVVDVNLNGGRYTEVVMQMIRSAASSSGIRN*
Ga0068858_10259763113300005842Switchgrass RhizosphereLFILWVVDVNLNGARYTAAVMQMIRPLAASIGIRS*
Ga0068862_10039450523300005844Switchgrass RhizosphereMKAVTAAFVALFILWVVDVNLNGGRYTYALMQMIRPMASSIGIRN*
Ga0081455_1004475863300005937Tabebuia Heterophylla RhizosphereMKAVGAAFVAVFVLWVVDVNFNGSRYTNVFVQMIRPAASSIGIRF*
Ga0081540_100224133300005983Tabebuia Heterophylla RhizosphereMKALGAAFVAVFVLWVVDVNFNGSQYTDAAVRMIRPIASSFSRF*
Ga0081540_100693673300005983Tabebuia Heterophylla RhizosphereMKAIAAAFVAVFVLWVVDVNFNGARYTDAAMRMIQKAGSSIGIRI*
Ga0081540_101027163300005983Tabebuia Heterophylla RhizosphereMKAVAAAFVALFVLWVVDVNFNGARYTDATMRMIRSVASSTGIRN*
Ga0081540_101061043300005983Tabebuia Heterophylla RhizosphereMKAIGATFVALFVLWVVDVNFNGSRYTDAAVRMIRPMASSLGVRI*
Ga0081540_108974333300005983Tabebuia Heterophylla RhizosphereMKAIAAAFVALFVLWVVDVNFNGARYTDAAMQMIRSSASAIGIRT*
Ga0081540_129160613300005983Tabebuia Heterophylla RhizosphereVFVLWVVDVNFNGSQYTDAAVRMIRPIASSFSRF*
Ga0075365_1009123313300006038Populus EndosphereMKAVSAAFVAVFILWVVDVNLNGGRYTEVVMQMIRLGASSIGIRN*
Ga0075365_1068354923300006038Populus EndosphereFVALFVLWVVDVNFNGARYTDAAMRMIRPLASSVGIRF*
Ga0075365_1085383023300006038Populus EndosphereMKAVGAAFVAVFVLWVVDVNFNGSRYTNVIVQMIRPAASSIGIRI*
Ga0075362_1012349523300006177Populus EndosphereMKAVVAAFVALFVLWVVDVNFNGARYTDAAMRMIRPLASSVGIRF*
Ga0075362_1074325313300006177Populus EndosphereMKAVTAAFVALFILWVVDVNLNGGRYTEVVMQMIRLGASSIGIRN*
Ga0075367_1003617123300006178Populus EndosphereMKAIAAAFVALFVLWVVDVNFNGARYTDAVMLLIRPAASSIGIRI*
Ga0075367_1007505713300006178Populus EndosphereMKAVAATFVALFVLWVVDVNFNGARYTDAVMRMIRPVAASIGIRN*
Ga0075367_1047734753300006178Populus EndosphereAIAAAFVALFVLWVVDVNFNGARYTDAAMRMIRATATSIGIRN*
Ga0075366_1059528233300006195Populus EndosphereVALFVLWVVDVNFNGARYTDAAMRMIRATATSIGIRN*
Ga0074053_1175976023300006575SoilVAAAFVALFVLWVVDVNFNGSQYTDAAVRMIRPIASAFSRF*
Ga0074057_1086839223300006605SoilMKAITAAFVAVFILWVVDVNLNGSRYTDVVTRMVRSAVSSIGVRT*
Ga0074062_1254943533300006606SoilAIAAAFVALFVLWVVDVNFNGSQYTDAAVRMIRPIASAFSRF*
Ga0066659_1051632233300006797SoilMKAVAAALIAVSVLWVVDVNFNGGRYTDAVVRMIRYTTSSIGIRT*
Ga0075428_10217198313300006844Populus RhizosphereMKAVAATFVALFVLWVVDVNFNGARYTDAAMRMIRPLASSVGIRF*
Ga0099791_1061916313300007255Vadose Zone SoilMKAITAAFVAVFVLWVVDVNFNGGRYTDAVVQMIRLTASSIGIRI*
Ga0105251_1020269423300009011Switchgrass RhizosphereQSMKAVAAAFVALFILWVVDVNLNGGRYTEVVMQMIRSAASSSGIRN*
