NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F017547

Metagenome / Metatranscriptome Family F017547

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017547
Family Type Metagenome / Metatranscriptome
Number of Sequences 240
Average Sequence Length 40 residues
Representative Sequence MHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRRGDPS
Number of Associated Samples 204
Number of Associated Scaffolds 240

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 2.09 %
% of genes near scaffold ends (potentially truncated) 37.50 %
% of genes from short scaffolds (< 2000 bps) 89.17 %
Associated GOLD sequencing projects 199
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (50.833 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(19.167 % of family members)
Environment Ontology (ENVO) Unclassified
(24.167 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.917 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 50.75%    β-sheet: 0.00%    Coil/Unstructured: 49.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 240 Family Scaffolds
PF08768THAP4_heme-bd 64.58
PF02635DrsE 18.33
PF01475FUR 4.17
PF07685GATase_3 3.75
PF01571GCV_T 1.67
PF08669GCV_T_C 1.25
PF08353MurT_C 0.83
PF14748P5CR_dimer 0.83
PF03900Porphobil_deamC 0.42
PF05140ResB 0.42
PF12833HTH_18 0.42
PF00300His_Phos_1 0.42

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 240 Family Scaffolds
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 4.17
COG0769UDP-N-acetylmuramyl tripeptide synthaseCell wall/membrane/envelope biogenesis [M] 0.83
COG0181Porphobilinogen deaminaseCoenzyme transport and metabolism [H] 0.42
COG1333Cytochrome c biogenesis protein ResBPosttranslational modification, protein turnover, chaperones [O] 0.42


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A50.83 %
All OrganismsrootAll Organisms49.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559006|FI_contig07087Not Available1211Open in IMG/M
2170459017|G14TP7Y01CPUOUNot Available505Open in IMG/M
2189573001|GZR05M101DW7JWNot Available536Open in IMG/M
3300003219|JGI26341J46601_10184682Not Available571Open in IMG/M
3300003505|JGIcombinedJ51221_10252034Not Available717Open in IMG/M
3300003659|JGI25404J52841_10001709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae3957Open in IMG/M
3300004080|Ga0062385_10852890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales601Open in IMG/M
3300004082|Ga0062384_100550593Not Available773Open in IMG/M
3300004114|Ga0062593_101595288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales708Open in IMG/M
3300004121|Ga0058882_1779103Not Available762Open in IMG/M
3300005164|Ga0066815_10002951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1654Open in IMG/M
3300005176|Ga0066679_10255059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1131Open in IMG/M
3300005177|Ga0066690_10216760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1277Open in IMG/M
3300005186|Ga0066676_11179639Not Available502Open in IMG/M
3300005187|Ga0066675_10661562Not Available785Open in IMG/M
3300005363|Ga0008090_15008828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales913Open in IMG/M
3300005434|Ga0070709_10682943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales797Open in IMG/M
3300005436|Ga0070713_101831845Not Available589Open in IMG/M
3300005437|Ga0070710_11431305Not Available517Open in IMG/M
3300005445|Ga0070708_101179283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales716Open in IMG/M
3300005454|Ga0066687_10497030Not Available721Open in IMG/M
3300005524|Ga0070737_10002860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales19738Open in IMG/M
3300005524|Ga0070737_10036706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae2909Open in IMG/M
3300005555|Ga0066692_10712482Not Available621Open in IMG/M
3300005560|Ga0066670_10629868Not Available652Open in IMG/M
3300005610|Ga0070763_10135021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1277Open in IMG/M
3300005764|Ga0066903_100750166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata1733Open in IMG/M
3300005764|Ga0066903_101884962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1145Open in IMG/M
3300005764|Ga0066903_104536060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales740Open in IMG/M
3300005764|Ga0066903_108117666Not Available538Open in IMG/M
3300006028|Ga0070717_10087205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae2628Open in IMG/M
3300006032|Ga0066696_11085458Not Available509Open in IMG/M
3300006034|Ga0066656_10204515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1258Open in IMG/M
3300006050|Ga0075028_100665937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales624Open in IMG/M
3300006052|Ga0075029_100308952Not Available1011Open in IMG/M
3300006057|Ga0075026_100854437Not Available556Open in IMG/M
3300006059|Ga0075017_101459178Not Available539Open in IMG/M
3300006086|Ga0075019_10407788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales833Open in IMG/M
3300006172|Ga0075018_10340179Not Available750Open in IMG/M
3300006354|Ga0075021_10620643Not Available691Open in IMG/M
3300006573|Ga0074055_10006740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1889Open in IMG/M
3300006604|Ga0074060_12040006All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus512Open in IMG/M
3300006606|Ga0074062_10002334Not Available618Open in IMG/M
3300006755|Ga0079222_10453375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales918Open in IMG/M
3300006797|Ga0066659_10404536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1074Open in IMG/M
3300006854|Ga0075425_100863026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1036Open in IMG/M
