Basic Information | |
---|---|
Family ID | F017547 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 240 |
Average Sequence Length | 40 residues |
Representative Sequence | MHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRRGDPS |
Number of Associated Samples | 204 |
Number of Associated Scaffolds | 240 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 2.09 % |
% of genes near scaffold ends (potentially truncated) | 37.50 % |
% of genes from short scaffolds (< 2000 bps) | 89.17 % |
Associated GOLD sequencing projects | 199 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.833 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.167 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.167 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.917 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 240 Family Scaffolds |
---|---|---|
PF08768 | THAP4_heme-bd | 64.58 |
PF02635 | DrsE | 18.33 |
PF01475 | FUR | 4.17 |
PF07685 | GATase_3 | 3.75 |
PF01571 | GCV_T | 1.67 |
PF08669 | GCV_T_C | 1.25 |
PF08353 | MurT_C | 0.83 |
PF14748 | P5CR_dimer | 0.83 |
PF03900 | Porphobil_deamC | 0.42 |
PF05140 | ResB | 0.42 |
PF12833 | HTH_18 | 0.42 |
PF00300 | His_Phos_1 | 0.42 |
COG ID | Name | Functional Category | % Frequency in 240 Family Scaffolds |
---|---|---|---|
COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 4.17 |
COG0769 | UDP-N-acetylmuramyl tripeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 0.42 |
COG1333 | Cytochrome c biogenesis protein ResB | Posttranslational modification, protein turnover, chaperones [O] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 50.83 % |
All Organisms | root | All Organisms | 49.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559006|FI_contig07087 | Not Available | 1211 | Open in IMG/M |
2170459017|G14TP7Y01CPUOU | Not Available | 505 | Open in IMG/M |
2189573001|GZR05M101DW7JW | Not Available | 536 | Open in IMG/M |
3300003219|JGI26341J46601_10184682 | Not Available | 571 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10252034 | Not Available | 717 | Open in IMG/M |
3300003659|JGI25404J52841_10001709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3957 | Open in IMG/M |
3300004080|Ga0062385_10852890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 601 | Open in IMG/M |
3300004082|Ga0062384_100550593 | Not Available | 773 | Open in IMG/M |
3300004114|Ga0062593_101595288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 708 | Open in IMG/M |
3300004121|Ga0058882_1779103 | Not Available | 762 | Open in IMG/M |
3300005164|Ga0066815_10002951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1654 | Open in IMG/M |
3300005176|Ga0066679_10255059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1131 | Open in IMG/M |
3300005177|Ga0066690_10216760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1277 | Open in IMG/M |
3300005186|Ga0066676_11179639 | Not Available | 502 | Open in IMG/M |
3300005187|Ga0066675_10661562 | Not Available | 785 | Open in IMG/M |
3300005363|Ga0008090_15008828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 913 | Open in IMG/M |
3300005434|Ga0070709_10682943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 797 | Open in IMG/M |
3300005436|Ga0070713_101831845 | Not Available | 589 | Open in IMG/M |
3300005437|Ga0070710_11431305 | Not Available | 517 | Open in IMG/M |
3300005445|Ga0070708_101179283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 716 | Open in IMG/M |
3300005454|Ga0066687_10497030 | Not Available | 721 | Open in IMG/M |
3300005524|Ga0070737_10002860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 19738 | Open in IMG/M |
3300005524|Ga0070737_10036706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2909 | Open in IMG/M |
3300005555|Ga0066692_10712482 | Not Available | 621 | Open in IMG/M |
3300005560|Ga0066670_10629868 | Not Available | 652 | Open in IMG/M |
3300005610|Ga0070763_10135021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1277 | Open in IMG/M |
3300005764|Ga0066903_100750166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 1733 | Open in IMG/M |
3300005764|Ga0066903_101884962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1145 | Open in IMG/M |
3300005764|Ga0066903_104536060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 740 | Open in IMG/M |
3300005764|Ga0066903_108117666 | Not Available | 538 | Open in IMG/M |
3300006028|Ga0070717_10087205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2628 | Open in IMG/M |
3300006032|Ga0066696_11085458 | Not Available | 509 | Open in IMG/M |
3300006034|Ga0066656_10204515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1258 | Open in IMG/M |
3300006050|Ga0075028_100665937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 624 | Open in IMG/M |
3300006052|Ga0075029_100308952 | Not Available | 1011 | Open in IMG/M |
3300006057|Ga0075026_100854437 | Not Available | 556 | Open in IMG/M |
3300006059|Ga0075017_101459178 | Not Available | 539 | Open in IMG/M |
3300006086|Ga0075019_10407788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 833 | Open in IMG/M |
3300006172|Ga0075018_10340179 | Not Available | 750 | Open in IMG/M |