Ga0066710_10386578613300009012Grasslands SoilFMKAVAAAFVALFVLWVVDVNFNGGRYTDAATRMIRPAALSIGIRI
Ga0111539_1117533723300009094Populus RhizosphereMKAIAAAFVALFVLWVVDGNFNGARYTDAAMRMIRATATSIGIRN*
Ga0111539_1331973113300009094Populus RhizosphereMKAVSAAFVAVFILWVVDVNLNGGRYTEVVMQVIRAGVSSIGIRT*
Ga0105245_1227578113300009098Miscanthus RhizosphereMKAVAAAFVALFILWVVDVNLNGARYTAAVMQMIRPLAASIG
Ga0066709_10060224823300009137Grasslands SoilMKAIAATFVALFILWVVDVNFNGARYTDAAMRMIRSTASLIGIRN*
Ga0105243_1204398223300009148Miscanthus RhizosphereVALFVLWVVDVNFNGARYTDAAMRMYRSTVASIGVRN*
Ga0105243_1303778413300009148Miscanthus RhizosphereFVALFILWVVDVNLNGGRYTYALMQMIRPMASSIGIRN*
Ga0111538_1298342223300009156Populus RhizosphereMKAVSAAFVAVFILWVVDVNLNGGRYTEVVMQVIRAGASSIGIRT*
Ga0075423_1178614113300009162Populus RhizosphereMKAIAAAFVALFVLWVVDVNFNGARYTDAAMRMIRATATLIGIRN*
Ga0105248_1097296423300009177Switchgrass RhizosphereAAAFVALFVLWVVDVNFNGARYTDAAMRMYRSTVASIGVRN*
Ga0126307_1040993533300009789Serpentine SoilMKAVAAAFVALFILWVVDVNLNGGRYTNVVMQMIRSAASSIGIRN*
Ga0126307_1062921523300009789Serpentine SoilMKPVAAAFVAVFILWVVDVNLNGARYTAAVMQMIRPLAASIGIRN*
Ga0105080_103174123300009797Groundwater SandMKAVAAAFVAVFVLWVVDVNFNGARYTDAAMRMIRSTAASIGVRN*
Ga0105081_106039813300009806Groundwater SandMKAVAAAFVALFVLWVVDVNFNGGRYTDAAIRMIRPMASSIGIRT*
Ga0126313_1097067413300009840Serpentine SoilMKAVTAAFVAVFILWVVDVNLNGGRYTGVVWQLIRAAAL
Ga0126305_1045881023300010036Serpentine SoilMKAVAAAFVALFILWVVDVNLNGGRYTGIVMQMIRLGASSIGIRN*
Ga0126304_1073498723300010037Serpentine SoilVFVLWVVDVSLNGGRFTEVVMQMIRLGASSIGIRN*
Ga0126315_1004288753300010038Serpentine SoilMKAVAAAFVALFILWVVDVNLNGGRYTGAVMRMIQSVASSSGIRN*
Ga0126308_1016768023300010040Serpentine SoilMKAVTAAFVALFILWVVDVNLNGGRYTDVVMQMIRSAASSSGIRN*
Ga0126312_1138501923300010041Serpentine SoilMKAVAAAFVALFILWVVDVNLNGGRYTGVVMRMIQSVASSSGIRN*
Ga0126314_1034105123300010042Serpentine SoilMKAVAAAFVALFILWVVDVNLNGGRYTGVVMQMIRLGASSIGIRN*
Ga0126310_1063386923300010044Serpentine SoilMKAVAAAFVALFILWVVDVNLNGGRYTEVAMQLIRLGASSIGIRN*
Ga0126311_1015451033300010045Serpentine SoilMKAISAAFVAVFVLWVVDVSLNGGRFTEVVMQMIRLGASSIGIRN*
Ga0126311_1038178023300010045Serpentine SoilMKPVAAAFVAVFILWVVDVNLNGARYTAAVMQMIRPLAASIGIRS*
Ga0126311_1179407413300010045Serpentine SoilMKAIAAAFVALFILWVVDVNLNGGRYTEVTMRMIRLGASSIGIRN*
Ga0126306_1138390323300010166Serpentine SoilMKAVAAAFVALFILWVVDVNLNGGRYTGIVMQMIRLGASSIGIRN
