| Basic Information | |
|---|---|
| Family ID | F017659 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 239 |
| Average Sequence Length | 49 residues |
| Representative Sequence | VMEFIEKKAKGHAPRLKAVKTKRKTAALDSVLAKSIASLRKEKRAA |
| Number of Associated Samples | 185 |
| Number of Associated Scaffolds | 239 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.51 % |
| % of genes near scaffold ends (potentially truncated) | 97.07 % |
| % of genes from short scaffolds (< 2000 bps) | 94.14 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (8.787 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.485 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (62.762 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.78% β-sheet: 0.00% Coil/Unstructured: 66.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 239 Family Scaffolds |
|---|---|---|
| PF02735 | Ku | 91.21 |
| PF01554 | MatE | 2.51 |
| PF03795 | YCII | 1.26 |
| PF00155 | Aminotran_1_2 | 0.42 |
| PF13560 | HTH_31 | 0.42 |
| PF08281 | Sigma70_r4_2 | 0.42 |
| PF09487 | HrpB2 | 0.42 |
| PF02739 | 5_3_exonuc_N | 0.42 |
| PF02405 | MlaE | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 239 Family Scaffolds |
|---|---|---|---|
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 91.21 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.26 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.42 |
| COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459014|G1P06HT01C57BO | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11026095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104857581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300000787|JGI11643J11755_11711534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300000891|JGI10214J12806_13786368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300000956|JGI10216J12902_101438289 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300000956|JGI10216J12902_103618158 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300001867|JGI12627J18819_10005665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4766 | Open in IMG/M |
| 3300002120|C687J26616_10170956 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300003267|soilL1_10058301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4611 | Open in IMG/M |
| 3300003324|soilH2_10099136 | All Organisms → cellular organisms → Bacteria | 2653 | Open in IMG/M |
| 3300004114|Ga0062593_100628780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300004114|Ga0062593_100799589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300004156|Ga0062589_100965290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 792 | Open in IMG/M |
| 3300004156|Ga0062589_101598116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300004643|Ga0062591_100794435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300004643|Ga0062591_101001899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300004782|Ga0062382_10291009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300005180|Ga0066685_10156196 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300005295|Ga0065707_10403699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300005330|Ga0070690_100675562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas | 791 | Open in IMG/M |
| 3300005331|Ga0070670_100229598 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300005331|Ga0070670_100819621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300005331|Ga0070670_101711611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas | 579 | Open in IMG/M |
| 3300005331|Ga0070670_101844849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300005334|Ga0068869_101208316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas | 665 | Open in IMG/M |
| 3300005334|Ga0068869_101995429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300005340|Ga0070689_100509745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1032 | Open in IMG/M |
| 3300005343|Ga0070687_101402072 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005347|Ga0070668_100744254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300005354|Ga0070675_100533383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1060 | Open in IMG/M |
| 3300005355|Ga0070671_101993899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 517 | Open in IMG/M |
| 3300005364|Ga0070673_100110723 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
| 3300005366|Ga0070659_101516329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300005440|Ga0070705_100546828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas | 887 | Open in IMG/M |
| 3300005440|Ga0070705_101941053 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005444|Ga0070694_101290003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas | 614 | Open in IMG/M |
| 3300005450|Ga0066682_10210316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
| 3300005459|Ga0068867_101227037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300005468|Ga0070707_101091197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas | 764 | Open in IMG/M |
| 3300005530|Ga0070679_101648679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300005536|Ga0070697_100901675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300005539|Ga0068853_100564596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
| 3300005539|Ga0068853_101657961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300005543|Ga0070672_100599006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300005543|Ga0070672_101025255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas → unclassified Halomonas → Halomonas sp. KM-1 | 732 | Open in IMG/M |
| 3300005545|Ga0070695_100935174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300005546|Ga0070696_101043438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300005547|Ga0070693_101414383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300005548|Ga0070665_102075034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300005548|Ga0070665_102246956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300005549|Ga0070704_102311492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300005553|Ga0066695_10374444 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300005556|Ga0066707_11000705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300005561|Ga0066699_10330133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas → Halomonas muralis | 1088 | Open in IMG/M |