3300006354|Ga0075021_10620643 | Not Available | 691 | Open in IMG/M |
3300006573|Ga0074055_10006740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1889 | Open in IMG/M |
3300006604|Ga0074060_12040006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 512 | Open in IMG/M |
3300006606|Ga0074062_10002334 | Not Available | 618 | Open in IMG/M |
3300006755|Ga0079222_10453375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 918 | Open in IMG/M |
3300006797|Ga0066659_10404536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1074 | Open in IMG/M |
3300006854|Ga0075425_100863026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1036 | Open in IMG/M |
3300006954|Ga0079219_11860184 | Not Available | 566 | Open in IMG/M |
3300007255|Ga0099791_10329105 | Not Available | 730 | Open in IMG/M |
3300007258|Ga0099793_10453131 | Not Available | 634 | Open in IMG/M |
3300007265|Ga0099794_10244653 | Not Available | 924 | Open in IMG/M |
3300007788|Ga0099795_10163314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 921 | Open in IMG/M |
3300009038|Ga0099829_10900605 | Not Available | 734 | Open in IMG/M |
3300009089|Ga0099828_10430855 | Not Available | 1189 | Open in IMG/M |
3300009090|Ga0099827_10082057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 2520 | Open in IMG/M |
3300009090|Ga0099827_10232144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora | 1545 | Open in IMG/M |
3300009092|Ga0105250_10099338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1187 | Open in IMG/M |
3300009101|Ga0105247_10056410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2426 | Open in IMG/M |
3300009524|Ga0116225_1046967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2089 | Open in IMG/M |
3300009792|Ga0126374_10936639 | Not Available | 674 | Open in IMG/M |
3300010048|Ga0126373_11053740 | Not Available | 879 | Open in IMG/M |
3300010048|Ga0126373_12918580 | Not Available | 533 | Open in IMG/M |
3300010152|Ga0126318_10436240 | Not Available | 942 | Open in IMG/M |
3300010159|Ga0099796_10070745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1259 | Open in IMG/M |
3300010322|Ga0134084_10137625 | Not Available | 811 | Open in IMG/M |
3300010333|Ga0134080_10054434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1579 | Open in IMG/M |
3300010358|Ga0126370_11051268 | Not Available | 747 | Open in IMG/M |
3300010360|Ga0126372_12999063 | Not Available | 524 | Open in IMG/M |
3300010371|Ga0134125_12918390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 519 | Open in IMG/M |
3300010373|Ga0134128_13176862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 505 | Open in IMG/M |
3300010375|Ga0105239_12828917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 566 | Open in IMG/M |
3300010376|Ga0126381_100712838 | Not Available | 1436 | Open in IMG/M |
3300010401|Ga0134121_11987804 | Not Available | 613 | Open in IMG/M |
3300011080|Ga0138568_1044731 | Not Available | 915 | Open in IMG/M |
3300012096|Ga0137389_10138048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1984 | Open in IMG/M |
3300012199|Ga0137383_10001089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 15607 | Open in IMG/M |
3300012201|Ga0137365_10389313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1028 | Open in IMG/M |
3300012202|Ga0137363_10961431 | Not Available | 725 | Open in IMG/M |
3300012205|Ga0137362_10942107 | Not Available | 737 | Open in IMG/M |
3300012206|Ga0137380_10035496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 4599 | Open in IMG/M |
3300012210|Ga0137378_10496719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1127 | Open in IMG/M |
3300012210|Ga0137378_10606263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1005 | Open in IMG/M |
3300012211|Ga0137377_11330920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 648 | Open in IMG/M |
3300012349|Ga0137387_10813547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 676 | Open in IMG/M |
3300012351|Ga0137386_10136319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1752 | Open in IMG/M |
3300012355|Ga0137369_10695191 | Not Available | 699 | Open in IMG/M |
3300012375|Ga0134034_1187962 | Not Available | 607 | Open in IMG/M |
3300012401|Ga0134055_1075511 | Not Available | 876 | Open in IMG/M |
3300012476|Ga0157344_1002954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 932 | Open in IMG/M |
3300012489|Ga0157349_1031531 | Not Available | 556 | Open in IMG/M |
3300012493|Ga0157355_1011279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 706 | Open in IMG/M |
3300012494|Ga0157341_1002366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1239 | Open in IMG/M |
3300012498|Ga0157345_1011088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 794 | Open in IMG/M |
3300012500|Ga0157314_1004842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1003 | Open in IMG/M |
3300012918|Ga0137396_10991032 | Not Available | 609 | Open in IMG/M |
3300012918|Ga0137396_11039774 | Not Available | 590 | Open in IMG/M |
3300012984|Ga0164309_10609600 | Not Available | 854 | Open in IMG/M |
3300012988|Ga0164306_11473964 | Not Available | 582 | Open in IMG/M |