Ga0134065_1011350823300010326Grasslands SoilMKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIQHVASSIGIRT*
Ga0126376_1270980223300010359Tropical Forest SoilMKALGATLIAVFVLWVVDVNFNGARYTDAAMRMIRATATSIGIRN*
Ga0126372_1121476913300010360Tropical Forest SoilMKALGATFVAVFVLWVVDVNFNGSQYTDAAVRMIRPIAASFSRF*
Ga0134128_1057603433300010373Terrestrial SoilMKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIRATATSIGIRN*
Ga0134126_1280033813300010396Terrestrial SoilMKAIAAAFVALFVLWVVDVNFNGGRYTDAAMRMIRSTATSIGI*
Ga0134124_1168385713300010397Terrestrial SoilMKAIAAAFVALFVLWVVDVNFNGARYTDAAMRMIRHTASSIGI*
Ga0134127_1079283833300010399Terrestrial SoilMKAVAAAFVALFILWVVDVNLNGGRYTEVVMQVIRAGASSIGIRT*
Ga0134127_1092584123300010399Terrestrial SoilMKAVAAAFVALFILWVVDVNLNGGRYTYVVMQMIRSAATSIRIGN*
Ga0134121_1056947423300010401Terrestrial SoilMKAVAAAFVALFVLWLVDVNFNGARYTDAAMRMIRHTASSIGI*
Ga0138514_10009469823300011003SoilMKAVTAAFVAVFILWVVDVNLNGGRYTEVVMQMIRLGASSIGIRN*
Ga0137425_109196613300011422SoilMKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIRSIASSIGI*
Ga0137365_1003380143300012201Vadose Zone SoilMKAVTAAFVAVFVLWVVDVNFNGGRYTDAAVQMIRLAASSIGIRI*
Ga0137399_1042011313300012203Vadose Zone SoilMKAVAAAFVAVFVLWVVDVNFNGARYADAAMRMIRSTASSIGVRI*
Ga0137377_1178525723300012211Vadose Zone SoilMKAVAATFVAVFVLWVVDVNFNGARYTDAAMRMIRSTASSIGVRN*
Ga0150985_10860421613300012212Avena Fatua RhizosphereAAFVAVFVLWVADVSLNGGRYTEVVMQLIRLGASSIGIRN*
Ga0150985_10932755733300012212Avena Fatua RhizosphereMKAVAAAFVALFVLWVVDVNFNGARYTDAAMQMIRHTASSIGIRN*
Ga0150985_11288367413300012212Avena Fatua RhizosphereLHAFVAVFVLWVVDVSLNGGRFTEVVMQMIRLGASSIGIRN*
Ga0150985_11701070933300012212Avena Fatua RhizosphereAAFVALFVLWVVDVNFNGARYTDAAMRMIRHTASSIGIRN*
Ga0150985_12294484513300012212Avena Fatua RhizosphereTAALVAVFILWVVDVNLNGSRYTGVVVQMVRATFSR*
Ga0150984_10195183223300012469Avena Fatua RhizosphereVAVFILWVVDVNLNGSRYTNVVVQMIRATVSSIRT*
Ga0150984_10627066413300012469Avena Fatua RhizosphereMKAVSAAFVAVFVLWVADVSLNGGRYTEVVMQLIRLGASSIGIRN*
Ga0150984_10681501123300012469Avena Fatua RhizosphereAAFVALFVLWVVDVNFNGARYTDAAMQMIRHTASSIGIRN*
Ga0150984_10906308713300012469Avena Fatua RhizosphereAFVALFVLWVVDVNFNGARYTDAAMRMIRSTAASIGIRN*
Ga0137397_1028886513300012685Vadose Zone SoilMKAVTAAFVAVFVLWVVDVNFNGGRYTGAALQMIRLVASSIGIRI*
Ga0157305_1025537723300012891SoilVAVFILWVVDVNLNGSRYTDAVTRMIRSAVASIGVRN*
Ga0157289_1001265943300012903SoilKAITSALIAVFILWVVDVNFNGGRYTDVVLQVIRAAASSLGFRI*