3300006954|Ga0079219_11860184Not Available566Open in IMG/M
3300007255|Ga0099791_10329105Not Available730Open in IMG/M
3300007258|Ga0099793_10453131Not Available634Open in IMG/M
3300007265|Ga0099794_10244653Not Available924Open in IMG/M
3300007788|Ga0099795_10163314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales921Open in IMG/M
3300009038|Ga0099829_10900605Not Available734Open in IMG/M
3300009089|Ga0099828_10430855Not Available1189Open in IMG/M
3300009090|Ga0099827_10082057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata2520Open in IMG/M
3300009090|Ga0099827_10232144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora1545Open in IMG/M
3300009092|Ga0105250_10099338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1187Open in IMG/M
3300009101|Ga0105247_10056410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae2426Open in IMG/M
3300009524|Ga0116225_1046967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae2089Open in IMG/M
3300009792|Ga0126374_10936639Not Available674Open in IMG/M
3300010048|Ga0126373_11053740Not Available879Open in IMG/M
3300010048|Ga0126373_12918580Not Available533Open in IMG/M
3300010152|Ga0126318_10436240Not Available942Open in IMG/M
3300010159|Ga0099796_10070745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1259Open in IMG/M
3300010322|Ga0134084_10137625Not Available811Open in IMG/M
3300010333|Ga0134080_10054434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1579Open in IMG/M
3300010358|Ga0126370_11051268Not Available747Open in IMG/M
3300010360|Ga0126372_12999063Not Available524Open in IMG/M
3300010371|Ga0134125_12918390All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus519Open in IMG/M
3300010373|Ga0134128_13176862All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus505Open in IMG/M
3300010375|Ga0105239_12828917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales566Open in IMG/M
3300010376|Ga0126381_100712838Not Available1436Open in IMG/M
3300010401|Ga0134121_11987804Not Available613Open in IMG/M
3300011080|Ga0138568_1044731Not Available915Open in IMG/M
3300012096|Ga0137389_10138048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1984Open in IMG/M
3300012199|Ga0137383_10001089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae15607Open in IMG/M
3300012201|Ga0137365_10389313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1028Open in IMG/M
3300012202|Ga0137363_10961431Not Available725Open in IMG/M
3300012205|Ga0137362_10942107Not Available737Open in IMG/M
3300012206|Ga0137380_10035496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae4599Open in IMG/M
3300012210|Ga0137378_10496719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1127Open in IMG/M
3300012210|Ga0137378_10606263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1005Open in IMG/M
3300012211|Ga0137377_11330920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales648Open in IMG/M
3300012349|Ga0137387_10813547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales676Open in IMG/M
3300012351|Ga0137386_10136319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1752Open in IMG/M
3300012355|Ga0137369_10695191Not Available699Open in IMG/M
3300012375|Ga0134034_1187962Not Available607Open in IMG/M
3300012401|Ga0134055_1075511Not Available876Open in IMG/M
3300012476|Ga0157344_1002954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales932Open in IMG/M
3300012489|Ga0157349_1031531Not Available556Open in IMG/M
3300012493|Ga0157355_1011279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales706Open in IMG/M
3300012494|Ga0157341_1002366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1239Open in IMG/M
3300012498|Ga0157345_1011088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales794Open in IMG/M
3300012500|Ga0157314_1004842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1003Open in IMG/M
3300012918|Ga0137396_10991032Not Available609Open in IMG/M
3300012918|Ga0137396_11039774Not Available590Open in IMG/M
3300012984|Ga0164309_10609600Not Available854Open in IMG/M
3300012988|Ga0164306_11473964Not Available582Open in IMG/M
3300012989|Ga0164305_10989333Not Available714Open in IMG/M
3300014165|Ga0181523_10114865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1607Open in IMG/M
3300014487|Ga0182000_10590817Not Available534Open in IMG/M
3300015371|Ga0132258_12818845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1210Open in IMG/M
3300015372|Ga0132256_100985598Not Available958Open in IMG/M
3300016357|Ga0182032_10856491Not Available771Open in IMG/M
3300017937|Ga0187809_10066319All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300017943|Ga0187819_10211331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1143Open in IMG/M
3300017946|Ga0187879_10328544Not Available848Open in IMG/M
3300017955|Ga0187817_10120615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1659Open in IMG/M
3300017959|Ga0187779_10483838Not Available817Open in IMG/M
3300017973|Ga0187780_10790044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales687Open in IMG/M
3300017973|Ga0187780_10979639Not Available616Open in IMG/M
3300017974|Ga0187777_10492600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales856Open in IMG/M
3300017974|Ga0187777_10531605Not Available824Open in IMG/M
3300017999|Ga0187767_10186777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales646Open in IMG/M
3300018037|Ga0187883_10318758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales794Open in IMG/M
3300018060|Ga0187765_10619062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales701Open in IMG/M
3300018064|Ga0187773_10976583All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus553Open in IMG/M