| 3300005564|Ga0070664_101197742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300005578|Ga0068854_100452147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300005614|Ga0068856_100423531 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300005614|Ga0068856_102278315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 550 | Open in IMG/M |
| 3300005615|Ga0070702_101153772 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005616|Ga0068852_101295827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300005617|Ga0068859_101620410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300005618|Ga0068864_101622648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300005618|Ga0068864_102664534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas | 506 | Open in IMG/M |
| 3300005718|Ga0068866_10620348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 733 | Open in IMG/M |
| 3300005719|Ga0068861_102212403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300005834|Ga0068851_10263071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300005840|Ga0068870_10582153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300005841|Ga0068863_100236070 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300005842|Ga0068858_101816187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300005842|Ga0068858_101921744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300005843|Ga0068860_101402033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300005843|Ga0068860_101878489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300005844|Ga0068862_100799384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300005844|Ga0068862_100884665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300005844|Ga0068862_102639860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300006237|Ga0097621_101857084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300006358|Ga0068871_100389922 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300006358|Ga0068871_102275256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas | 517 | Open in IMG/M |
| 3300006755|Ga0079222_12162696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300006755|Ga0079222_12367698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 531 | Open in IMG/M |
| 3300006796|Ga0066665_11378934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas | 544 | Open in IMG/M |
| 3300006853|Ga0075420_100867626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300006876|Ga0079217_10069554 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300006876|Ga0079217_11039449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas | 604 | Open in IMG/M |
| 3300006918|Ga0079216_10585936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300006918|Ga0079216_10808873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300006918|Ga0079216_11908107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300006931|Ga0097620_102247583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas | 602 | Open in IMG/M |
| 3300006954|Ga0079219_10769864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300007076|Ga0075435_100550008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300009011|Ga0105251_10662796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300009038|Ga0099829_10911703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300009090|Ga0099827_10712616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300009100|Ga0075418_12067665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300009147|Ga0114129_11638725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300009147|Ga0114129_13200109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 532 | Open in IMG/M |
| 3300009148|Ga0105243_10654852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
| 3300009148|Ga0105243_11058809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300009156|Ga0111538_12646814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300009174|Ga0105241_10122577 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300009174|Ga0105241_11445953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300009176|Ga0105242_10700233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300009177|Ga0105248_10464554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1427 | Open in IMG/M |
| 3300009551|Ga0105238_10346258 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300009553|Ga0105249_13594359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300010038|Ga0126315_10276088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300010042|Ga0126314_10047047 | All Organisms → cellular organisms → Bacteria | 2785 | Open in IMG/M |
| 3300010044|Ga0126310_11686150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300010166|Ga0126306_11876697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 502 | Open in IMG/M |
| 3300010304|Ga0134088_10135402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1169 | Open in IMG/M |
| 3300010359|Ga0126376_10918956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300010375|Ga0105239_11400200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300010375|Ga0105239_12826360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300010397|Ga0134124_10102621 | All Organisms → cellular organisms → Bacteria | 2492 | Open in IMG/M |
| 3300010397|Ga0134124_10232371 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300010397|Ga0134124_10602172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300010399|Ga0134127_11956525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300010399|Ga0134127_12423895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300010400|Ga0134122_10937503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300010400|Ga0134122_12064947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300010401|Ga0134121_12769074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300010403|Ga0134123_10175507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1799 | Open in IMG/M |