Ga0137396_1033214123300012918Vadose Zone SoilMKSITAAFVAVFVLWVVDVNFNGGRYTDAAVQVIRLAASSIGIRI*
Ga0137394_1026709623300012922Vadose Zone SoilMKAVTAAFVAVFVLWVVDVNFNGGRYTDAAVQVIRLAASSIGIRI*
Ga0137419_1180951823300012925Vadose Zone SoilVAVFVLWVVDVNFNGGRYTDAAVQVIRLAASSIGIRI*
Ga0162652_10002874223300012941SoilMKAVSAAFVALFILWVVDVNLNGGRYTGAVMQMIRLGASSIGIRN*
Ga0164241_1119394013300012943SoilMKAIAAAFVALFVLWVVDVNFNGSRYTDATMRMIRSASSTGIRN*
Ga0164303_1099038023300012957SoilMKAVAATFVAVFVLWVVDVNFNGGRYTDAAMRMIRPVASSIGIRN*
Ga0134110_1037095323300012975Grasslands SoilMKAIAATFVALFVLWVVDVNFNGARYTDAAMRMIRSTASSIGIRN*
Ga0134087_1079889613300012977Grasslands SoilMKAIAATFVALFVLWVVDVNFNGARYTDAAMRMIRSTASLIGIRN*
Ga0168316_10139153300012981Weathered Mine TailingsMKAITAAFVAVFILWVVDVNLNGSRYTDVVTRMIRAMVSSIGTRN*
Ga0164308_1174690413300012985SoilMKAITAAFVAVFILWVVDVNLNGSRYTDAVTRMIRAAVSSIGVLN*
Ga0134081_1027714523300014150Grasslands SoilMKAVGAAFVAVFVLWVVDVNFNGARYTDAAMRMIRQAASSIGVRT*
Ga0157380_1150925613300014326Switchgrass RhizosphereIAAAFVALFVLWVVDFNFNGARYTDAAMRMIRATATSIGIRN*
Ga0173483_1094452613300015077SoilMKAIAAAFVALFILWVVDVNLNGGRYTEVVMQMIRSAASSSGIRN*
Ga0137418_1090452523300015241Vadose Zone SoilMKAVAAAFVAVFVLWVVDVNFNGGRYTDAAVQVIRLAASSIGIRI*
Ga0182006_133044513300015261RhizosphereMKALAAAFVALFVLWVVDVNFNGARYTDAAMRMIR
Ga0134072_1047177123300015357Grasslands SoilMKAVTAAFVALFVLWVVDVNFNGARYTDAAMRMIQQVASSIGIRT*
Ga0134085_1004448043300015359Grasslands SoilMKAVAAALIAVSVLWVVDVNFNGARYTDAVVRMIRYTTSSIGIRT*
Ga0132258_1157498023300015371Arabidopsis RhizosphereMKAIAATFVALFVLWVVDVNFAGGRYTDAIMRMMRPVAASIGIRN*
Ga0163161_1121716223300017792Switchgrass RhizosphereMKAIAAAFVALFVLWVVDVNFNGARYTDAAMRMIRATATSIGIRN
Ga0184604_1009820313300018000Groundwater SedimentMKAVAAAFVALFILWVVDVNLNGGRYTAAVMQMIRLGASSIGIRN
Ga0184604_1010596913300018000Groundwater SedimentMKAVAAAFVAVFVLWVVDVNFNGARYTDAAMRMIRATTSSIGIRN
Ga0184608_1028540113300018028Groundwater SedimentMKAVTAAFVALFILWVVDVNLNGGRYTGAVMQMIRLGASSIGIRN
Ga0184626_1000794963300018053Groundwater SedimentMKAVTAAFVAVFVLWVVDVNFNGGRYTGAAVQLIRLAASSIGIRI
Ga0184619_1013015123300018061Groundwater SedimentMKAVAAALIAVFVLWVVDVNFNGARYTDAVVRMIRSTASSIGVRI
Ga0184635_1021119923300018072Groundwater SedimentMKAVAAAFVAVFVLWVVDVNFNGGRYTDAAMRMIRSTASSIGIRN
Ga0184609_1033701223300018076Groundwater SedimentMKAVAATFVALFVLWVVDVNFNGARYTDAAMRMIRSTASSIGIRN