3300012989|Ga0164305_10989333 | Not Available | 714 | Open in IMG/M |
3300014165|Ga0181523_10114865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1607 | Open in IMG/M |
3300014487|Ga0182000_10590817 | Not Available | 534 | Open in IMG/M |
3300015371|Ga0132258_12818845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1210 | Open in IMG/M |
3300015372|Ga0132256_100985598 | Not Available | 958 | Open in IMG/M |
3300016357|Ga0182032_10856491 | Not Available | 771 | Open in IMG/M |
3300017937|Ga0187809_10066319 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
3300017943|Ga0187819_10211331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1143 | Open in IMG/M |
3300017946|Ga0187879_10328544 | Not Available | 848 | Open in IMG/M |
3300017955|Ga0187817_10120615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1659 | Open in IMG/M |
3300017959|Ga0187779_10483838 | Not Available | 817 | Open in IMG/M |
3300017973|Ga0187780_10790044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 687 | Open in IMG/M |
3300017973|Ga0187780_10979639 | Not Available | 616 | Open in IMG/M |
3300017974|Ga0187777_10492600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 856 | Open in IMG/M |
3300017974|Ga0187777_10531605 | Not Available | 824 | Open in IMG/M |
3300017999|Ga0187767_10186777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 646 | Open in IMG/M |
3300018037|Ga0187883_10318758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 794 | Open in IMG/M |
3300018060|Ga0187765_10619062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 701 | Open in IMG/M |
3300018064|Ga0187773_10976583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 553 | Open in IMG/M |
3300018468|Ga0066662_11971818 | Not Available | 611 | Open in IMG/M |
3300018482|Ga0066669_10237522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1429 | Open in IMG/M |
3300019361|Ga0173482_10149333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 908 | Open in IMG/M |
3300019362|Ga0173479_10500301 | Not Available | 613 | Open in IMG/M |
3300019875|Ga0193701_1053173 | Not Available | 817 | Open in IMG/M |
3300020075|Ga0206349_1415870 | Not Available | 821 | Open in IMG/M |
3300020581|Ga0210399_10454736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1066 | Open in IMG/M |
3300021170|Ga0210400_10072016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2709 | Open in IMG/M |
3300021178|Ga0210408_11031010 | Not Available | 635 | Open in IMG/M |
3300021180|Ga0210396_11260179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 617 | Open in IMG/M |
3300021344|Ga0193719_10457559 | Not Available | 518 | Open in IMG/M |
3300021362|Ga0213882_10127058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1040 | Open in IMG/M |
3300021362|Ga0213882_10327740 | Not Available | 641 | Open in IMG/M |
3300021374|Ga0213881_10000072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 84090 | Open in IMG/M |
3300021374|Ga0213881_10037050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2052 | Open in IMG/M |
3300021374|Ga0213881_10116749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1159 | Open in IMG/M |
3300021377|Ga0213874_10086565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1023 | Open in IMG/M |
3300021377|Ga0213874_10089166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1011 | Open in IMG/M |
3300021384|Ga0213876_10191482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1088 | Open in IMG/M |
3300021388|Ga0213875_10234796 | Not Available | 864 | Open in IMG/M |
3300021403|Ga0210397_10011079 | Not Available | 5443 | Open in IMG/M |
3300021403|Ga0210397_10128371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1748 | Open in IMG/M |
3300021406|Ga0210386_10712581 | Not Available | 865 | Open in IMG/M |
3300021415|Ga0193694_1032230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 735 | Open in IMG/M |
3300021432|Ga0210384_10479088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1120 | Open in IMG/M |
3300021478|Ga0210402_10393620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1286 | Open in IMG/M |
3300021560|Ga0126371_11301563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 860 | Open in IMG/M |
3300021560|Ga0126371_11870285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 720 | Open in IMG/M |
3300021860|Ga0213851_1425264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 920 | Open in IMG/M |
3300022512|Ga0242676_1013006 | Not Available | 789 | Open in IMG/M |
3300022715|Ga0242678_1061308 | Not Available | 565 | Open in IMG/M |
3300022718|Ga0242675_1054242 | Not Available | 679 | Open in IMG/M |
3300022720|Ga0242672_1023271 | Not Available | 880 | Open in IMG/M |
3300024176|Ga0224565_1027417 | Not Available | 634 | Open in IMG/M |
3300024227|Ga0228598_1049654 | Not Available | 832 | Open in IMG/M |
3300024323|Ga0247666_1005102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2929 | Open in IMG/M |
3300025908|Ga0207643_10794821 | Not Available | 613 | Open in IMG/M |
3300025910|Ga0207684_10100761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2468 | Open in IMG/M |
3300025945|Ga0207679_11536725 | Not Available | 610 | Open in IMG/M |