| 3300010403|Ga0134123_12587561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300011119|Ga0105246_12460543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 512 | Open in IMG/M |
| 3300011414|Ga0137442_1030851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300011438|Ga0137451_1120319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300012022|Ga0120191_10032608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300012200|Ga0137382_10433795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300012202|Ga0137363_10840298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300012203|Ga0137399_10250388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1453 | Open in IMG/M |
| 3300012203|Ga0137399_11173950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300012208|Ga0137376_11132040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300012210|Ga0137378_10361226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1349 | Open in IMG/M |
| 3300012353|Ga0137367_10402349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300012361|Ga0137360_11345424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300012362|Ga0137361_10968132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300012362|Ga0137361_10975230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300012509|Ga0157334_1067005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 532 | Open in IMG/M |
| 3300012517|Ga0157354_1056841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300012685|Ga0137397_11127352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300012918|Ga0137396_10533966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300012918|Ga0137396_10882440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300012923|Ga0137359_10035707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4285 | Open in IMG/M |
| 3300012929|Ga0137404_11885101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300012948|Ga0126375_11988081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300012955|Ga0164298_10629685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300012958|Ga0164299_10864382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300012958|Ga0164299_11461414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300012961|Ga0164302_10226159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
| 3300013100|Ga0157373_10060647 | All Organisms → cellular organisms → Bacteria | 2679 | Open in IMG/M |
| 3300013100|Ga0157373_11015160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300013296|Ga0157374_10158046 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300013297|Ga0157378_10759494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300013306|Ga0163162_11265975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300013308|Ga0157375_10217205 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300013308|Ga0157375_10408395 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300013308|Ga0157375_10535500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1334 | Open in IMG/M |
| 3300013308|Ga0157375_11987148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300013308|Ga0157375_12859155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300013308|Ga0157375_13482735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300014263|Ga0075324_1050425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300014325|Ga0163163_11358760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300014326|Ga0157380_11459427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300014326|Ga0157380_12818891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 553 | Open in IMG/M |
| 3300014829|Ga0120104_1061250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300015245|Ga0137409_10682701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300015265|Ga0182005_1244407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300015371|Ga0132258_11159247 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300018000|Ga0184604_10374302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 508 | Open in IMG/M |
| 3300018422|Ga0190265_11024529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300018422|Ga0190265_11677042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300018422|Ga0190265_12596244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300018466|Ga0190268_10815848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300018468|Ga0066662_12694043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300018469|Ga0190270_12258468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300018920|Ga0190273_11404368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300018920|Ga0190273_12276851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300019254|Ga0184641_1367381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300019789|Ga0137408_1194886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1346 | Open in IMG/M |
| 3300019879|Ga0193723_1120699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300021073|Ga0210378_10191793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300025907|Ga0207645_10760323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300025908|Ga0207643_10930363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300025911|Ga0207654_10761115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300025912|Ga0207707_10181350 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300025917|Ga0207660_11540688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300025923|Ga0207681_10615441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300025930|Ga0207701_10379567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1220 | Open in IMG/M |
| 3300025939|Ga0207665_10397320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
| 3300025939|Ga0207665_10914428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300025942|Ga0207689_11161245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300025945|Ga0207679_11685951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300025945|Ga0207679_12148869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300025960|Ga0207651_12104181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300026035|Ga0207703_10917045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300026041|Ga0207639_10812145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300026041|Ga0207639_11367185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300026046|Ga0208780_1016061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300026075|Ga0207708_10053692 | All Organisms → cellular organisms → Bacteria | 3071 | Open in IMG/M |