3300018468|Ga0066662_11971818Not Available611Open in IMG/M
3300018482|Ga0066669_10237522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1429Open in IMG/M
3300019361|Ga0173482_10149333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura908Open in IMG/M
3300019362|Ga0173479_10500301Not Available613Open in IMG/M
3300019875|Ga0193701_1053173Not Available817Open in IMG/M
3300020075|Ga0206349_1415870Not Available821Open in IMG/M
3300020581|Ga0210399_10454736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1066Open in IMG/M
3300021170|Ga0210400_10072016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2709Open in IMG/M
3300021178|Ga0210408_11031010Not Available635Open in IMG/M
3300021180|Ga0210396_11260179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales617Open in IMG/M
3300021344|Ga0193719_10457559Not Available518Open in IMG/M
3300021362|Ga0213882_10127058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1040Open in IMG/M
3300021362|Ga0213882_10327740Not Available641Open in IMG/M
3300021374|Ga0213881_10000072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria84090Open in IMG/M
3300021374|Ga0213881_10037050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae2052Open in IMG/M
3300021374|Ga0213881_10116749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1159Open in IMG/M
3300021377|Ga0213874_10086565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1023Open in IMG/M
3300021377|Ga0213874_10089166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1011Open in IMG/M
3300021384|Ga0213876_10191482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1088Open in IMG/M
3300021388|Ga0213875_10234796Not Available864Open in IMG/M
3300021403|Ga0210397_10011079Not Available5443Open in IMG/M
3300021403|Ga0210397_10128371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1748Open in IMG/M
3300021406|Ga0210386_10712581Not Available865Open in IMG/M
3300021415|Ga0193694_1032230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales735Open in IMG/M
3300021432|Ga0210384_10479088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1120Open in IMG/M
3300021478|Ga0210402_10393620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1286Open in IMG/M
3300021560|Ga0126371_11301563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales860Open in IMG/M
3300021560|Ga0126371_11870285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales720Open in IMG/M
3300021860|Ga0213851_1425264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales920Open in IMG/M
3300022512|Ga0242676_1013006Not Available789Open in IMG/M
3300022715|Ga0242678_1061308Not Available565Open in IMG/M
3300022718|Ga0242675_1054242Not Available679Open in IMG/M
3300022720|Ga0242672_1023271Not Available880Open in IMG/M
3300024176|Ga0224565_1027417Not Available634Open in IMG/M
3300024227|Ga0228598_1049654Not Available832Open in IMG/M
3300024323|Ga0247666_1005102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2929Open in IMG/M
3300025908|Ga0207643_10794821Not Available613Open in IMG/M
3300025910|Ga0207684_10100761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2468Open in IMG/M
3300025945|Ga0207679_11536725Not Available610Open in IMG/M
3300026335|Ga0209804_1246492Not Available677Open in IMG/M
3300026340|Ga0257162_1019867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales807Open in IMG/M
3300026548|Ga0209161_10361916Not Available646Open in IMG/M
3300026551|Ga0209648_10540678Not Available655Open in IMG/M
3300026557|Ga0179587_10516279Not Available784Open in IMG/M
3300026899|Ga0209326_1000673Not Available2979Open in IMG/M
3300027076|Ga0208860_1002810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1364Open in IMG/M
3300027172|Ga0208098_1014069Not Available756Open in IMG/M
3300027604|Ga0208324_1028666Not Available1684Open in IMG/M
3300027725|Ga0209178_1424138Not Available509Open in IMG/M
3300027775|Ga0209177_10088310Not Available961Open in IMG/M
3300027787|Ga0209074_10160797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales816Open in IMG/M
3300027812|Ga0209656_10032010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3109Open in IMG/M
3300027882|Ga0209590_10109232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1665Open in IMG/M
3300027903|Ga0209488_10014133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura5824Open in IMG/M
3300027911|Ga0209698_10281042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1322Open in IMG/M
3300027911|Ga0209698_11432125Not Available502Open in IMG/M
3300027965|Ga0209062_1106233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1166Open in IMG/M
3300027968|Ga0209061_1000975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria54927Open in IMG/M
3300027968|Ga0209061_1004596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales13067Open in IMG/M
3300029636|Ga0222749_10113137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1288Open in IMG/M
3300029951|Ga0311371_12341788Not Available550Open in IMG/M
3300030494|Ga0310037_10227507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae817Open in IMG/M
3300030763|Ga0265763_1035391Not Available583Open in IMG/M
3300031057|Ga0170834_108058150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1315Open in IMG/M
3300031093|Ga0308197_10383716Not Available545Open in IMG/M
3300031446|Ga0170820_17681797Not Available766Open in IMG/M
3300031469|Ga0170819_17228802Not Available627Open in IMG/M
3300031543|Ga0318516_10057057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2138Open in IMG/M
3300031543|Ga0318516_10227466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1078Open in IMG/M
3300031543|Ga0318516_10682341Not Available584Open in IMG/M
3300031545|Ga0318541_10663472Not Available583Open in IMG/M