3300026335|Ga0209804_1246492 | Not Available | 677 | Open in IMG/M |
3300026340|Ga0257162_1019867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 807 | Open in IMG/M |
3300026548|Ga0209161_10361916 | Not Available | 646 | Open in IMG/M |
3300026551|Ga0209648_10540678 | Not Available | 655 | Open in IMG/M |
3300026557|Ga0179587_10516279 | Not Available | 784 | Open in IMG/M |
3300026899|Ga0209326_1000673 | Not Available | 2979 | Open in IMG/M |
3300027076|Ga0208860_1002810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1364 | Open in IMG/M |
3300027172|Ga0208098_1014069 | Not Available | 756 | Open in IMG/M |
3300027604|Ga0208324_1028666 | Not Available | 1684 | Open in IMG/M |
3300027725|Ga0209178_1424138 | Not Available | 509 | Open in IMG/M |
3300027775|Ga0209177_10088310 | Not Available | 961 | Open in IMG/M |
3300027787|Ga0209074_10160797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 816 | Open in IMG/M |
3300027812|Ga0209656_10032010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3109 | Open in IMG/M |
3300027882|Ga0209590_10109232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1665 | Open in IMG/M |
3300027903|Ga0209488_10014133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 5824 | Open in IMG/M |
3300027911|Ga0209698_10281042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1322 | Open in IMG/M |
3300027911|Ga0209698_11432125 | Not Available | 502 | Open in IMG/M |
3300027965|Ga0209062_1106233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1166 | Open in IMG/M |
3300027968|Ga0209061_1000975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 54927 | Open in IMG/M |
3300027968|Ga0209061_1004596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 13067 | Open in IMG/M |
3300029636|Ga0222749_10113137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1288 | Open in IMG/M |
3300029951|Ga0311371_12341788 | Not Available | 550 | Open in IMG/M |
3300030494|Ga0310037_10227507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 817 | Open in IMG/M |
3300030763|Ga0265763_1035391 | Not Available | 583 | Open in IMG/M |
3300031057|Ga0170834_108058150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1315 | Open in IMG/M |
3300031093|Ga0308197_10383716 | Not Available | 545 | Open in IMG/M |
3300031446|Ga0170820_17681797 | Not Available | 766 | Open in IMG/M |
3300031469|Ga0170819_17228802 | Not Available | 627 | Open in IMG/M |
3300031543|Ga0318516_10057057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2138 | Open in IMG/M |
3300031543|Ga0318516_10227466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1078 | Open in IMG/M |
3300031543|Ga0318516_10682341 | Not Available | 584 | Open in IMG/M |
3300031545|Ga0318541_10663472 | Not Available | 583 | Open in IMG/M |
3300031546|Ga0318538_10057642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1918 | Open in IMG/M |
3300031549|Ga0318571_10280548 | Not Available | 621 | Open in IMG/M |
3300031572|Ga0318515_10578173 | Not Available | 598 | Open in IMG/M |
3300031680|Ga0318574_10502337 | Not Available | 710 | Open in IMG/M |
3300031681|Ga0318572_10292193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 962 | Open in IMG/M |
3300031713|Ga0318496_10775128 | Not Available | 528 | Open in IMG/M |
3300031740|Ga0307468_101450947 | Not Available | 633 | Open in IMG/M |
3300031748|Ga0318492_10146871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1188 | Open in IMG/M |
3300031751|Ga0318494_10356717 | Not Available | 846 | Open in IMG/M |
3300031751|Ga0318494_10413062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
3300031751|Ga0318494_10557670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 669 | Open in IMG/M |
3300031793|Ga0318548_10466868 | Not Available | 617 | Open in IMG/M |
3300031795|Ga0318557_10346945 | Not Available | 682 | Open in IMG/M |
3300031798|Ga0318523_10050466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1954 | Open in IMG/M |
3300031798|Ga0318523_10284299 | Not Available | 826 | Open in IMG/M |
3300031819|Ga0318568_10272481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1049 | Open in IMG/M |
3300031820|Ga0307473_10525031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 804 | Open in IMG/M |
3300031823|Ga0307478_11628731 | Not Available | 533 | Open in IMG/M |
3300031832|Ga0318499_10258600 | Not Available | 675 | Open in IMG/M |
3300031893|Ga0318536_10519403 | Not Available | 598 | Open in IMG/M |
3300031897|Ga0318520_10772272 | Not Available | 602 | Open in IMG/M |
3300031897|Ga0318520_10987693 | Not Available | 531 | Open in IMG/M |
3300031946|Ga0310910_11266137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 571 | Open in IMG/M |
3300031981|Ga0318531_10101686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1267 | Open in IMG/M |
3300031981|Ga0318531_10228669 | Not Available | 839 | Open in IMG/M |
3300032055|Ga0318575_10376168 | Not Available | 720 | Open in IMG/M |
3300032064|Ga0318510_10078920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1220 | Open in IMG/M |
3300032065|Ga0318513_10250155 | Not Available | 858 | Open in IMG/M |
3300032068|Ga0318553_10765833 | Not Available | 505 | Open in IMG/M |