| 3300026075|Ga0207708_10987961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 731 | Open in IMG/M |
| 3300026095|Ga0207676_11204231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300026095|Ga0207676_11409167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300026116|Ga0207674_10666076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300026116|Ga0207674_11826673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300026116|Ga0207674_11958917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300026118|Ga0207675_102685260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 507 | Open in IMG/M |
| 3300026142|Ga0207698_12470533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300026307|Ga0209469_1060703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1168 | Open in IMG/M |
| 3300026530|Ga0209807_1135171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300026542|Ga0209805_1194674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300027691|Ga0209485_1038994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
| 3300027840|Ga0209683_10273180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300027880|Ga0209481_10515253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300027903|Ga0209488_10085928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2344 | Open in IMG/M |
| 3300028379|Ga0268266_11991428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300028380|Ga0268265_11492979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300028381|Ga0268264_10606295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
| 3300028536|Ga0137415_11173457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 582 | Open in IMG/M |
| 3300030511|Ga0268241_10056307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300030903|Ga0308206_1175777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300031058|Ga0308189_10365055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300031058|Ga0308189_10429212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300031548|Ga0307408_100829198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300031716|Ga0310813_11908539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 559 | Open in IMG/M |
| 3300031720|Ga0307469_11782131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300031731|Ga0307405_10352704 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300031740|Ga0307468_100944047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300031820|Ga0307473_10282085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300031852|Ga0307410_10454365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300031903|Ga0307407_10005022 | All Organisms → cellular organisms → Bacteria | 5696 | Open in IMG/M |
| 3300031944|Ga0310884_10818609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300031995|Ga0307409_101335756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300032002|Ga0307416_100259762 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300032005|Ga0307411_11800699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300032126|Ga0307415_100655976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300032174|Ga0307470_11867786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300032421|Ga0310812_10506424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300034194|Ga0370499_0147123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.02% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.18% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.35% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.51% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.26% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.26% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.84% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.84% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.84% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.84% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.42% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.42% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.42% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.42% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.42% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.42% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026046 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2PV_03744820 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | KEYKDEYRERVMEFIEKKAKGHAPRLKAVKAKPKTTALDSVLAKSIESLRKKEKRAA |
| ICChiseqgaiiFebDRAFT_110260953 | 3300000363 | Soil | ERVMEFIEKKARGKAPRLHAVKSKRKVSALDSVLEKSLRTLRKEKRAA* |
| INPhiseqgaiiFebDRAFT_1048575812 | 3300000364 | Soil | KGHKPRLARAKKKAASTSLDSVLARSLAALKKGKKAA* |
| JGI11643J11755_117115342 | 3300000787 | Soil | KDEYRDRVEKFIAQKAKGRAPRLRAVKAKPKSDNLNAALAKSLAALKKGKRAA* |
| JGI10214J12806_137863682 | 3300000891 | Soil | EYRERVMDFIAKKAKGHAPRLSAVKTKRQTTSLDSALAKSIESLKKGKRAA* |
| JGI10216J12902_1014382891 | 3300000956 | Soil | APRLQAVKTKRKTGDLNTVLAKSIAALKKGKRAA* |
| JGI10216J12902_1036181583 | 3300000956 | Soil | APRLQAVKTKRKTGDLDAVLAKSIAALKKGKRAA* |
| JGI12627J18819_100056653 | 3300001867 | Forest Soil | MEFIEKKAKGHAPRLKAVKAKRKTAALDSVLAKSIASLRKEKRAA* |
| C687J26616_101709561 | 3300002120 | Soil | YKDEYRERVMEFIGKKAKGRAPKLAAVRPKRATASLDSVLAKSINALKKGKRAA* |
| soilL1_100583011 | 3300003267 | Sugarcane Root And Bulk Soil | YKDEYRERVMEFIEKKAKGHAPRLKAVKPKRQTAALDNVLAKSIEALRKKEKRAA* |
| soilH2_100991361 | 3300003324 | Sugarcane Root And Bulk Soil | AKGHAPRLKAVKTKRQTAALDNVLAKSIESLRKKEKRAA* |
| Ga0062593_1006287802 | 3300004114 | Soil | EYRERVLEFIAKKAKGHAPRLAPVKTKRATTSLDSVLAKSIASLKKGKRAA* |
| Ga0062593_1007995892 | 3300004114 | Soil | ERVEKFIEQKAKGRKPRLQAVKTKRKTESVEAALAKSLAALKKGKRAA* |
| Ga0062589_1009652902 | 3300004156 | Soil | KEYKDEYRERVMEFIEKKAKGHAPRLKAVKPKRQTAALDNVLAKSIEALRKKEKRAA* |
| Ga0062589_1015981161 | 3300004156 | Soil | YRERVMEFIEKKAKGHAPRLKAVKAKRQTAALDNVLAKSIEALRKKEKRAA* |