3300031546|Ga0318538_10057642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1918Open in IMG/M
3300031549|Ga0318571_10280548Not Available621Open in IMG/M
3300031572|Ga0318515_10578173Not Available598Open in IMG/M
3300031680|Ga0318574_10502337Not Available710Open in IMG/M
3300031681|Ga0318572_10292193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales962Open in IMG/M
3300031713|Ga0318496_10775128Not Available528Open in IMG/M
3300031740|Ga0307468_101450947Not Available633Open in IMG/M
3300031748|Ga0318492_10146871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1188Open in IMG/M
3300031751|Ga0318494_10356717Not Available846Open in IMG/M
3300031751|Ga0318494_10413062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria783Open in IMG/M
3300031751|Ga0318494_10557670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales669Open in IMG/M
3300031793|Ga0318548_10466868Not Available617Open in IMG/M
3300031795|Ga0318557_10346945Not Available682Open in IMG/M
3300031798|Ga0318523_10050466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1954Open in IMG/M
3300031798|Ga0318523_10284299Not Available826Open in IMG/M
3300031819|Ga0318568_10272481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1049Open in IMG/M
3300031820|Ga0307473_10525031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales804Open in IMG/M
3300031823|Ga0307478_11628731Not Available533Open in IMG/M
3300031832|Ga0318499_10258600Not Available675Open in IMG/M
3300031893|Ga0318536_10519403Not Available598Open in IMG/M
3300031897|Ga0318520_10772272Not Available602Open in IMG/M
3300031897|Ga0318520_10987693Not Available531Open in IMG/M
3300031946|Ga0310910_11266137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales571Open in IMG/M
3300031981|Ga0318531_10101686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1267Open in IMG/M
3300031981|Ga0318531_10228669Not Available839Open in IMG/M
3300032055|Ga0318575_10376168Not Available720Open in IMG/M
3300032064|Ga0318510_10078920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1220Open in IMG/M
3300032065|Ga0318513_10250155Not Available858Open in IMG/M
3300032068|Ga0318553_10765833Not Available505Open in IMG/M
3300032160|Ga0311301_12489133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae579Open in IMG/M
3300032515|Ga0348332_10153857Not Available901Open in IMG/M
3300032770|Ga0335085_10160194Not Available2809Open in IMG/M
3300032770|Ga0335085_10473547Not Available1435Open in IMG/M
3300032770|Ga0335085_10665508Not Available1162Open in IMG/M
3300032770|Ga0335085_10794109Not Available1042Open in IMG/M
3300032770|Ga0335085_10823194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1019Open in IMG/M
3300032782|Ga0335082_10038871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5005Open in IMG/M
3300032782|Ga0335082_10262029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1608Open in IMG/M
3300032782|Ga0335082_11557861All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus533Open in IMG/M
3300032783|Ga0335079_10188908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2291Open in IMG/M
3300032783|Ga0335079_10403430All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300032805|Ga0335078_10168719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3076Open in IMG/M
3300032828|Ga0335080_10455955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1364Open in IMG/M
3300032828|Ga0335080_11451570Not Available680Open in IMG/M
3300032893|Ga0335069_11664278Not Available682Open in IMG/M
3300032893|Ga0335069_12018095Not Available607Open in IMG/M
3300032898|Ga0335072_11573834Not Available556Open in IMG/M
3300032954|Ga0335083_10261131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1542Open in IMG/M
3300032954|Ga0335083_10456748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1078Open in IMG/M
3300032955|Ga0335076_10781833Not Available836Open in IMG/M
3300032955|Ga0335076_11267116Not Available622Open in IMG/M
3300033158|Ga0335077_10520657Not Available1254Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil19.17%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.33%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.33%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.08%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.08%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.08%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.08%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.08%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock2.08%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.67%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.67%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.25%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.25%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.25%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.25%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.25%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.83%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.42%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.42%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.42%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.42%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.42%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.42%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.42%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.42%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.42%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.42%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.42%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.42%