3300032160|Ga0311301_12489133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 579 | Open in IMG/M |
3300032515|Ga0348332_10153857 | Not Available | 901 | Open in IMG/M |
3300032770|Ga0335085_10160194 | Not Available | 2809 | Open in IMG/M |
3300032770|Ga0335085_10473547 | Not Available | 1435 | Open in IMG/M |
3300032770|Ga0335085_10665508 | Not Available | 1162 | Open in IMG/M |
3300032770|Ga0335085_10794109 | Not Available | 1042 | Open in IMG/M |
3300032770|Ga0335085_10823194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1019 | Open in IMG/M |
3300032782|Ga0335082_10038871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5005 | Open in IMG/M |
3300032782|Ga0335082_10262029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1608 | Open in IMG/M |
3300032782|Ga0335082_11557861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 533 | Open in IMG/M |
3300032783|Ga0335079_10188908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2291 | Open in IMG/M |
3300032783|Ga0335079_10403430 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
3300032805|Ga0335078_10168719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3076 | Open in IMG/M |
3300032828|Ga0335080_10455955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1364 | Open in IMG/M |
3300032828|Ga0335080_11451570 | Not Available | 680 | Open in IMG/M |
3300032893|Ga0335069_11664278 | Not Available | 682 | Open in IMG/M |
3300032893|Ga0335069_12018095 | Not Available | 607 | Open in IMG/M |
3300032898|Ga0335072_11573834 | Not Available | 556 | Open in IMG/M |
3300032954|Ga0335083_10261131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1542 | Open in IMG/M |
3300032954|Ga0335083_10456748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1078 | Open in IMG/M |
3300032955|Ga0335076_10781833 | Not Available | 836 | Open in IMG/M |
3300032955|Ga0335076_11267116 | Not Available | 622 | Open in IMG/M |
3300033158|Ga0335077_10520657 | Not Available | 1254 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.17% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.83% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.33% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.33% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.08% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.08% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.08% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.08% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.08% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 2.08% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.67% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.25% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.25% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.25% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.25% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.25% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.83% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.42% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.42% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.42% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.42% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.42% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.42% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.42% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.42% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.42% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.42% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.42% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.42% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.42% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.42% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.42% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.42% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.42% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FI_00833330 | 2166559006 | Grass Soil | MHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRRGDPS |
4ZMR_04137270 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MLSAAIVIGVLAVSAAACLYLAVRVFAAGGRRGDPS |
FD2_07742280 | 2189573001 | Grass Soil | MHGMLSAAIVVGIFALAAAACLYLVVRVFAAGGRPG |
JGI26341J46601_101846821 | 3300003219 | Bog Forest Soil | MHGMLSAAILIGVFAVIAAACLYVAVRVYTAGGRRGDTS* |
JGIcombinedJ51221_102520342 | 3300003505 | Forest Soil | MHGMLSAAILIGVFAVAASACLYLAVRVYAAGGRRGDSS* |
JGI25404J52841_100017094 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDRHGDPS* |
Ga0062385_108528902 | 3300004080 | Bog Forest Soil | MHGMLSAAILIGVLAVMAAACLYVAVRVYAAGGRRGDPS* |
Ga0062384_1005505931 | 3300004082 | Bog Forest Soil | RTLRTMHGMLSAAILIGVFAVAASACLYLAVRVYAAGRR* |
Ga0062593_1015952882 | 3300004114 | Soil | MHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRRGDPS* |
Ga0058882_17791031 | 3300004121 | Forest Soil | RTLRAMHGMLSAAILIGVLAVTAAACLYVAVRVYAAGGRRGDSS* |
Ga0066815_100029511 | 3300005164 | Soil | MHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRRGDPS* |
Ga0066679_102550593 | 3300005176 | Soil | MHGMLSAAIVTGVFAVAAAACLYLAVRVFAAGGRHGDPS* |