| Ga0062591_1007944351 | 3300004643 | Soil | YRERVMEFIEKKARGKAPRLHAVKSKRKVSALDSVLEKSLRSLRKEKRAA* |
| Ga0062591_1010018992 | 3300004643 | Soil | EYRERVMEFIEKKAKGHAPRLKAVKPKRQTAALDNVLAKSIESLRKKEKRAA* |
| Ga0062382_102910092 | 3300004782 | Wetland Sediment | FIEKKAKGKAPRLHAVRAKRASTSLDSVLEKSLRALQKEKHAA* |
| Ga0066685_101561961 | 3300005180 | Soil | QRVTEFIEKKAKGHAPKLRLVKTKRKAASLDKVLSRSIEALRKEKKAA* |
| Ga0065707_104036991 | 3300005295 | Switchgrass Rhizosphere | KAKGRAPRLKAVTTKRKTGALDSVLAKSIASLKKEKRAA* |
| Ga0070690_1006755622 | 3300005330 | Switchgrass Rhizosphere | GEFKASDYKDEYRERVEKFIQQKAKGHAPRLKAVRTKPKTNALGSALEKSLAALKKGKRAA* |
| Ga0070670_1002295983 | 3300005331 | Switchgrass Rhizosphere | KEYKDEYRERVMEFIEKKAKGRAPHLKAVKPKRQTAALDNVLAKSIEALRKKVKRAA* |
| Ga0070670_1008196212 | 3300005331 | Switchgrass Rhizosphere | RVMEFIEKKAKGHAPRLKPVKAKRTTASLDNVLAKSIESLRKEKRAA* |
| Ga0070670_1017116111 | 3300005331 | Switchgrass Rhizosphere | YKDEYRERVMEFIEKKAKGHAPRLKAVKSKRQTAALDSVLAKSIASLRKEKRAA* |
| Ga0070670_1018448492 | 3300005331 | Switchgrass Rhizosphere | RERVMEFIEKKAKGHAPRLKAVKAKPKTTALDSVLAKSIESLRKKEKRAA* |
| Ga0068869_1012083161 | 3300005334 | Miscanthus Rhizosphere | KDEYRERVMEFIEKKAKGHAPRLKAVKAKRQTAALDNVLAKSIEALRKKEKRAA* |
| Ga0068869_1019954292 | 3300005334 | Miscanthus Rhizosphere | IEKKAKGHAPRLKAVKAKPKTTALDSVLAKSIESLRKKEKRAA* |
| Ga0070689_1005097451 | 3300005340 | Switchgrass Rhizosphere | YKDEYRERVMEFIEKKAKGHAPRLKAVKAKRQTTALDNVLAKSIESLRKKEKRAA* |
| Ga0070687_1014020722 | 3300005343 | Switchgrass Rhizosphere | EFEDEYRKRVMEFIERKAKGHKPKLQAVKTKRKTTSLDSVLAKSLASLRKEKRAA* |
| Ga0070668_1007442541 | 3300005347 | Switchgrass Rhizosphere | VLEFIAKKAKGHAPRLSAVKTKRATTSLDSVLTKSIAALKKGKRAA* |
| Ga0070675_1005333832 | 3300005354 | Miscanthus Rhizosphere | RERVEKFIQQKAKGHAPRLKAVRTKPKTNALGSALEKSLAALKKGKRAA* |
| Ga0070671_1019938992 | 3300005355 | Switchgrass Rhizosphere | VLEFIAKKAKGHAPRLAAVKTKRKTTSLDSVLAKSIAALKKGKHAA* |
| Ga0070673_1001107233 | 3300005364 | Switchgrass Rhizosphere | DEYRERVMEFIKKKAKGHAPRLKAVKAKRQTTALDNVLAKSIESLRKKEKRAA* |
| Ga0070659_1015163292 | 3300005366 | Corn Rhizosphere | DEYRERVMEFIERKAKGHAPRLKAVRTKRKTGSLDSVLEKSLAALKKEKRAA* |
| Ga0070705_1005468283 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | YKDEYRARVMEFVEKKAKGHKPKLHLVKTKRKTTSLNSVLSKSIAALKKHKKAA* |
| Ga0070705_1019410531 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | DEYRERVMEFIEKKARGKAPRLQAVKSKRKVSALDSVLEKSLRTLRKEKRAA* |
| Ga0070694_1012900032 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EFKDEYRERVLEFIAKKAKGHAPRLAPVKTKRATTSLDSVLAKSIASLKKGKRAA* |
| Ga0066682_102103161 | 3300005450 | Soil | RVMEFIEKKAKGHAPKLHLVKTKRKAASLDKVLSRSIETLRKEKKAA* |
| Ga0068867_1012270371 | 3300005459 | Miscanthus Rhizosphere | VMEFIEKKAKGHAPRLKAVKTKRQTAALDNVLAKSIESLRKKEKRAA* |
| Ga0070707_1010911972 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | DYKDEYRARVMEFVERKSKGHAPKLRLVKTKRKPASLDKILSRSIESLKKRAA* |
| Ga0070679_1016486792 | 3300005530 | Corn Rhizosphere | YRERVREFIEKKAKGHAPKLKAVKPKRQTAALDNVLAKSIEALRKKDKRAA* |
| Ga0070697_1009016751 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EFIEKKAKGHAPKLRAVKPKRKTAALDSVLAKSIDALRRKEKRAA* |
| Ga0068853_1005645962 | 3300005539 | Corn Rhizosphere | RVMEFIEKKAKGHAPRLKAVKAKPKTTALDSVLAKSIESLRKKEKRAA* |
| Ga0068853_1016579612 | 3300005539 | Corn Rhizosphere | VMEFIEKKAKGHAPRLKAVKPKRQTAALDNVLAKSIEALRKKDKRAA* |
| Ga0070672_1005990061 | 3300005543 | Miscanthus Rhizosphere | APKLKAVKAKRQTAALDSVLAKSIAAMRKEKRAA* |
| Ga0070672_1010252552 | 3300005543 | Miscanthus Rhizosphere | KEYKDEYRERVMEFIEKKAKGHAPRLKAVKAKRQTTALDNVLAKSIESLRKKEKRAA* |
| Ga0070695_1009351741 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RVMKFIERKARGKAPRLRPVKSRRKTGALDSVLAKSLQALRKEKRAA* |
| Ga0070696_1010434381 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EYRARVTEFLAKKAKGRAPRLRLVKTKRQAASLDKVLSKSIEALKKQKRVA* |
| Ga0070693_1014143831 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VMEFIEKKAKGHAPRLKAVKTKRKTAALDSVLAKSIASLRKEKRAA* |
| Ga0070665_1020750342 | 3300005548 | Switchgrass Rhizosphere | YRERVMDFIAKKAKGHAPRLSAVKTKRQTTSLDSALAKSIESLKKGKRAA* |
| Ga0070665_1022469562 | 3300005548 | Switchgrass Rhizosphere | APRLRAVKTKRKPSSLDSVLEKSLKALRKEKRAA* |
| Ga0070704_1023114921 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RVMEFVEKKAKGHQPTLHLVKSKRKTTALDKVLSKSIEALKKQKKAA* |
| Ga0066695_103744441 | 3300005553 | Soil | NPKDFKDEYRARVAEFIEKKAKGHAPKLHLVKSKRKTTSLDKVLSKSIEALKKQKRAA* |
| Ga0066707_110007052 | 3300005556 | Soil | EYKDEYRQRVMEFIEKKAKGHAPKLHLVKTKRKAASLDKVLSRSIAALRKEKKAA* |
| Ga0066699_103301332 | 3300005561 | Soil | KDEYRQRVMEFIEKKAKGHAPKLHLVKTKRKAASLDKVLSRSIAALRKEKKAA* |
| Ga0070664_1011977421 | 3300005564 | Corn Rhizosphere | KEFKDEYRERVMEFIEKKAKGRAPRLAAVKTKRKTTSLDSVLAKSIASLKKGKRAA* |
| Ga0068854_1004521471 | 3300005578 | Corn Rhizosphere | RQRVMEFIEKKAKGHAPRLKPVKTKRQSAALDNVLAKSIAALKKEKRAA* |
| Ga0068856_1004235311 | 3300005614 | Corn Rhizosphere | VMEFIEKKAKGHAPRLKAVKTKAKTTALDSVLAKSIESLRKKEKRAA* |
| Ga0068856_1022783152 | 3300005614 | Corn Rhizosphere | YKDEYRKRVMEFIERKAKGHAPRLKPVKTKRQTAALDNVLAKSIAALKKEKRAA* |
| Ga0070702_1011537722 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | KQLVGMLEGDFDAAEFEDEYRKRVMEFIERKAKGHTPKLRAVKTKRKTTSLDSVLRKSLESLKKEKRAA* |
| Ga0068852_1012958271 | 3300005616 | Corn Rhizosphere | VIEFIKKKAKGRAPKLKPVKAKRQTAALDSVLAKSIDALRRKEKRAA* |
| Ga0068859_1016204101 | 3300005617 | Switchgrass Rhizosphere | YRERVMEFIEKKAKGRAPKLKAVKAKRQTAALDSVLAKSIAAMRKEKRAA* |
| Ga0068864_1016226482 | 3300005618 | Switchgrass Rhizosphere | RERVMEFIEKKARGKAPRLHAVKSKRKVSALDSVLEKSLRTLRKEKRAA* |
| Ga0068864_1026645342 | 3300005618 | Switchgrass Rhizosphere | EYKDEYRERVMEFIEKKAKGHAPRLKAVKTKRQTAALDNVLAKSIESLRKKEKRAA* |
| Ga0068866_106203481 | 3300005718 | Miscanthus Rhizosphere | EYKDEYRERVMEFIEKKAKGHAPRLKAVKAKRQTTALDNVLAKSIESLRKKEKRAA* |
| Ga0068861_1022124032 | 3300005719 | Switchgrass Rhizosphere | IERKAKGHAPRLKAVKAKRQTGGLDTVLAKSIAALKKEKRAA* |
| Ga0068851_102630711 | 3300005834 | Corn Rhizosphere | HAPRLKAVKPKRQTAALDNVLAKSIESLRKKEKRAA* |
| Ga0068870_105821532 | 3300005840 | Miscanthus Rhizosphere | YRERVMEFIEKKARGHAPRLKAVKSKRSTTALDSVLAKSIASLRKEKRAA* |