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004121Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005524Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011080Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012375Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012489Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610EnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022512Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022715Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024176Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1EnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026340Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-AEnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026899Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027076Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes)EnvironmentalOpen in IMG/M
3300027172Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027965Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027968Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030763Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FI_008333302166559006Grass SoilMHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRRGDPS
4ZMR_041372702170459017Switchgrass, Maize And Mischanthus LitterMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRRGDPS
FD2_077422802189573001Grass SoilMHGMLSAAIVVGIFALAAAACLYLVVRVFAAGGRPG
JGI26341J46601_1018468213300003219Bog Forest SoilMHGMLSAAILIGVFAVIAAACLYVAVRVYTAGGRRGDTS*
JGIcombinedJ51221_1025203423300003505Forest SoilMHGMLSAAILIGVFAVAASACLYLAVRVYAAGGRRGDSS*
JGI25404J52841_1000170943300003659Tabebuia Heterophylla RhizosphereMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDRHGDPS*
Ga0062385_1085289023300004080Bog Forest SoilMHGMLSAAILIGVLAVMAAACLYVAVRVYAAGGRRGDPS*
Ga0062384_10055059313300004082Bog Forest SoilRTLRTMHGMLSAAILIGVFAVAASACLYLAVRVYAAGRR*
Ga0062593_10159528823300004114SoilMHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRRGDPS*
Ga0058882_177910313300004121Forest SoilRTLRAMHGMLSAAILIGVLAVTAAACLYVAVRVYAAGGRRGDSS*
Ga0066815_1000295113300005164SoilMHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRRGDPS*
Ga0066679_1025505933300005176SoilMHGMLSAAIVTGVFAVAAAACLYLAVRVFAAGGRHGDPS*
Ga0066690_1021676033300005177SoilMHGMLSAAIVVGVFALAAAACLYLAVRVFVAGGRPGDKHSDAS*
Ga0066676_1117963913300005186SoilMHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRHGDPS*
Ga0066675_1066156223300005187SoilMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGEDKHGDPS*
Ga0008090_1500882823300005363Tropical Rainforest SoilMHGMLSAAIVIGVFAMCAAACLYLAMRVFAAGGRPGDRHGDPS*
Ga0070709_1068294323300005434Corn, Switchgrass And Miscanthus RhizosphereMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS*
Ga0070713_10183184513300005436Corn, Switchgrass And Miscanthus RhizosphereMHGMLSAAIVIGVLAVVAAACLYVAVRVFAAGGRRGDAS*
Ga0070710_1143130523300005437Corn, Switchgrass And Miscanthus RhizospherePPMHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDEHGDPS*
Ga0070708_10117928323300005445Corn, Switchgrass And Miscanthus RhizosphereMHGMLSAAIVIGVFAVSAAACLYLAVRVFVAGGRRGDPS*
Ga0066687_1049703023300005454SoilMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS*
Ga0070737_10002860203300005524Surface SoilMHGMLSAAVLIGVLAAVAAGCGWLAVRAYLAGGRRGDPS*
Ga0070737_1003670643300005524Surface SoilMHGMLSAGVLIGALAAVAAACGWLAVRAYLAGGRRGDPS*
Ga0066661_1082888423300005554SoilGRLTRTLRPMHGMLSAAIVTGVFAVAAAACLYLAVRVFAAGGRHGDPS*
Ga0066692_1071248213300005555SoilMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPG
Ga0066670_1062986813300005560SoilPRTLPPMHGMLSAAIVIGVFAVFAAACLYLAVRVFAAGGRRGDPS*
Ga0070763_1013502133300005610SoilMHGMLSAAILIGVFAVAASACLYLAVRVYAAGGRRGDTS*
Ga0066903_10075016623300005764Tropical Forest SoilMHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDRHGDPS*
Ga0066903_10188496223300005764Tropical Forest SoilMHGMLSAAIVIGVFAVAAVACLYLAVRVFAAGGRRGDPS*
Ga0066903_10453606033300005764Tropical Forest SoilMHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPG
Ga0066903_10811766613300005764Tropical Forest SoilPVHWRVMHGMLSTAIVIGGFAVVAAACLYVAVRVFTAGGRRGDAS*
Ga0070717_1008720533300006028Corn, Switchgrass And Miscanthus RhizosphereMLSAAIVTGVFAVAAAACLYLAVRVFAAGGRHGDPS*
Ga0066696_1108545813300006032SoilPRTLPPMHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRRGDPS*
Ga0066656_1020451513300006034SoilMHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRRGDPS*
Ga0075028_10066593723300006050WatershedsMHGMLSAAIVIGVFAVTAVACLYLAVRVFAAGGRPGDKHGDPS*
Ga0075029_10030895223300006052WatershedsMHGMLSAAILIGVFAVAAAACLYLVVRVYTAGGRRGDSS*
Ga0075026_10085443713300006057WatershedsPMHGMLSAAILIGVLAVMAAACLYVAVRVYAAGGRRGDPS*
Ga0075017_10145917813300006059WatershedsMHGMLSAAILIGVFAVAAAACLYLVVRVYAAGGRRGDSS*
Ga0075019_1040778823300006086WatershedsMHGMLSAAILIGVFAVMAAACLYVAMRVYAAGGRRGDTS*
Ga0075018_1034017913300006172WatershedsMHGMLSAAILIGVFAVAAAACLYVAVRVYAAGGRRGDSS*
Ga0075021_1062064313300006354WatershedsAMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHGDPS*
Ga0074055_1000674043300006573SoilMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRRGDPS*
Ga0074060_1204000623300006604SoilMHGMLSAAIVIGVFAVSAAACLYLAVRVFTAGGRRGDPS*
Ga0074062_1000233413300006606SoilMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRRGDPS*
Ga0079222_1045337523300006755Agricultural SoilMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDKHGDPS*
Ga0066659_1040453623300006797SoilMHGMLSAAIVIGVFAVFAAACLYLAVRVFAAGGRRGDPS*
Ga0075425_10086302633300006854Populus RhizosphereMHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRP
Ga0079219_1186018413300006954Agricultural SoilCPVHLRAMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS*