Ga0066690_102167603 | 3300005177 | Soil | MHGMLSAAIVVGVFALAAAACLYLAVRVFVAGGRPGDKHSDAS* |
Ga0066676_111796391 | 3300005186 | Soil | MHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRHGDPS* |
Ga0066675_106615622 | 3300005187 | Soil | MHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGEDKHGDPS* |
Ga0008090_150088282 | 3300005363 | Tropical Rainforest Soil | MHGMLSAAIVIGVFAMCAAACLYLAMRVFAAGGRPGDRHGDPS* |
Ga0070709_106829432 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS* |
Ga0070713_1018318451 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGMLSAAIVIGVLAVVAAACLYVAVRVFAAGGRRGDAS* |
Ga0070710_114313052 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PPMHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDEHGDPS* |
Ga0070708_1011792832 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGMLSAAIVIGVFAVSAAACLYLAVRVFVAGGRRGDPS* |
Ga0066687_104970302 | 3300005454 | Soil | MLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS* |
Ga0070737_1000286020 | 3300005524 | Surface Soil | MHGMLSAAVLIGVLAAVAAGCGWLAVRAYLAGGRRGDPS* |
Ga0070737_100367064 | 3300005524 | Surface Soil | MHGMLSAGVLIGALAAVAAACGWLAVRAYLAGGRRGDPS* |
Ga0066661_108288842 | 3300005554 | Soil | GRLTRTLRPMHGMLSAAIVTGVFAVAAAACLYLAVRVFAAGGRHGDPS* |
Ga0066692_107124821 | 3300005555 | Soil | MHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPG |
Ga0066670_106298681 | 3300005560 | Soil | PRTLPPMHGMLSAAIVIGVFAVFAAACLYLAVRVFAAGGRRGDPS* |
Ga0070763_101350213 | 3300005610 | Soil | MHGMLSAAILIGVFAVAASACLYLAVRVYAAGGRRGDTS* |
Ga0066903_1007501662 | 3300005764 | Tropical Forest Soil | MHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDRHGDPS* |
Ga0066903_1018849622 | 3300005764 | Tropical Forest Soil | MHGMLSAAIVIGVFAVAAVACLYLAVRVFAAGGRRGDPS* |
Ga0066903_1045360603 | 3300005764 | Tropical Forest Soil | MHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPG |
Ga0066903_1081176661 | 3300005764 | Tropical Forest Soil | PVHWRVMHGMLSTAIVIGGFAVVAAACLYVAVRVFTAGGRRGDAS* |
Ga0070717_100872053 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSAAIVTGVFAVAAAACLYLAVRVFAAGGRHGDPS* |
Ga0066696_110854581 | 3300006032 | Soil | PRTLPPMHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRRGDPS* |
Ga0066656_102045151 | 3300006034 | Soil | MHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRRGDPS* |
Ga0075028_1006659372 | 3300006050 | Watersheds | MHGMLSAAIVIGVFAVTAVACLYLAVRVFAAGGRPGDKHGDPS* |
Ga0075029_1003089522 | 3300006052 | Watersheds | MHGMLSAAILIGVFAVAAAACLYLVVRVYTAGGRRGDSS* |
Ga0075026_1008544371 | 3300006057 | Watersheds | PMHGMLSAAILIGVLAVMAAACLYVAVRVYAAGGRRGDPS* |
Ga0075017_1014591781 | 3300006059 | Watersheds | MHGMLSAAILIGVFAVAAAACLYLVVRVYAAGGRRGDSS* |
Ga0075019_104077882 | 3300006086 | Watersheds | MHGMLSAAILIGVFAVMAAACLYVAMRVYAAGGRRGDTS* |
Ga0075018_103401791 | 3300006172 | Watersheds | MHGMLSAAILIGVFAVAAAACLYVAVRVYAAGGRRGDSS* |
Ga0075021_106206431 | 3300006354 | Watersheds | AMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHGDPS* |
Ga0074055_100067404 | 3300006573 | Soil | MHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRRGDPS* |
Ga0074060_120400062 | 3300006604 | Soil | MHGMLSAAIVIGVFAVSAAACLYLAVRVFTAGGRRGDPS* |
Ga0074062_100023341 | 3300006606 | Soil | MHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRRGDPS* |
Ga0079222_104533752 | 3300006755 | Agricultural Soil | MHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDKHGDPS* |
Ga0066659_104045362 | 3300006797 | Soil | MHGMLSAAIVIGVFAVFAAACLYLAVRVFAAGGRRGDPS* |
Ga0075425_1008630263 | 3300006854 | Populus Rhizosphere | MHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRP |
Ga0079219_118601841 | 3300006954 | Agricultural Soil | CPVHLRAMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS* |
Ga0099791_103291051 | 3300007255 | Vadose Zone Soil | MHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRRGDAS* |
Ga0099793_104531311 | 3300007258 | Vadose Zone Soil | VVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS* |
Ga0099794_102446533 | 3300007265 | Vadose Zone Soil | MHGMLSAAIVIGVFAVAAAACLYVAVRAFTAGGRRGDAS* |
Ga0099795_101633142 | 3300007788 | Vadose Zone Soil | MHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRPGDKHSDAS* |
Ga0099829_109006051 | 3300009038 | Vadose Zone Soil | MHGMLSAAIVIGVLAVAAAACLWVAVRVYAAGRR* |
Ga0099828_104308553 | 3300009089 | Vadose Zone Soil | MHGMLSAAILIGVFAVAAAACLYVAVRIYAAGGRHGDPS* |
Ga0099827_100820574 | 3300009090 | Vadose Zone Soil | MHGMLSAAIVIGVFAVVAAACLYVAVRAFTAGGRRGDAP* |
Ga0099827_102321443 | 3300009090 | Vadose Zone Soil | MHGMLSAAIVIGVLAVAAAACLYVAVRVYAAGRR* |
Ga0105250_100993382 | 3300009092 | Switchgrass Rhizosphere | MHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDKHGDPS* |
Ga0105247_100564103 | 3300009101 | Switchgrass Rhizosphere | MHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRRGDAS* |
Ga0116225_10469673 | 3300009524 | Peatlands Soil | MHGMLSAAILIGVLAVMAVACLYVAIRVYAAGGRRGDPS* |
Ga0126374_109366392 | 3300009792 | Tropical Forest Soil | MHGMLSAAIVIGAFAVVAAACLYVAVRVFAAGGRRGDPS* |
Ga0126373_110537403 | 3300010048 | Tropical Forest Soil | MHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRRGDPS* |