Ga0190265_1222296523300018422SoilMKAIAATFVALFVLWVVDVNFNGARYTDAAMRMIRSTASSIGIRN
Ga0190272_1034495223300018429SoilMKAIAAAFVALFVLWVVDVNFNGARYTDAAMRMIRSTASSIGIRN
Ga0190272_1190090323300018429SoilMKAVAAAFVAVFVLCVVDVNFHGSRYTDAAMRMIRSTVSSIGVRN
Ga0066667_1012852123300018433Grasslands SoilMKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIQQVASSIGIRT
Ga0190268_1006526923300018466SoilMKAIAAAFVALFVLWVVDVNFNGARYTDAAMRMIRSTASSIGVRN
Ga0190268_1029274323300018466SoilMKAIAAAFVAVFILWVVDVNLNGSRYTDAVTRMVRSAVSSIGVRN
Ga0190270_1228705613300018469SoilMKAVTAAFVAVFVLWVVDVNFNGGRYTDALVQMVRSIGVRI
Ga0190270_1266544823300018469SoilAAFVAVFILWVVDVNLNGSRYTDAVTRMVRSAVSSIGVRN
Ga0190274_1007537823300018476SoilMKAIAAAFVALFILWVVDVNLNGGRYTYVVMQMIRSAASSIGIRN
Ga0190274_1146650823300018476SoilMKAITAAFVAMFILWVVDVNLNGSRYTDAVTRMVRSAVSSIGVRN
Ga0190274_1252827513300018476SoilMKAVAAAFVAVFVLWVVDVNFNGARYTDAAMRMIRSTA
Ga0190274_1275982513300018476SoilVAAAFVALFILWVVDVNLNGARYSAAVMQMIRPLAASIGIRN
Ga0190273_1012568213300018920SoilMKAVTSALIAVFILWVVDVNFNGGRYTDVVLQVIRAAASSLGFRI
Ga0190273_1017553113300018920SoilMKAIAAAFVALFILWVVDVNLNGGRYTYVVMQMIRSAASSIGIRI
Ga0173482_1043634113300019361SoilMKAVTAAFVAVFILWVVDVNLNGGRYTGVVWQLVRAAALSLGFRI
Ga0190264_1015992933300019377SoilMKAVTAAFVAVFILWVVDVNLNGGRYTGVVWQLIRAAASSVGVRI
Ga0190264_1016601033300019377SoilMKAITAAFVAVFILWVVDVNLNGSRYTDAVTRMVRSAVSSIGVRN
Ga0190264_1036027523300019377SoilMKTVAAAFVAVFVLWVVDVNFNGGRYTDAATRMIRSAASSIGVRN
Ga0190267_1168998613300019767SoilMKAITAAFVAVFILWVVDVNLNGSRYTDAVTRMIRA
Ga0222622_1112651223300022756Groundwater SedimentMKAVAAAFVALFVLWVVDVNFNGGRYTDVAVRMIRPLASSIGIRN
Ga0247761_101199233300022878Plant LitterMKAVTSALVAVFILWVVDVNFNGGRYTDVVLHVIRA
Ga0247770_117923513300022891Plant LitterMKAVTSALVAVFILWVVDVNFNGGRYTDVVLQVIRAAALSLGFRI
Ga0247774_105738813300022903Plant LitterMKAVTSALVAVFILWVVDVNFNGGRYTDVVLQVIRAAASSLGFRI
Ga0247783_124691323300022911Plant LitterMKAVTSALIAVFILWVVDVNFNGGRYTDVVLQVIRA
Ga0247771_101135513300023267Plant LitterMKAITSALIAVFILWVVDVNFNGGRYTDVVLQVIRAAASSLGFRI
Ga0247763_102450523300023274Plant LitterMKAVTSALVAVFILWVVDVNFNGGRYTDVVLQVIRAAALSLGYRI
Ga0247794_1015207013300024055SoilMKAITAAFVAVFILWVVDVNLNGSRYTNVVVQMIRATVSSR
Ga0207653_1044559623300025885Corn, Switchgrass And Miscanthus RhizosphereMKAVAATFVALFVLWVVDVNFNGGRYTDAAMRMIRHTASSIGI
Ga0207642_1050326913300025899Miscanthus RhizosphereMKAITAAFVAVFILWVVDVNLNGSRYTDAVTRMIRAAVSSIGVRN