| Ga0068863_1002360703 | 3300005841 | Switchgrass Rhizosphere | PKEYKDEYRERVMEFIEKKAKGHAPRLKAVKAKRQTTALDNVLAKSIESLRKKEKRAA* |
| Ga0068858_1018161872 | 3300005842 | Switchgrass Rhizosphere | KDEYRERVLEFIAKKAKGHAPRLSAVKTKRATTSLDSVLTKSIAALKKGKRAA* |
| Ga0068858_1019217442 | 3300005842 | Switchgrass Rhizosphere | VMEFIEKKARGHAPRLKAVKSKRQTAALDSVLAKSIASLRKEKRAA* |
| Ga0068860_1014020332 | 3300005843 | Switchgrass Rhizosphere | AKGRAPRLKAVKAKRQTTALDSVLAKSIASLRKEKRAA* |
| Ga0068860_1018784891 | 3300005843 | Switchgrass Rhizosphere | ADYKDEYRERVLEFIAKKAKGHAPRLAAVKTKRKTTSLDSVLAKSIASLKKGKRAA* |
| Ga0068862_1007993842 | 3300005844 | Switchgrass Rhizosphere | IEQKAKGRKPRLQAVKTKRRTESVEAALAKSLAALKKGKRAA* |
| Ga0068862_1008846651 | 3300005844 | Switchgrass Rhizosphere | ERVMEFIEKKAKGHAPRLKAVKAKRQTAALDSVLAKSIASLRKEKRAA* |
| Ga0068862_1026398601 | 3300005844 | Switchgrass Rhizosphere | VMEFIERKAKGRAPQLRAVKTKRQSGDLGNVLAKSIASLKKKEKRAA* |
| Ga0097621_1018570842 | 3300006237 | Miscanthus Rhizosphere | IEKKAKGHAPRLKAVKPKRQTAALDNVLAKSIESLRKKEKRAA* |
| Ga0068871_1003899221 | 3300006358 | Miscanthus Rhizosphere | VLEFIAKKAKGHAPRLAAVKTKRKTTSLDSVLAKSIAALKKGKNAA* |
| Ga0068871_1022752561 | 3300006358 | Miscanthus Rhizosphere | YKDEYRERVMEFIEKKAKGHAPRLKAVKTKRQTAALDNVLAKSIESLRKKEKRAA* |
| Ga0079222_121626962 | 3300006755 | Agricultural Soil | KGHAPRLKPVKTKRQSAALDNVLAKSIAALKKEKRAA* |
| Ga0079222_123676982 | 3300006755 | Agricultural Soil | FIEKKAKGHAPRLKPVKTKRQSAALDNVLAKSIAALKKEKRAA* |
| Ga0066665_113789342 | 3300006796 | Soil | KDEYRARVVEFIEKKAKGHAPRLHLVKSKRKTASLDKVLSKSIEALKRQKRAA* |
| Ga0075420_1008676262 | 3300006853 | Populus Rhizosphere | RERVMEFIEKKAKGRAPRLKAVRAKRQTAALDSVLAKSIASLRKEKRAA* |
| Ga0079217_100695541 | 3300006876 | Agricultural Soil | DFNPKDYKDEYRKRVMEFIERKAKGHAPRLRAVKTKRKSGDLDNVLAKSIAALKKEKRAA |
| Ga0079217_110394492 | 3300006876 | Agricultural Soil | EFDPAEYKDEYRQRVMEFIERKAKGRAPKLRAVKPKRQTAALDNVLAKSIESLRKKEKRAA* |
| Ga0079216_105859361 | 3300006918 | Agricultural Soil | ERVEKFIEQKARGRAPRLQAVKTKRRTDALGSALEKSIAALKKGKRAA* |
| Ga0079216_108088732 | 3300006918 | Agricultural Soil | EYRERVMEFIEKKAKGRAPRLKAVKAKRQTAALDSVLAKSIASLRKEKRAA* |
| Ga0079216_119081072 | 3300006918 | Agricultural Soil | RERVEKFIEQKAKGRKPRLQAVKTKRKTGALDAALAKSIAALKKGKRAA* |
| Ga0097620_1022475832 | 3300006931 | Switchgrass Rhizosphere | KDEYRERVMEFIEKKAKGHAPRLKAVKAKPKTTALDSVLAKSIESLRKKEKRAA* |
| Ga0079219_107698641 | 3300006954 | Agricultural Soil | IEQKAKGRKPRLQAVKTKRKTESVEAALAKSLAALKKGNRAA* |
| Ga0075435_1005500082 | 3300007076 | Populus Rhizosphere | EFIEKKAKGHAPRLRAVKAKPKTAALDSVLAKSIESLRRKEKRAA* |
| Ga0105251_106627962 | 3300009011 | Switchgrass Rhizosphere | FKAKEYKDEYRERVMEFIEKKAKGHAPRLKAVKSKRQTAALDSVLAKSIASLRKEKRAA* |
| Ga0099829_109117032 | 3300009038 | Vadose Zone Soil | KGHAPKLRAVKTKRQPTSLDSVLAKSLQSLKKEKRAA* |
| Ga0099827_107126161 | 3300009090 | Vadose Zone Soil | KAKGPAPKLRAVKTKRKTTSLDSVLAKSLESLKKEKRAA* |
| Ga0075418_120676652 | 3300009100 | Populus Rhizosphere | ERVMEFIEKKAKGHAPRLKAVKTKRQTAALDSVLAKSIASLRKEKRAA* |
| Ga0114129_116387251 | 3300009147 | Populus Rhizosphere | PAEYKDEYRERVMEFIEKKAKGHAPKLKAVKPKRKTAALDSVLAKSIESLRRKEKRAA* |
| Ga0114129_132001091 | 3300009147 | Populus Rhizosphere | DEYRERVLEFIAKKAKGHAPRLAPARTKRTSTSLDSVLAKSIAALKKGKKAA* |
| Ga0105243_106548522 | 3300009148 | Miscanthus Rhizosphere | EYKDEYRERVMEFIEKKAKGRAPRLKPVKAKRQTAALDNVLAKSIDALRKKEKRAA* |
| Ga0105243_110588092 | 3300009148 | Miscanthus Rhizosphere | FIAKKAKGHAPRLAAVKTKRKTTSLDSVLAKSIASLKKGKRAA* |
| Ga0111538_126468141 | 3300009156 | Populus Rhizosphere | LEFIAKKAKGHAPRLAPVKAKRQTTSLDSVLTKSIAALKKGKRAA* |
| Ga0105241_101225774 | 3300009174 | Corn Rhizosphere | AEYKDEYRERVLEFIAKKAKGHAPRLAAVKTKRKTTSLDSVLAKSIASLKKGKRAA* |
| Ga0105241_114459532 | 3300009174 | Corn Rhizosphere | KGHAPRLKAVKAKRQTAALDNVLAKSIESLRKKEKRAA* |
| Ga0105242_107002331 | 3300009176 | Miscanthus Rhizosphere | RVMEFIEKKARGHAPRLKAVKTKRKTAALDSVLAKSIASLRKEKRAA* |
| Ga0105248_104645543 | 3300009177 | Switchgrass Rhizosphere | EFIAKKAKGHAPRLSAVKTKRATTSLDSVLAKSIAALKKGKRAA* |
| Ga0105238_103462581 | 3300009551 | Corn Rhizosphere | APRLKAVKPKRQTAALDNVLAKSIEALRKKEKRAA* |
| Ga0105249_135943591 | 3300009553 | Switchgrass Rhizosphere | FIEKKAKGHAPRLKPVKAKAKTAALDSVLAKSIASLRKEKRAA* |
| Ga0126315_102760881 | 3300010038 | Serpentine Soil | MEFSEQKAKGRAPRLKAVKTKRQTAALDSVLAKSIES |
| Ga0126314_100470474 | 3300010042 | Serpentine Soil | VVEFIEKKAKGHAPRLKAVKPKRQTAALDNVLAKSIESLRKKEKRAA* |
| Ga0126310_116861502 | 3300010044 | Serpentine Soil | MEFVEKKAKGKAPRLKAVKPKRQTAALDNVLAKSIESLRKKVKRAA* |
| Ga0126306_118766973 | 3300010166 | Serpentine Soil | YRERVEKFIAQKAKGRAPRLQAVKTKRKAADLGAALEKSLAALKKGKRAA* |
| Ga0134088_101354021 | 3300010304 | Grasslands Soil | KDEYRQRVTEFIEKKAKGHAPKLRLVKTKRKAASLDKVLSRSIEALRKEKKAA* |
| Ga0126376_109189561 | 3300010359 | Tropical Forest Soil | KGRAPRLTAVKTKRKTTELDSVLAKSIAALKKGKRAA* |
| Ga0105239_114002001 | 3300010375 | Corn Rhizosphere | DEYRERVMEFIEKKARGHAPRLKAVKAKPKTTALDSVLAKSIESLRKKEKRAA* |
| Ga0105239_128263602 | 3300010375 | Corn Rhizosphere | MEFIEKKAKGHAPRLKPVKAKRQTAALDNVLAKSIEALRKKEKRAA* |
| Ga0134124_101026215 | 3300010397 | Terrestrial Soil | EKKAKGKTTRLHAVKSKRATSSLAVALEKSLKTLKKERKAA* |
| Ga0134124_102323713 | 3300010397 | Terrestrial Soil | HAPRLAPVKTKRATAGLDNVLAKSIAALKKEKRAA* |
| Ga0134124_106021721 | 3300010397 | Terrestrial Soil | EYKDEYRERVMEFIEKKAKGHAPRLKAVKPKRQTAALDNVLAKSIESLRKKDKRAA* |
| Ga0134127_119565251 | 3300010399 | Terrestrial Soil | EKKARGKAPRLQAVKSKRKVSALDSVLEKSLRTLRKEKRAA* |
| Ga0134127_124238951 | 3300010399 | Terrestrial Soil | DYKDEYRERVMEFIEKKARGKAPRLQAVKSKRKVSALDSVLEKSLRTLRKEKRAA* |
| Ga0134122_109375032 | 3300010400 | Terrestrial Soil | FIEKKAKGHAPRLKAVKTKRKTAALDSVLAKSIASLRKEKRAA* |
| Ga0134122_120649471 | 3300010400 | Terrestrial Soil | KDEYRERVMEFIEKKARGRAPKLKAVKAKRQTAALDNVLAKSIESLRKEKRAA* |
| Ga0134121_127690741 | 3300010401 | Terrestrial Soil | RVMEFIEKKAKGHAPRLKPVKTKRQTAALDNVLAKSIAALKKEKRAA* |
| Ga0134123_101755071 | 3300010403 | Terrestrial Soil | ADYKDEYRERVLEFIAKKAKGHAPRLAPVKAKRQTTSLDSVLTKSIAALKKGKRAA* |
| Ga0134123_125875612 | 3300010403 | Terrestrial Soil | GHAPRLKAVKTKRKTEALDNVLAKSIASLRKEKRAA* |