Ga0126373_129185802 | 3300010048 | Tropical Forest Soil | MHGMLSAAIVIGVFAVSAAACLFLAVRVFAAGGRRGDPS* |
Ga0126318_104362402 | 3300010152 | Soil | MHGMLSAAIVIGVFAVAAAACLYLAVRVFASGGRPGDRHGDPS* |
Ga0099796_100707452 | 3300010159 | Vadose Zone Soil | MHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRHGDAS* |
Ga0134084_101376252 | 3300010322 | Grasslands Soil | MHGMLSAAIVIGVFAVFAAACLYLAVRVFAAGGRCGDPS* |
Ga0134080_100544343 | 3300010333 | Grasslands Soil | MHGMLSAAIVTGVFAVAAAACLYLAVRVLAAGGRRGDPS* |
Ga0126370_110512682 | 3300010358 | Tropical Forest Soil | MHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0126372_129990632 | 3300010360 | Tropical Forest Soil | MHGMLSAAIVIGVFAVFAVACLYLAVRVFAAGGRRGDPS* |
Ga0134125_129183902 | 3300010371 | Terrestrial Soil | MHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDEHGDPS* |
Ga0134128_131768622 | 3300010373 | Terrestrial Soil | MHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGGKHGDPS* |
Ga0105239_128289172 | 3300010375 | Corn Rhizosphere | MHGMLSAAIVFGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS* |
Ga0126381_1007128383 | 3300010376 | Tropical Forest Soil | MHGMLSAAIVIGVFAVVAAGCLYVAVRVFAAGGRRGDPS* |
Ga0134121_119878042 | 3300010401 | Terrestrial Soil | AMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS* |
Ga0138568_10447312 | 3300011080 | Peatlands Soil | MLSAAILIGVLAVMAVACLYVAIRVYAAGGRRGDPS* |
Ga0137389_101380482 | 3300012096 | Vadose Zone Soil | MHGMLSAAILIGVFAVAAAACLYVAVRVYAAGGRRGDPS* |
Ga0137383_100010897 | 3300012199 | Vadose Zone Soil | MHGMLSAAIVIGVFAVVAAACLYMAVRAFTAGGRRGDAP* |
Ga0137365_103893131 | 3300012201 | Vadose Zone Soil | PPMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRRGDPS* |
Ga0137363_109614312 | 3300012202 | Vadose Zone Soil | MHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRHGDPS* |
Ga0137362_109421072 | 3300012205 | Vadose Zone Soil | MHGMLSAAIVIGVLAVAAAACLWVAARVYAAGRR* |
Ga0137380_100354965 | 3300012206 | Vadose Zone Soil | MHGMLSAAIVIGVFAVAAAACLYVAVRVFTAGGRRGDAS* |
Ga0137378_104967192 | 3300012210 | Vadose Zone Soil | MLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDRHGDAS* |
Ga0137378_106062632 | 3300012210 | Vadose Zone Soil | MHGMLSAAIVIGVFAVAAAACLYVAVRVFTAGGRRGDPS* |
Ga0137377_113309202 | 3300012211 | Vadose Zone Soil | MHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPRR* |
Ga0137387_108135472 | 3300012349 | Vadose Zone Soil | MHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDRHGDAS* |
Ga0137386_101363194 | 3300012351 | Vadose Zone Soil | AAIVIGVFAVSAAACLYLAVRVFAAGGRPGDRHGDAS* |
Ga0137369_106951912 | 3300012355 | Vadose Zone Soil | SAAIVIGVFAVAAAACLYLAVRVLAAGGRRGDPS* |
Ga0134034_11879621 | 3300012375 | Grasslands Soil | MLSAAIVVGVFALAAAACLYLAVRVFVAGGRPGDKHSDAS* |
Ga0134055_10755112 | 3300012401 | Grasslands Soil | LSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDPS* |
Ga0157344_10029542 | 3300012476 | Arabidopsis Rhizosphere | MHGMLSAAIVIGVFAVCAAACLYLAVRVFTAGGRRGDPS* |
Ga0157349_10315311 | 3300012489 | Unplanted Soil | MHGMLSAAIVIGVFAVVAAACLYLAVRVLAAGGRPGDKHGDPS* |
Ga0157355_10112792 | 3300012493 | Unplanted Soil | MHGMLSAAIVIGVLAVSAAACLYLAVRVFTAGGRRGDPS* |
Ga0157341_10023662 | 3300012494 | Arabidopsis Rhizosphere | MHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRPGEDKHGDPS* |
Ga0157345_10110882 | 3300012498 | Arabidopsis Rhizosphere | MHGMLSAALVIGVFAVCAAACLYLAVRVFAAGGRRGDPS* |
Ga0157314_10048422 | 3300012500 | Arabidopsis Rhizosphere | MHGMLSAAIVIGVFAVSAAACVYLAVRVFAAGGRRGDPS* |
Ga0137396_109910322 | 3300012918 | Vadose Zone Soil | MHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRRGDPS* |
Ga0137396_110397742 | 3300012918 | Vadose Zone Soil | MHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDA |
Ga0164309_106096002 | 3300012984 | Soil | MHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDQHGDPS* |
Ga0164306_114739642 | 3300012988 | Soil | MHGMLSAAIVVGVFALAAAACLYLAVRVFATGGRPGDKHSDAS* |
Ga0164305_109893332 | 3300012989 | Soil | RAMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS* |
Ga0181523_101148651 | 3300014165 | Bog | LSAAILIGVFAVIAVACLYVAMRAYAAGGRRGDTS* |
Ga0182000_105908171 | 3300014487 | Soil | MHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRPGDEHGDPS* |
Ga0132258_128188453 | 3300015371 | Arabidopsis Rhizosphere | MHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDKHGDPS* |
Ga0132256_1009855981 | 3300015372 | Arabidopsis Rhizosphere | LPPMHGMLSAAIVIGVFAVCAAACLYLAVRVFTAGGRRGDPS* |
Ga0182032_108564912 | 3300016357 | Soil | MHGMLSAAIVIGVFAVCAAACMYLAVRVFAAGGRPGDRHGDPS |
Ga0187809_100663192 | 3300017937 | Freshwater Sediment | MHGMLSAAIVTGVFAVTAVACLYLAVRVFAAGGRPGDKHGDPS |
Ga0187819_102113311 | 3300017943 | Freshwater Sediment | MHGMLSAAILIGVLAVMAVACLYVAIRVYAAGGRHGDTS |
Ga0187879_103285441 | 3300017946 | Peatland | PVKCGLMHGMLSAAILIGVFAVIAVACLYVAMRVYAAGGRRGDTS |
Ga0187817_101206154 | 3300017955 | Freshwater Sediment | MHGMLSAAILIGVLAVMAAACLYVAVRVYAAGGRRGDTS |
Ga0187779_104838382 | 3300017959 | Tropical Peatland | MHGVLSAAIVIGVFAVAAAACLYLAVRVYAAGGRHGDPS |
Ga0187780_107900442 | 3300017973 | Tropical Peatland | MHGMLSAAILIGVLAVVAAACLYLAVRVYAAGGRRGDAS |