Ga0207710_1025642823300025900Switchgrass RhizosphereMKALAAAFVALFVLWVVDVNFNGARYTDAAMRMYRSTVASIGVRN
Ga0207710_1053403423300025900Switchgrass RhizosphereMKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIRHTASSIGI
Ga0207680_1012440243300025903Switchgrass RhizosphereVALFVLWVVDVNFNGARYTDAAMRMIRATATSIGIRN
Ga0207643_1001627923300025908Miscanthus RhizosphereMKAVAAAFVALFILWVVDVNLNGARYTAAVMQMIRPLAASIGIRS
Ga0207643_1026307223300025908Miscanthus RhizosphereMKAITAAFVAVFILWVVDVNLNGSRYTDAVTRMIRSAVASIGVRN
Ga0207643_1110939313300025908Miscanthus RhizosphereITAAFVAVFILWVVDVNLNGSRYTDAVTRMIRAAVSSIGVRN
Ga0207684_1143269523300025910Corn, Switchgrass And Miscanthus RhizosphereMKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIRSTATSIGIRN
Ga0207649_1033635113300025920Corn RhizosphereMKALAAAFVALFVLWVVDVNFNGARYTDAAMRMIRATATSIGIRN
Ga0207652_1114808013300025921Corn RhizospherePLQKDTKSELRPCPHRCERMKAITAAFVAVFILWVVDVNLNGSRYTNVVVQMIRATVSSR
Ga0207681_1027315223300025923Switchgrass RhizosphereMKAVAATFVALFVLWVVDVNFNGGRYTDAAMRMIRSTATSIGI
Ga0207706_1016694343300025933Corn RhizosphereAFVALFVLWVVDANFNGARYTDAAMRMIRATATSIGIRN
Ga0207709_1018430923300025935Miscanthus RhizosphereMKAIAATFVALFVLWVVDVNFNGGRYTDAAMRMIRHTASSIGI
Ga0207704_1182088023300025938Miscanthus RhizosphereFVALFILWVVDVNLNGARYTAAVMQMIRPLAASIGIRS
Ga0207668_1055083523300025972Switchgrass RhizosphereMKALAAAFVTLFVLWVVDVNFNGARYTDAAMRMYRSTVASIGVRN
Ga0207678_1019165123300026067Corn RhizosphereMKAVAAAFVALFVLWVVDVNFNGGRYTDVAMRMIGPVASSIGIRN
Ga0207675_10089684513300026118Switchgrass RhizosphereFMKAVAAAFVALFILWVVDVNLNGARYTAAVMQMIRPLAASIGIRS
Ga0207675_10131064633300026118Switchgrass RhizosphereMKAITAAFVAVFVLWVVDVNFNGSQYTDAAVRMIRPIASAIGGRF
Ga0207698_1135661823300026142Corn RhizosphereMKAITAAFVAVFILWVVDVNLNGSRYTNVVVQMIRATVSSIRT
Ga0209158_111267823300026333SoilMKAVAAAFVALLVLWVVDVNFNGARYTDAAMRMIQQVASSIGIRT
Ga0209056_1011990013300026538SoilMKAVAAALIAVSVLWVVDVNFNGARYTDAVVRMIRSTTSSIGIRT
Ga0209488_1079156223300027903Vadose Zone SoilMKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIRHTASSIGIRN
Ga0268266_1023521623300028379Switchgrass RhizosphereMKAVAAAFVALFILWVVDVNLNGYTAAVMQMIRPLAASIGIRS
Ga0268265_1003164113300028380Switchgrass RhizosphereMKAVAAAFVALFILWVVDVNLNGGRYTEVVMQMIRSAASSSGIRN
Ga0268265_1006719643300028380Switchgrass RhizosphereMKAVAATFVALFVLWVVDVNFNGGRYTDAAMRMIRSTATSI
Ga0268265_1133764123300028380Switchgrass RhizosphereMKAVAATFVALFVLWVVDVNFNGGRYTDAAMRMIR