| Ga0105246_124605431 | 3300011119 | Miscanthus Rhizosphere | KAKEYKDEYRERVMEFIEKKAKGHAPRLKAVKSKRQTAALDSVLAKSIASLRKEKRAA* |
| Ga0137442_10308512 | 3300011414 | Soil | YRERVMEFIEKKARGKAPRLHAVKSKRKVSALDSVLEKSLRTLRKEKRAA* |
| Ga0137451_11203191 | 3300011438 | Soil | KKAKGKAPRLHAVKLKRKPSSLDSVLEKSLQSLRKEKRAA* |
| Ga0120191_100326081 | 3300012022 | Terrestrial | RERVMEFIERKAKGHAPRLRAVKTKRKAGSLDSVLAKSLAALKKEKKAA* |
| Ga0137382_104337951 | 3300012200 | Vadose Zone Soil | QLVGMLEGEFNAAEFEDKYRKRVMEFIERKAKGHAPKLRAVKTKRRTTSLDSVLAKSLESLKKEKRAA* |
| Ga0137363_108402981 | 3300012202 | Vadose Zone Soil | EDFQDEYRQRVMEFVEKKAKGRAPKLRLVKNKRQPASLDKILSKSIESLKKGKRAA* |
| Ga0137399_102503881 | 3300012203 | Vadose Zone Soil | DYKDEYRQRVMDFIKRKARGKAPRLRAVKSKRKPGSLDSVLEKSLQALRKEKRAA* |
| Ga0137399_111739501 | 3300012203 | Vadose Zone Soil | KKAKGKAPRLHAVKSKRKPSSLDSVLQKSLQSLRKEKRAA* |
| Ga0137376_111320401 | 3300012208 | Vadose Zone Soil | DYKDEYRQRVMEFIERKAKGKAPRLHAVKTKRKAASLDSVLEKSLRSLGKEKRAA* |
| Ga0137378_103612261 | 3300012210 | Vadose Zone Soil | QRVMEFIKKKAKGHAPKLHLVKTKRKAASLDKVLSRSIETLRKEKKAA* |
| Ga0137367_104023491 | 3300012353 | Vadose Zone Soil | RERVMQFIEKKAKGRAPKLSTVKTKRQTTSLDSVLAKSIASLKKEKRAA* |
| Ga0137360_113454242 | 3300012361 | Vadose Zone Soil | RQRVMEFIERKAKGKAPRLHAVKTKRKAASLDSVLEKSLRSLGKEKRAA* |
| Ga0137361_109681322 | 3300012362 | Vadose Zone Soil | DFKDEYRQRVMEFIEQKAKGKAPKLRAVKTKRAPSSLDAVLAKSIDSLKKGKRAA* |
| Ga0137361_109752302 | 3300012362 | Vadose Zone Soil | VEKKAKGHAPKLRLVKTKRQAASLDKILSKSIESLKKEKRAA* |
| Ga0157334_10670052 | 3300012509 | Soil | DEYRERVLEFIAKKAKGHAPRLAAVKTKRKTTSLDSVLAKSIAALKKGKHAA* |
| Ga0157354_10568412 | 3300012517 | Unplanted Soil | PADYKDEFRERVLEFIAKKARGQAPRLAAVKTKRKTTSLDSVLAKSIAALKKGKHAA* |
| Ga0137397_111273522 | 3300012685 | Vadose Zone Soil | HAPRLSSVKSKRKTTSLDSALAKSIAALKKGKRAA* |
| Ga0137396_105339661 | 3300012918 | Vadose Zone Soil | RVMEFIERKAKGHAPRLHAVKSKRKPSSLDDMLARSLKAVKKQKHAA* |
| Ga0137396_108824401 | 3300012918 | Vadose Zone Soil | KAPRLRAVKTRRKAGSLDSVLEKSLQSLKKEKRAA* |
| Ga0137359_100357077 | 3300012923 | Vadose Zone Soil | FVEKKAKGHAPKLRLVKTKRQAASLDKILSKSIESLKKEKRAA* |
| Ga0137404_118851011 | 3300012929 | Vadose Zone Soil | KASGKAPRLKAVKSKRKVSALDSVLEKSLRTLRKEKRAA* |
| Ga0126375_119880811 | 3300012948 | Tropical Forest Soil | HKPKLTRPKTKRASTSLDSVLQRSIAALKKGKKAA* |
| Ga0164298_106296851 | 3300012955 | Soil | EYRQRVMEFIDKKAKGHAPRLKPVKTKRQTAALDNVLAKSIAALKKEKRAA* |
| Ga0164299_108643821 | 3300012958 | Soil | IERKAKGDKPKLHAVKTKRKTTSLDSVLAKSLASLKKEKRAA* |
| Ga0164299_114614142 | 3300012958 | Soil | DEYRERVMEFIEKKARGKAPRLQAVKSKPRVSSLDSVLEKSLRSLRKEKRAA* |
| Ga0164302_102261593 | 3300012961 | Soil | YKDEYRERVMEFIEKKARGKAPRLQAVKSKPRVSSLDSVLEKSLRSLRKEKRAA* |
| Ga0157373_100606471 | 3300013100 | Corn Rhizosphere | KAKGRAPRLQAVKTKRKADNLGAALEKSLAALKKGKRAA* |
| Ga0157373_110151601 | 3300013100 | Corn Rhizosphere | IEKKAKGHAPRLKAVKTKAKTTALDSVLAKSIESLRKKEKRAA* |
| Ga0157374_101580461 | 3300013296 | Miscanthus Rhizosphere | GEFDPDNYKDKYRERVLEFIAKKAKGHAPRLAAVKTKRKTTSLDSVLAKSIAALKKGKHAA* |
| Ga0157378_107594942 | 3300013297 | Miscanthus Rhizosphere | EFIEKKAKGHAPRLKAVKAKPKTTALDSVLAKSIESLRKKEKRAA* |
| Ga0163162_112659751 | 3300013306 | Switchgrass Rhizosphere | PKEYKDEYRERVMEFIEKKAKGHAPRLKAVKPKRQTAALDNVLAKSIEALRKKEKRAA* |
| Ga0157375_102172051 | 3300013308 | Miscanthus Rhizosphere | YRERVMEFIEKKAKGHAPRLKAVKPKRQTAALDNVLAKSIESLRKKEKRAA* |
| Ga0157375_104083951 | 3300013308 | Miscanthus Rhizosphere | YRERVMEFIEKKAKGHAPRLKPVKAKRTTASLDNVLAKSIESLRKEKRAA* |
| Ga0157375_105355003 | 3300013308 | Miscanthus Rhizosphere | MLEGEFNASEFEDEYRKRVMEFIERKAKGHKPKLQAVKTKRKTTSLDSILAKSLASLKKEKRAA* |
| Ga0157375_119871482 | 3300013308 | Miscanthus Rhizosphere | MDFIEKKAKGHAPRLKAVKAKRQTAALDSVLAKSIASLRKEKRAA* |
| Ga0157375_128591551 | 3300013308 | Miscanthus Rhizosphere | EEFEDEYRKRVMEFIERKAKGHAPKLKAVKTKRKTTSLDSVLARSLAALKKEKRAA* |
| Ga0157375_134827351 | 3300013308 | Miscanthus Rhizosphere | DEYRERVMEFIEKKARGHAPRLKAVKTKRKTAALDSVLARSIASLRKEKRAA* |
| Ga0075324_10504251 | 3300014263 | Natural And Restored Wetlands | YKDEYRSRVMEFIEKKAKGRAPKLRAVRTKKQTGSLDNILAKSIQSLRKKEKRAA* |
| Ga0163163_113587601 | 3300014325 | Switchgrass Rhizosphere | NPKEYKDEYRERVMEFIEKKAKGHAPRLKAVKAKRQTAALDNVLAKSIESLRKKEKRAA* |
| Ga0157380_114594271 | 3300014326 | Switchgrass Rhizosphere | MEFIEKKAKGRAPKLKAVKAKRQTAALDSVLAKSIASLRKEKRAA* |
| Ga0157380_128188911 | 3300014326 | Switchgrass Rhizosphere | EFEPRDFKDEYRERVMEYIAKKAKGKAPRLAAVKTKRKTTSLDSVLAKSIASLKKGKRAA |
| Ga0120104_10612502 | 3300014829 | Permafrost | YKDEYRQRVMEFIKRKARGKAPRLRAVKSRRKAGSLDSVLEKSLQALRKEKRAA* |
| Ga0137409_106827011 | 3300015245 | Vadose Zone Soil | YRERVMEFIEKKAKGKAPRLHAVKSKRKTSSLDSVLEKSLQSLRKEKRAA* |
| Ga0182005_12444071 | 3300015265 | Rhizosphere | RVLEFIAKKAKGRAPRLAPVKTKRATTSLDSVLAKSIASLKKGKRAA* |
| Ga0132258_111592473 | 3300015371 | Arabidopsis Rhizosphere | VMEFIEKKAKGKAPRLSAVKTKRAPSSLDAVLAKSIASLKKGKRAA* |
| Ga0184604_103743021 | 3300018000 | Groundwater Sediment | ERKAKGKAPRLHAVKTKRTATSLDSMLTRSVAALKKGKRAA |
| Ga0190265_110245291 | 3300018422 | Soil | DYKDEYRARVTEFLEKKAKGRAPRLQPVKAKRKTAALDSVLERSIAALRKEKRAA |
| Ga0190265_116770421 | 3300018422 | Soil | DEYRERVEKFIAQKARGRAPRLQAVKTKRKSDNLNAALQKGLAALKKGKRAA |
| Ga0190265_125962442 | 3300018422 | Soil | PKAYKDEYRERVQEFIEKKAKGRAPRLKPVKAKRTTATLDSVLAKSIESLRRKEKRAA |
| Ga0190268_108158482 | 3300018466 | Soil | VMEFIEKKAKGHAPRLRAVKTKRKAGSLDSVLEKSLAALKKEKRAA |
| Ga0066662_126940431 | 3300018468 | Grasslands Soil | DEYRARAMEFIERKAKGKAPRLQAVKTKRAATSLDKVLSKSIESLKKQKHAA |
| Ga0190270_122584681 | 3300018469 | Soil | EDEFRAADYKDEYRERVMKFIKQKARGKAPRLRAVKSRRKAGSLDSVLAKSLQSLRKEKRAA |
| Ga0190273_114043682 | 3300018920 | Soil | KKAKGKAPRLHAVKAKRKTSSLDSVLEKSLRSLRKEKRAA |
| Ga0190273_122768512 | 3300018920 | Soil | MEFIEKKAKGHAPRLRAVKTKRRVGSLGSVLEKSLAAMKKEKRAA |
| Ga0184641_13673811 | 3300019254 | Groundwater Sediment | RVMEFIEKKARGKAPRLHAVKSKRKVSALDSVLEKSLRTLRKEKRAA |
| Ga0137408_11948861 | 3300019789 | Vadose Zone Soil | MEFIEKKAKGKAPRLHAVKTKRKASSLDSVLEKSLRSLRKEKRAA |
| Ga0193723_11206992 | 3300019879 | Soil | KAKGKAPRLRAVKSKRKPSSLDSVLQKSLQSLRKEKRAA |
| Ga0210378_101917931 | 3300021073 | Groundwater Sediment | AGEFNAADYKDEYRERVMEFIERKAKGKAPRLRAVKSKAKTGSLDTILAKSLESLKKGKRAA |