Ga0099791_1032910513300007255Vadose Zone SoilMHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRRGDAS*
Ga0099793_1045313113300007258Vadose Zone SoilVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS*
Ga0099794_1024465333300007265Vadose Zone SoilMHGMLSAAIVIGVFAVAAAACLYVAVRAFTAGGRRGDAS*
Ga0099795_1016331423300007788Vadose Zone SoilMHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRPGDKHSDAS*
Ga0099829_1090060513300009038Vadose Zone SoilMHGMLSAAIVIGVLAVAAAACLWVAVRVYAAGRR*
Ga0099828_1043085533300009089Vadose Zone SoilMHGMLSAAILIGVFAVAAAACLYVAVRIYAAGGRHGDPS*
Ga0099827_1008205743300009090Vadose Zone SoilMHGMLSAAIVIGVFAVVAAACLYVAVRAFTAGGRRGDAP*
Ga0099827_1023214433300009090Vadose Zone SoilMHGMLSAAIVIGVLAVAAAACLYVAVRVYAAGRR*
Ga0105250_1009933823300009092Switchgrass RhizosphereMHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDKHGDPS*
Ga0105247_1005641033300009101Switchgrass RhizosphereMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRRGDAS*
Ga0116225_104696733300009524Peatlands SoilMHGMLSAAILIGVLAVMAVACLYVAIRVYAAGGRRGDPS*
Ga0126374_1093663923300009792Tropical Forest SoilMHGMLSAAIVIGAFAVVAAACLYVAVRVFAAGGRRGDPS*
Ga0126373_1105374033300010048Tropical Forest SoilMHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRRGDPS*
Ga0126373_1291858023300010048Tropical Forest SoilMHGMLSAAIVIGVFAVSAAACLFLAVRVFAAGGRRGDPS*
Ga0126318_1043624023300010152SoilMHGMLSAAIVIGVFAVAAAACLYLAVRVFASGGRPGDRHGDPS*
Ga0099796_1007074523300010159Vadose Zone SoilMHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRHGDAS*
Ga0134084_1013762523300010322Grasslands SoilMHGMLSAAIVIGVFAVFAAACLYLAVRVFAAGGRCGDPS*
Ga0134080_1005443433300010333Grasslands SoilMHGMLSAAIVTGVFAVAAAACLYLAVRVLAAGGRRGDPS*
Ga0126370_1105126823300010358Tropical Forest SoilMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0126372_1299906323300010360Tropical Forest SoilMHGMLSAAIVIGVFAVFAVACLYLAVRVFAAGGRRGDPS*
Ga0134125_1291839023300010371Terrestrial SoilMHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDEHGDPS*
Ga0134128_1317686223300010373Terrestrial SoilMHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGGKHGDPS*
Ga0105239_1282891723300010375Corn RhizosphereMHGMLSAAIVFGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS*
Ga0126381_10071283833300010376Tropical Forest SoilMHGMLSAAIVIGVFAVVAAGCLYVAVRVFAAGGRRGDPS*
Ga0134121_1198780423300010401Terrestrial SoilAMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS*
Ga0138568_104473123300011080Peatlands SoilMLSAAILIGVLAVMAVACLYVAIRVYAAGGRRGDPS*
Ga0137389_1013804823300012096Vadose Zone SoilMHGMLSAAILIGVFAVAAAACLYVAVRVYAAGGRRGDPS*
Ga0137383_1000108973300012199Vadose Zone SoilMHGMLSAAIVIGVFAVVAAACLYMAVRAFTAGGRRGDAP*
Ga0137365_1038931313300012201Vadose Zone SoilPPMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRRGDPS*
Ga0137363_1096143123300012202Vadose Zone SoilMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRHGDPS*
Ga0137362_1094210723300012205Vadose Zone SoilMHGMLSAAIVIGVLAVAAAACLWVAARVYAAGRR*
Ga0137380_1003549653300012206Vadose Zone SoilMHGMLSAAIVIGVFAVAAAACLYVAVRVFTAGGRRGDAS*
Ga0137378_1049671923300012210Vadose Zone SoilMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDRHGDAS*
Ga0137378_1060626323300012210Vadose Zone SoilMHGMLSAAIVIGVFAVAAAACLYVAVRVFTAGGRRGDPS*
Ga0137377_1133092023300012211Vadose Zone SoilMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPRR*
Ga0137387_1081354723300012349Vadose Zone SoilMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDRHGDAS*
Ga0137386_1013631943300012351Vadose Zone SoilAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDRHGDAS*
Ga0137369_1069519123300012355Vadose Zone SoilSAAIVIGVFAVAAAACLYLAVRVLAAGGRRGDPS*
Ga0134034_118796213300012375Grasslands SoilMLSAAIVVGVFALAAAACLYLAVRVFVAGGRPGDKHSDAS*
Ga0134055_107551123300012401Grasslands SoilLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDPS*
Ga0157344_100295423300012476Arabidopsis RhizosphereMHGMLSAAIVIGVFAVCAAACLYLAVRVFTAGGRRGDPS*
Ga0157349_103153113300012489Unplanted SoilMHGMLSAAIVIGVFAVVAAACLYLAVRVLAAGGRPGDKHGDPS*
Ga0157355_101127923300012493Unplanted SoilMHGMLSAAIVIGVLAVSAAACLYLAVRVFTAGGRRGDPS*
Ga0157341_100236623300012494Arabidopsis RhizosphereMHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRPGEDKHGDPS*
Ga0157345_101108823300012498Arabidopsis RhizosphereMHGMLSAALVIGVFAVCAAACLYLAVRVFAAGGRRGDPS*
Ga0157314_100484223300012500Arabidopsis RhizosphereMHGMLSAAIVIGVFAVSAAACVYLAVRVFAAGGRRGDPS*
Ga0137396_1099103223300012918Vadose Zone SoilMHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRRGDPS*
Ga0137396_1103977423300012918Vadose Zone SoilMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDA
Ga0164309_1060960023300012984SoilMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDQHGDPS*
Ga0164306_1147396423300012988SoilMHGMLSAAIVVGVFALAAAACLYLAVRVFATGGRPGDKHSDAS*
Ga0164305_1098933323300012989SoilRAMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS*
Ga0181523_1011486513300014165BogLSAAILIGVFAVIAVACLYVAMRAYAAGGRRGDTS*
Ga0182000_1059081713300014487SoilMHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRPGDEHGDPS*
Ga0132258_1281884533300015371Arabidopsis RhizosphereMHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDKHGDPS*
Ga0132256_10098559813300015372Arabidopsis RhizosphereLPPMHGMLSAAIVIGVFAVCAAACLYLAVRVFTAGGRRGDPS*
Ga0182032_1085649123300016357SoilMHGMLSAAIVIGVFAVCAAACMYLAVRVFAAGGRPGDRHGDPS
Ga0187809_1006631923300017937Freshwater SedimentMHGMLSAAIVTGVFAVTAVACLYLAVRVFAAGGRPGDKHGDPS
Ga0187819_1021133113300017943Freshwater SedimentMHGMLSAAILIGVLAVMAVACLYVAIRVYAAGGRHGDTS
Ga0187879_1032854413300017946PeatlandPVKCGLMHGMLSAAILIGVFAVIAVACLYVAMRVYAAGGRRGDTS