Ga0268265_1234331423300028380Switchgrass RhizosphereMKAVTAAFVALFILWVVDVNLNGGRYTYALMQMIRPMASSIGIRN
Ga0302169_1021517513300028679FenAFVAVFILWVVDVNLNGSRYTDAATRMIRAAVSSIGVRN
Ga0307322_1014118323300028710SoilAAFVAVFILWVVDVNLNGGRYTEVVMQMIRLGASSIGIRN
Ga0307309_1009781123300028714SoilMKAIAAAFVALFILWVVDVNLNGGRYTYVVMQMIRSAASSIGIGN
Ga0307299_1018028633300028793SoilMKAVAAAFVAVFVLWVVDVNFNSGRYTNAAVQMIRPAA
Ga0307287_1018319113300028796SoilMKAVAAAFVALFVLWVVDVNFNGSRYTDVVMRMIRPVASSIGIRN
Ga0307503_1061456813300028802SoilRYECMKAITAAFVAMFILWVVDVNLNGSRYTDAVTRMIRAAVSSIGVR
Ga0307281_1002742313300028803SoilMKALAAAFVALFVLWVVDVNFNGARYTDAAVRMIRPAASSIGIRI
Ga0307296_1018516423300028819SoilMKAVAAAFVALFVLWVVDVNFNGGRYTDAALRMIRPMASSLGIRT
Ga0307310_1024653913300028824SoilMKAVAAAFVALFVLWVVDVNFNGARYTDAAMRMIRSTASSIGIRN
Ga0307278_1000522023300028878SoilMKAVSAAFVALFILWVVDVNLNGGRYTGAVMQMIRLGASSIGIRN
Ga0311334_1052485413300029987FenMKAITAAFVAVFILWVVDVNLNGSRYTDAATRMIRAAVSSIGVRN
Ga0308200_115246613300030905SoilMKAVSAAFVAVFILWVVDVNLNGGRYTYVVMQMIRSVASSMGIAN
Ga0102760_1090154623300031039SoilFVAVFVLWVVDVNFNGARYTDAAMRMIRSTATSIGVGN
Ga0308189_1006136413300031058SoilAFVALFILWVVDVNLNGGRYTEVVMQMIRLGASSIGIRN
Ga0308189_1031677323300031058SoilAAFVALFILWVVDVNLNGGRYTYVVMQMIRSAASSIRIGN
Ga0308199_113993923300031094SoilAAFVALFVLWVVDVNFNGGRYTDAAMRMIRATTSSIGIRN
Ga0307513_1074709923300031456EctomycorrhizaMKAVAAAFVAVFVLWVVDVNFNGARYTDAAMRMIRSTASSIGIRN
Ga0307509_1009227843300031507EctomycorrhizaMKAITAAFVAVFILWVVDVNFNGSRYTDAVTRMIREAVSSIGVR
Ga0307408_10221643033300031548RhizosphereAVFILWVVDVNLNGGRYTGVVWQLIRAAASSIGIRI
Ga0307516_1004046113300031730EctomycorrhizaMKAVAATFVAVFVLWVVDVNFNGGRYTDAAMRMIRPVASSIGIRN
Ga0307413_1038107623300031824RhizosphereMKAVAAAFVALFVLWVVDVNFNGARYTDATMRMIRSTSASIGVRN
Ga0307406_1189802223300031901RhizosphereMKAVTAAFVAVFILWVVDVNLNGGRYTGVVWQLVRAAALSLGF
Ga0307407_1090326033300031903RhizosphereFMKAVAAAFVALFVLWVVDVNFNGARYTDATMRMIRSTSASIGVRN
Ga0308175_10001494563300031938SoilMKAITAAFVAVFILWVVDVNLNGSRYTNVVVQMIRATVSSIRN
Ga0307409_10136134223300031995RhizosphereMKAVAAAFVALFILWVVDVNLNGGRYTEVAMQMIRLAASSIGIRN
Ga0308176_1022928513300031996SoilMKAITAALVAVFILWVVDVNLNGSRYTNVAVHMVRATIS
Ga0307411_1053930333300032005RhizosphereMKAVTAAFVAVFILWVVDVNLNGGRYTGVVWQLIRAAASSIG
Ga0307415_10029661123300032126RhizosphereMKAITAAFVAVFILWVLDVNLNGSRYTDAVTRMVRSAVSSIGVRN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.