| Ga0207645_107603231 | 3300025907 | Miscanthus Rhizosphere | PKEYKDEYRERVMEFIEKKAKGHAPRLKAVKPKRQTAALDNVLAKSIESLRKKDKRAA |
| Ga0207643_109303632 | 3300025908 | Miscanthus Rhizosphere | KGHAPRLKAVKTKRKTAALDSVLARSIASLRKEKRAA |
| Ga0207654_107611152 | 3300025911 | Corn Rhizosphere | IEKKAKGHAPRLKAVKAKRQTAALDNVLAKSIESLRKKEKRAA |
| Ga0207707_101813501 | 3300025912 | Corn Rhizosphere | EYRERVMEFIAKKAKGHAPRLKAVKAKPKTTALDSVLAKSIESLRKKEKRAA |
| Ga0207660_115406881 | 3300025917 | Corn Rhizosphere | KAKGHAPRLKAVKSKRQTAALDSVLAKSIASLRKEKRAA |
| Ga0207681_106154412 | 3300025923 | Switchgrass Rhizosphere | RVMQFIERKAKGHAPRLRAVKSKRKTSDLDDMLARSLKAVKKAKRAA |
| Ga0207701_103795673 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | KGHAPRLKAIRTKRKTGSLDSVLEKSLAALKKEKRAA |
| Ga0207665_103973201 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KAKGRAPRLAPVKTKRATTSLDSVLAKSIASLKKGKRAA |
| Ga0207665_109144282 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | YRQRVMEFVEKKAKGRAPRLHLVKGKRAPASLDKILTKSIESLKKRQRAA |
| Ga0207689_111612451 | 3300025942 | Miscanthus Rhizosphere | EYRERVMEFIEKKAKGHAPRLKAVKAKPKTTALDSVLAKSIESLRKKEKRAA |
| Ga0207679_116859512 | 3300025945 | Corn Rhizosphere | KKAKGHAPRLKAVKSKRQTAALDSVLAKSIASLRKEKRAA |
| Ga0207679_121488692 | 3300025945 | Corn Rhizosphere | AKGHAPRLKAVKAKRQTAALDNVLAKSIESLRKKEKRAA |
| Ga0207651_121041812 | 3300025960 | Switchgrass Rhizosphere | KEYKDEYRERVMEFIEKKAKGHAPRLKAVKTKRQTAALDNVLAKSIESLRKKEKRAA |
| Ga0207703_109170452 | 3300026035 | Switchgrass Rhizosphere | KAKGHAPRLKAVKPKRQTAALDNVLAKSIEALRKKEKRAA |
| Ga0207639_108121452 | 3300026041 | Corn Rhizosphere | AKGHAPRLKAVKTKAKTTALDSVLAKSIESLRKKEKRAA |
| Ga0207639_113671851 | 3300026041 | Corn Rhizosphere | EYRERVMEFIEKKAKGHAPRLRAVKPKRQTAALDNVLAKSIEALRKKDKRAA |
| Ga0208780_10160611 | 3300026046 | Natural And Restored Wetlands | YKDEYRSRVMEFIEKKAKGRAPKLRAVRTKKQTGSLDNILAKSIQSLRKKEKRAA |
| Ga0207708_100536921 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | EKKARGHAPRLKAVKTKRKTEALDNVLAKSIASLRKEKRAA |
| Ga0207708_109879613 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | KAPRLHAVKAKRKVGELDSVLEKSLRTLRKEKRAA |
| Ga0207676_112042311 | 3300026095 | Switchgrass Rhizosphere | KAKGHAPRLKAVKAKRQTAALDNVLAKSIESLRKKEKRAA |
| Ga0207676_114091672 | 3300026095 | Switchgrass Rhizosphere | KDKYRERVLEFIAKKAKGHAPRLAAVKTKRKTTSLDSVLAKSIAALKKGKHAA |
| Ga0207674_106660761 | 3300026116 | Corn Rhizosphere | MEFIEKKAKGRAPRLKPVKAKRQTAALDNVLAKSIEALRKKEKRAA |
| Ga0207674_118266731 | 3300026116 | Corn Rhizosphere | EFIEKKAKGHAPRLKAVKPKRQTAALDNVLAKSIEALRKKDKRAA |
| Ga0207674_119589171 | 3300026116 | Corn Rhizosphere | GAKVVNERKGHAPRLKPVKTKRQTAALDKVLAKSIAALKKEKRAA |
| Ga0207675_1026852602 | 3300026118 | Switchgrass Rhizosphere | NPKEYKDEYRERVMEFIEKKAKGHAPRLKAVKPKRQTAALDNVLAKSIEALRKKDKRAA |
| Ga0207698_124705332 | 3300026142 | Corn Rhizosphere | EYRERVIEFIKKKAKGRAPKLKPVKAKRQTAALDSVLAKSIDALRRKEKRAA |
| Ga0209469_10607032 | 3300026307 | Soil | DEYKDEYHQRVTEFIEKKAKGHAPKLRLVKTKRKAASLDKVLSRSIEALRKEKKAA |
| Ga0209807_11351711 | 3300026530 | Soil | MEFIEKKAKGHAPKLHLVKTKRKAASLDKVLSRSIETLRKEKKAA |
| Ga0209805_11946742 | 3300026542 | Soil | QDEYRQRVMEFIEKKAKGHAPKLHLVKTKRKAASLDKVLSRSIETLRKEKKAA |
| Ga0209485_10389941 | 3300027691 | Agricultural Soil | YRERVMEFIEKKAKGHAPRLRAVKTKRKAGSLGSVLEKSLAALKKEKRAA |
| Ga0209683_102731802 | 3300027840 | Wetland Sediment | DYKDEYRERVMGFIEKKAKGKAPRLHAVRAKRASTSLDSVLEKSLRALQKEKHAA |
| Ga0209481_105152531 | 3300027880 | Populus Rhizosphere | KKKARGRAPRLKPVKAKRQTTALDSVLSKSIEALRRKEKRAA |
| Ga0209488_100859281 | 3300027903 | Vadose Zone Soil | PKDYQDEYRQRVMEFVEKKAKGRAPRLHLVKSKRGPASLDKILSKSIESLKKKQRAA |
| Ga0268266_119914281 | 3300028379 | Switchgrass Rhizosphere | FIAKKAKGHAPRLSAVKTKRQTTSLDSALAKSIESLKKGKRAA |
| Ga0268265_114929791 | 3300028380 | Switchgrass Rhizosphere | RKAKGRAPQLRAVKTKRQSGDLGNVLAKSIASLKKKEKRAA |
| Ga0268264_106062952 | 3300028381 | Switchgrass Rhizosphere | KKAKGHAPRLAAVKTKRKTTSLDSVLAKSIAALKKGKHAA |
| Ga0137415_111734572 | 3300028536 | Vadose Zone Soil | MAKQLVGMLEGEFNAAEFEDKYRKRVMEFIERKAKGHAPKLQAVKAKRRTTSLDSVLAKSLESLKKEKRAA |
| Ga0268241_100563072 | 3300030511 | Soil | EMLKGEFNPKDYKDEYRKRVMEFIEKKAKGHAPRLKPVKTKRQAAALDNVLAKSIAALKKEKRAA |
| Ga0308206_11757772 | 3300030903 | Soil | KARGKAPRLHAVKSKRKVSALDSVLEKSLRTLRKEKRAA |
| Ga0308189_103650552 | 3300031058 | Soil | YKDEYRERVMKFIEQKARGKAPRLRAVKARRKTGSLDSVLAKSLQSLRKEKRAA |
| Ga0308189_104292121 | 3300031058 | Soil | EFRAEDYKDEYRQRVMEFIERKSKGKKPRLLAVKSRRKAGSLDSVLAKSLQSLRKEKRAA |
| Ga0307408_1008291982 | 3300031548 | Rhizosphere | ERVLEFIERKAKGHAPRLTAVKTKRKTTSLDSVLAKSIESLRKQKRAA |
| Ga0310813_119085392 | 3300031716 | Soil | NEYRERVMDFIAKKAKGHAPRLSAVKTKRQTTSLDSALAKSIESLKKGKRAA |
| Ga0307469_117821311 | 3300031720 | Hardwood Forest Soil | PKDFKDEYRGRVMDFIEKKAKGHAPRLQLVKSKRRAASLDKVLSKSIESLKKQKRAA |
| Ga0307405_103527043 | 3300031731 | Rhizosphere | KDEYRERVQEFIEKKARGRAPRLRAVKTKRKTEELGNVLEKSIAALRKKEKRAA |
| Ga0307468_1009440472 | 3300031740 | Hardwood Forest Soil | AKGKAPRLQPVKTKRKASSLDSVLEKSLRSLKKEKRAA |
| Ga0307473_102820852 | 3300031820 | Hardwood Forest Soil | PKDFKDEYRARVVEFIEKKAKGHAPRLHLVKSKRKTASLDKVLSKSIEALKRQKRAA |
| Ga0307410_104543652 | 3300031852 | Rhizosphere | PKEYKDEYRERVMEFIEKKARGRAPKLKAVKAKRQTAALDSVLAKSIASLRKEKRAA |
| Ga0307407_100050221 | 3300031903 | Rhizosphere | FIEKKARGHAPRLKAVKAKPKTTALDSVLAKSIESLRKKEKRAA |
| Ga0310884_108186091 | 3300031944 | Soil | QKAKGHAPRLKAVRTKPKTNALGSALEKSLAALKKGKRAA |
| Ga0307409_1013357562 | 3300031995 | Rhizosphere | EFIEKKAKGRAPRLQAVKVKRKTTSLDSVLAKSIESLRKKEKRAA |
| Ga0307416_1002597623 | 3300032002 | Rhizosphere | YRERVTEFIEKKAKGRAPKLRAVKPKRQTAALDNVLAKSIEALRKKEKRAA |
| Ga0307411_118006992 | 3300032005 | Rhizosphere | KARGRAPQLRAVKTKRKTEELGNVLEKSIAALRKKEKRAA |
| Ga0307415_1006559762 | 3300032126 | Rhizosphere | DEYRERVTEFIEKKAKGRAPKLRAVKPKRQTAALDNVLAKSIEALRKKEKRAA |
| Ga0307470_118677861 | 3300032174 | Hardwood Forest Soil | VMEFIEKKAKGHAPRLKAVKTKRQTAALDNVLAKSIESLRKKEKRAA |
| Ga0310812_105064242 | 3300032421 | Soil | RVMEFIEKKAKGHAPRLKAVKTKRQTAALDNVLAKSIESLRKKEKRAA |
| Ga0370499_0147123_443_580 | 3300034194 | Untreated Peat Soil | MKFIEQKAKGKAPKLKAVKTKRKTTSLDSVLAKSIAALKKEKRAA |
| ⦗Top⦘ |