Ga0187817_1012061543300017955Freshwater SedimentMHGMLSAAILIGVLAVMAAACLYVAVRVYAAGGRRGDTS
Ga0187779_1048383823300017959Tropical PeatlandMHGVLSAAIVIGVFAVAAAACLYLAVRVYAAGGRHGDPS
Ga0187780_1079004423300017973Tropical PeatlandMHGMLSAAILIGVLAVVAAACLYLAVRVYAAGGRRGDAS
Ga0187780_1097963913300017973Tropical PeatlandMHGMLSAAILIGVLAVVAAACLYLAVRVYAAGRRWARR
Ga0187777_1049260023300017974Tropical PeatlandMHGMLSAAILIGAFAVAAVACLYLAVRVYAAGGRRGDPS
Ga0187777_1053160523300017974Tropical PeatlandMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDKHGDPS
Ga0187767_1018677723300017999Tropical PeatlandMHGMLSAAILIGVLAVVAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0187883_1031875823300018037PeatlandMHGMLSAAILIGVFAVIAVACLYVAMRVYAAGGRRGDTS
Ga0187765_1061906223300018060Tropical PeatlandMHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0187773_1097658323300018064Tropical PeatlandMHGMLSEAIVIGVFAVTAVACLYLAVRVFAAGGRPGDRHGDPS
Ga0066662_1197181823300018468Grasslands SoilMHGMLSAAIVTGVFAVAAAACLYLAVRVFAAGGRHGDPS
Ga0066669_1023752233300018482Grasslands SoilMHGMLSAAIVIGVFAVSAAACLYLAVRVFTAGGRRGDPS
Ga0173482_1014933323300019361SoilMHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRRGDPS
Ga0173479_1050030113300019362SoilRTLPPMHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRRGDPS
Ga0193701_105317323300019875SoilMHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRRGDPS
Ga0206349_141587023300020075Corn, Switchgrass And Miscanthus RhizosphereAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDKHGDPS
Ga0210399_1045473623300020581SoilMHGMLSAAILIGVFAVAASACLYLAVRVYAAGGRRGDSS
Ga0210400_1007201643300021170SoilMHGMLSAAIVIGVFAVTAVACLYLAVRVFAAGGRPGDKHGDPS
Ga0210408_1103101023300021178SoilMLSAAIVIGVFAVFAAACLYLAARVFAAGGRRGDPS
Ga0210396_1126017923300021180SoilMHGMLSAAIVIGVFAVCAAACLYLAVRVLAAGGRRGDPS
Ga0193719_1045755923300021344SoilMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRRGDPS
Ga0213882_1012705823300021362Exposed RockMHGMLSAAILIGVLAVIAAACLYLVVRVYAAGGRHHDAS
Ga0213882_1032774023300021362Exposed RockMHGMLSAAILIGVFAAIGAAALYLAVRVYVAGRHRGHTS
Ga0213881_10000072463300021374Exposed RockMHGMLSAAVLVTVFAAVAAASLYAAVRVFAAGSRRRRPE
Ga0213881_1003705023300021374Exposed RockMHGMLSAAILIGVFAVIGAAALYLAVRVYVAGRHRGHTS
Ga0213881_1011674913300021374Exposed RockMHGMLSAAILIGVLGVIAAACLYLAVRVYAAGGRHGDAS
Ga0213874_1008656523300021377Plant RootsMHGMLSAAILIAVLAVVAAAGLYLAVRVYAAAGGKPADKQGRRGDAS
Ga0213874_1008916623300021377Plant RootsMHGMLSAAILIGVFAVIGAAALYLAVRVYAAGGHRGHPS
Ga0213876_1019148213300021384Plant RootsMHGMLSAAIVIGVLAVIAAACLYGAGRVLAAGRARA
Ga0213875_1023479623300021388Plant RootsMHGMLSAAILIGVLGVIAAACLYLAVRVYAAGGRHGDTS
Ga0210397_1001107953300021403SoilMHGMLSAAIVIGVFAVCAAACLYLALRVLAAGGRRGDPS
Ga0210397_1012837143300021403SoilMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS
Ga0210386_1071258133300021406SoilMHGMLSAAILIGVFAVAASACLYLAVRVYAAGGRRGDTS
Ga0193694_103223023300021415SoilMHGMLSAAIVIGVFAMAAAACLYLAVRVLAAGGRRGDPS
Ga0210384_1047908823300021432SoilMHGMLSAAIVTGVFALAAAACLYLAVRVFAAGGRHGDPS
Ga0210402_1039362033300021478SoilMHGMLSAAIVIGVFAVFAAACLYLAVRVFAAGGRRGDPS
Ga0126371_1130156323300021560Tropical Forest SoilMHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0126371_1187028523300021560Tropical Forest SoilMHGMLSAAIVIGVFAVAAVACLYLAVRVFAAGGRRGDPS
Ga0213851_142526423300021860WatershedsMHGMLSAAILIGVLAVMAAACLYVAVRVYAAGGRRGDPS
Ga0242676_101300613300022512SoilLSAAILIGVFAVAASACLYLAVRVYAAGGRRGDTS
Ga0242678_106130813300022715SoilLSAAILIGVFAVTAAACLYLAVRVYAAGGRRGDTS
Ga0242675_105424223300022718SoilLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS
Ga0242672_102327123300022720SoilLSAAIVIGVFAVCAAACLYLAVRVLAAGGRRGDPS
Ga0224565_102741723300024176Plant LitterMHGMLSAAILIGVFAVTAAVCLYLAVRVYAAGGRRGDTS
Ga0228598_104965423300024227RhizosphereCLARTLRPMHGMLSAAILIGVFAVTAAACLYLAVRVYAAGGRRGDTS
Ga0247666_100510243300024323SoilMHGMLSAAIVIGVFAVCAAACLYLAVRVFTAGGRRGDPS
Ga0207643_1079482133300025908Miscanthus RhizosphereHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS
Ga0207684_1010076133300025910Corn, Switchgrass And Miscanthus RhizosphereMLSAAIVTGVFAVAAAACLYLAVRVFAAGGRHGDPS
Ga0207679_1153672523300025945Corn RhizosphereMHGMLSAAILIGVFAVVATACLYLVVRVFMAGRGHTR
Ga0209804_124649213300026335SoilPVHLRPMHGMLSAAIVVGVFALAAAACLYLAVRVFVAGGRPGDKHSDAS
Ga0257162_101986723300026340SoilMHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRHGDAS
Ga0209161_1036191613300026548SoilMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGD
Ga0209648_1054067823300026551Grasslands SoilMHGMLSAAILIFVFAVAAVACLYAAVRVYVAGGRRGDPS
Ga0179587_1051627913300026557Vadose Zone SoilSPVHLRAMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRRGDPS
Ga0209326_100067353300026899Forest SoilIVVGVFALAAAACLYLAVRVFAAGSRPGDKHSDAS
Ga0208860_100281033300027076Forest SoilMHGMLSAAILIGVFAVTAAACLYVAVRVYAAGGRRGDAS
Ga0208098_101406923300027172Forest SoilMHGMLSAAILIGVFAVAASACLYLAVRVYAAGGRRGD
Ga0208324_102866633300027604Peatlands SoilMHGMLSAAILIGVLAVMAVACLYVAIRVYAAGGRRGDPS
Ga0209178_142413823300027725Agricultural SoilSPVHLRAMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS
Ga0209177_1008831023300027775Agricultural SoilMLSAAIVIGVFAVCAAACLYLAVRVFTAGGRRGDPS
Ga0209074_1016079713300027787Agricultural SoilMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDKH
Ga0209656_1003201023300027812Bog Forest SoilMHGMLSAAILIGVFAVIAAACLYVAVRVYTAGGRRGDTS
Ga0209590_1010923223300027882Vadose Zone SoilMHGMLSAAIVIGVFAVVAAACLYVAVRAFTAGGRRGDAP
Ga0209488_1001413363300027903Vadose Zone SoilMHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRRGDAS
Ga0209698_1028104223300027911WatershedsMHGMLSAAILIGVFAVAAAACLYLVVRVYTAGGRRGDSS
Ga0209698_1143212513300027911WatershedsGMLSAAILIGVFAVIAAACLYVAVRVYAAGGRRGDTS
Ga0209062_110623333300027965Surface SoilMHGMLSAAVLIGVLAAVAAGCGWLAVRAYLAGGRRGDP
Ga0209061_1000975243300027968Surface SoilMHGMLSAAVLIGVLAAVAAGCGWLAVRAYLAGGRRGDPS
Ga0209061_1004596143300027968Surface SoilMHGMLSAGVLIGALAAVAAACGWLAVRAYLAGGRRGDPS
Ga0222749_1011313713300029636SoilRAAPRTLPGMHGMLSAAIVIGVFAVTAVACLYLAVRVFAAGGRHGDPS
Ga0311371_1234178823300029951PalsaMHGMLSAAILIGVLAVAAAACLYAVVRVYLAGTRRG
Ga0310037_1022750723300030494Peatlands SoilMHGMLSAAILIGVFAVMAAACLYVAVRVYAAGGRRGDTS
Ga0265763_103539113300030763SoilLRPMHGMLSAAILIGVFAVTAAVCLYLVVRVYAAGGRRGDTS
Ga0170834_10805815013300031057Forest SoilGVSLVQLRPMHGMLSAAILIGVLAVTAAACLYLAVRVYAAGGRRDDPS
Ga0308197_1038371623300031093SoilLSAAIVIGVFAVAAAACLYLAVRVLAAGGRRGDPS
Ga0170820_1768179723300031446Forest SoilMHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRRGNPS
Ga0170819_1722880213300031469Forest SoilLRAMHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRRGDAS
Ga0318516_1005705723300031543SoilMHGMLSAAILIGVFAVAAAVCLYVAVRAYAAGGRRGDAS
Ga0318516_1022746623300031543SoilMHGMLSAAIVIGVFALCAAACLYLAMRVFAAGGRPGDRHGDPS
Ga0318516_1068234123300031543SoilTLRAMHGMLSAAILIGVLAVVAAACLYLAVRVYAAGGRRGDAS
Ga0318541_1066347223300031545SoilMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0318538_1005764243300031546SoilMHGMLSAAIVIGVFAVAAVACLYLAVRVLAAGGRRGDPS
Ga0318571_1028054823300031549SoilRTAAILICLFAVTAVACLLAAVRVYAAGRQRGRDAR
Ga0318515_1057817313300031572SoilGRLPRTLRVMHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0318574_1050233723300031680SoilHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0318572_1029219333300031681SoilMHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDRHG
Ga0318496_1077512823300031713SoilRTLRAMHGMLSAAILIGVLAVVAAACLYLAVRVYAAGGRRGDAS
Ga0307468_10145094713300031740Hardwood Forest SoilMHGMLSAAIVVGVFALAAATCLYLAVRVFAAGGRPGDKHSDAS
Ga0318492_1014687113300031748SoilGRLARTLRAMHGMLSAAILIGVLAVVAAACLYLAVRVYAAGGRRGDAS
Ga0318494_1035671733300031751SoilMHGMLSAAIVIGVFAVTAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0318494_1041306233300031751SoilMHGMLSAAIVIGVLAVSAAACLYLAVRMFAAGGRPGDRHGD
Ga0318494_1055767023300031751SoilMHGMLSAAIVIGVLAVCAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0318548_1046686823300031793SoilPRTLRVMHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0318557_1034694523300031795SoilLPRTLRAMHGMLSAAIVIGVFAVAAVACLYLAVRVFAAGGRRGDPS
Ga0318523_1005046643300031798SoilRLPRTLRAMHGMLSAAIVIGVFAVAAVACLYLAVRVFAAGGRRGDPS
Ga0318523_1028429913300031798SoilTLRVMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRRGDPS
Ga0318568_1027248133300031819SoilMHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRPGDRHG
Ga0307473_1052503123300031820Hardwood Forest SoilMHGMLSAAIVVGVFALAAAACLYLAVRMLAAGGRPGDKHGDPS
Ga0307478_1162873113300031823Hardwood Forest SoilRTLRAMHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRRGDPS
Ga0318499_1025860013300031832SoilPVHCGTMHGMLSAAIVIGVFALCAAACLYLAMRVFAAGGRPGDRHGDPS
Ga0318536_1051940313300031893SoilMHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDR
Ga0318520_1077227213300031897SoilMHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRPGDR
Ga0318520_1098769323300031897SoilRTLRVMHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0310910_1126613723300031946SoilMHGMLSAAILIGVFAVAAAACLYVAVRAYAAGGRRGDAS
Ga0318531_1010168633300031981SoilMHGMLSAAIVIGVFAVCSAACLYLAVRVFAAGGRPGDRHGDPS
Ga0318531_1022866923300031981SoilPRTLRAMHGMLSAAIVIGVFAVAAVACLYLAVRVFAAGGRRGDPS
Ga0318575_1037616823300032055SoilTLRPMHGMLSAAILIGVFAVAAAVCLYVAVRAYAAGGRRGDAS
Ga0318510_1007892023300032064SoilMHGMLSAAIVIGVLAVSAAACLYLAVRMFAAGGRPGDRHGDSS
Ga0318513_1025015523300032065SoilGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0318553_1076583323300032068SoilAGWRRARTLRVMHGMLSAAILIGVFAVAAAACLYAAVRVYAAGRR
Ga0311301_1248913323300032160Peatlands SoilMHGMLSAAILIGVLAVMAVACLYVAIRVYAAGGRHGDPS
Ga0348332_1015385723300032515Plant LitterPMHGMLSAAILIGVFAVTAAACLYLAVRVYAAGGRRGDTS
Ga0335085_1016019423300032770SoilMHGMLSAAIVIGVFAVTAAACLYLAVRVFAAGGRPGERHVDPS
Ga0335085_1047354733300032770SoilMHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDKHGDPS
Ga0335085_1066550813300032770SoilAIVIGVLAVSATACLYLAVRVFAAGGRPGDRHGDPS
Ga0335085_1079410923300032770SoilMHGMLSAAIVIGVFAVTAAACLYLAVRVFAAGGRPGDKHVDPS
Ga0335085_1082319423300032770SoilMHGMLSAAIVLGVFAVCAAACLYLAVRVFAAGGRPGDRHGDPS
Ga0335082_1003887123300032782SoilMHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRRGDPS
Ga0335082_1026202923300032782SoilMHGMLSAAILIGVFAVAAAACLYVAVRAYAAGGRRGDAP
Ga0335082_1155786123300032782SoilMHGMLSAAIVIGGFAVVAAACLYLAVRVFAAGGRRGDAS
Ga0335079_1018890823300032783SoilMHGMLSAAIVIGVFAACAAACLYLAVRVFAAGARPGDKHGDPS
Ga0335079_1040343033300032783SoilMHGMLSAAIVIGVFAVIAAACLYLAVRVLAAGGPPGDSHGDPS
Ga0335078_1016871933300032805SoilMHGMLSAAILIGVLAVVAAACLYLAVRVYADARDKQGRRGDAS
Ga0335080_1045595533300032828SoilMHGMLSAAIVIGVFAVIAAACLYLAVRVLAAGARPGDKHGDPS
Ga0335080_1145157013300032828SoilMHGMLSAAILIGVLAVVAAACLYLAVRVYAGARDKQGRRGDAS
Ga0335069_1166427813300032893SoilMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDKHGDPS
Ga0335069_1201809513300032893SoilLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDKHGDPS
Ga0335072_1157383423300032898SoilMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDTHGDPS
Ga0335083_1026113133300032954SoilMHGMLSAAIVIGVLAVTAAACLYLAVRVFAAGGRPGERHVDPS
Ga0335083_1045674823300032954SoilMHGMLSAGIVIGVFAVSAAACLYLAVRVFVAGGRRGDPS
Ga0335076_1078183333300032955SoilMHGMLSAAILIGVFAVIAAACLYVAVRVHAVGGRHGDTS
Ga0335076_1126711613300032955SoilRTLPGMHGMLSAAIVIGVFAVTAVACLYLAVRVFAAGGRPGDNHGDPS
Ga0335077_1052065723300033158SoilMHGMLSAAIVIGVFAVTAVACLYPAVRVFAAGGRPGDKHGDPS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.