Ga0187780_109796391 | 3300017973 | Tropical Peatland | MHGMLSAAILIGVLAVVAAACLYLAVRVYAAGRRWARR |
Ga0187777_104926002 | 3300017974 | Tropical Peatland | MHGMLSAAILIGAFAVAAVACLYLAVRVYAAGGRRGDPS |
Ga0187777_105316052 | 3300017974 | Tropical Peatland | MHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDKHGDPS |
Ga0187767_101867772 | 3300017999 | Tropical Peatland | MHGMLSAAILIGVLAVVAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0187883_103187582 | 3300018037 | Peatland | MHGMLSAAILIGVFAVIAVACLYVAMRVYAAGGRRGDTS |
Ga0187765_106190622 | 3300018060 | Tropical Peatland | MHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0187773_109765832 | 3300018064 | Tropical Peatland | MHGMLSEAIVIGVFAVTAVACLYLAVRVFAAGGRPGDRHGDPS |
Ga0066662_119718182 | 3300018468 | Grasslands Soil | MHGMLSAAIVTGVFAVAAAACLYLAVRVFAAGGRHGDPS |
Ga0066669_102375223 | 3300018482 | Grasslands Soil | MHGMLSAAIVIGVFAVSAAACLYLAVRVFTAGGRRGDPS |
Ga0173482_101493332 | 3300019361 | Soil | MHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRRGDPS |
Ga0173479_105003011 | 3300019362 | Soil | RTLPPMHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRRGDPS |
Ga0193701_10531732 | 3300019875 | Soil | MHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRRGDPS |
Ga0206349_14158702 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | AAIVIGVFAVAAAACLYLAVRVLAAGGRPGDKHGDPS |
Ga0210399_104547362 | 3300020581 | Soil | MHGMLSAAILIGVFAVAASACLYLAVRVYAAGGRRGDSS |
Ga0210400_100720164 | 3300021170 | Soil | MHGMLSAAIVIGVFAVTAVACLYLAVRVFAAGGRPGDKHGDPS |
Ga0210408_110310102 | 3300021178 | Soil | MLSAAIVIGVFAVFAAACLYLAARVFAAGGRRGDPS |
Ga0210396_112601792 | 3300021180 | Soil | MHGMLSAAIVIGVFAVCAAACLYLAVRVLAAGGRRGDPS |
Ga0193719_104575592 | 3300021344 | Soil | MHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRRGDPS |
Ga0213882_101270582 | 3300021362 | Exposed Rock | MHGMLSAAILIGVLAVIAAACLYLVVRVYAAGGRHHDAS |
Ga0213882_103277402 | 3300021362 | Exposed Rock | MHGMLSAAILIGVFAAIGAAALYLAVRVYVAGRHRGHTS |
Ga0213881_1000007246 | 3300021374 | Exposed Rock | MHGMLSAAVLVTVFAAVAAASLYAAVRVFAAGSRRRRPE |
Ga0213881_100370502 | 3300021374 | Exposed Rock | MHGMLSAAILIGVFAVIGAAALYLAVRVYVAGRHRGHTS |
Ga0213881_101167491 | 3300021374 | Exposed Rock | MHGMLSAAILIGVLGVIAAACLYLAVRVYAAGGRHGDAS |
Ga0213874_100865652 | 3300021377 | Plant Roots | MHGMLSAAILIAVLAVVAAAGLYLAVRVYAAAGGKPADKQGRRGDAS |
Ga0213874_100891662 | 3300021377 | Plant Roots | MHGMLSAAILIGVFAVIGAAALYLAVRVYAAGGHRGHPS |
Ga0213876_101914821 | 3300021384 | Plant Roots | MHGMLSAAIVIGVLAVIAAACLYGAGRVLAAGRARA |
Ga0213875_102347962 | 3300021388 | Plant Roots | MHGMLSAAILIGVLGVIAAACLYLAVRVYAAGGRHGDTS |
Ga0210397_100110795 | 3300021403 | Soil | MHGMLSAAIVIGVFAVCAAACLYLALRVLAAGGRRGDPS |
Ga0210397_101283714 | 3300021403 | Soil | MHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS |
Ga0210386_107125813 | 3300021406 | Soil | MHGMLSAAILIGVFAVAASACLYLAVRVYAAGGRRGDTS |
Ga0193694_10322302 | 3300021415 | Soil | MHGMLSAAIVIGVFAMAAAACLYLAVRVLAAGGRRGDPS |
Ga0210384_104790882 | 3300021432 | Soil | MHGMLSAAIVTGVFALAAAACLYLAVRVFAAGGRHGDPS |
Ga0210402_103936203 | 3300021478 | Soil | MHGMLSAAIVIGVFAVFAAACLYLAVRVFAAGGRRGDPS |
Ga0126371_113015632 | 3300021560 | Tropical Forest Soil | MHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0126371_118702852 | 3300021560 | Tropical Forest Soil | MHGMLSAAIVIGVFAVAAVACLYLAVRVFAAGGRRGDPS |
Ga0213851_14252642 | 3300021860 | Watersheds | MHGMLSAAILIGVLAVMAAACLYVAVRVYAAGGRRGDPS |
Ga0242676_10130061 | 3300022512 | Soil | LSAAILIGVFAVAASACLYLAVRVYAAGGRRGDTS |
Ga0242678_10613081 | 3300022715 | Soil | LSAAILIGVFAVTAAACLYLAVRVYAAGGRRGDTS |
Ga0242675_10542422 | 3300022718 | Soil | LSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS |
Ga0242672_10232712 | 3300022720 | Soil | LSAAIVIGVFAVCAAACLYLAVRVLAAGGRRGDPS |
Ga0224565_10274172 | 3300024176 | Plant Litter | MHGMLSAAILIGVFAVTAAVCLYLAVRVYAAGGRRGDTS |
Ga0228598_10496542 | 3300024227 | Rhizosphere | CLARTLRPMHGMLSAAILIGVFAVTAAACLYLAVRVYAAGGRRGDTS |
Ga0247666_10051024 | 3300024323 | Soil | MHGMLSAAIVIGVFAVCAAACLYLAVRVFTAGGRRGDPS |
Ga0207643_107948213 | 3300025908 | Miscanthus Rhizosphere | HGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS |
Ga0207684_101007613 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSAAIVTGVFAVAAAACLYLAVRVFAAGGRHGDPS |
Ga0207679_115367252 | 3300025945 | Corn Rhizosphere | MHGMLSAAILIGVFAVVATACLYLVVRVFMAGRGHTR |
Ga0209804_12464921 | 3300026335 | Soil | PVHLRPMHGMLSAAIVVGVFALAAAACLYLAVRVFVAGGRPGDKHSDAS |
Ga0257162_10198672 | 3300026340 | Soil | MHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRHGDAS |
Ga0209161_103619161 | 3300026548 | Soil | MHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGD |
Ga0209648_105406782 | 3300026551 | Grasslands Soil | MHGMLSAAILIFVFAVAAVACLYAAVRVYVAGGRRGDPS |
Ga0179587_105162791 | 3300026557 | Vadose Zone Soil | SPVHLRAMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRRGDPS |
Ga0209326_10006735 | 3300026899 | Forest Soil | IVVGVFALAAAACLYLAVRVFAAGSRPGDKHSDAS |
Ga0208860_10028103 | 3300027076 | Forest Soil | MHGMLSAAILIGVFAVTAAACLYVAVRVYAAGGRRGDAS |
Ga0208098_10140692 | 3300027172 | Forest Soil | MHGMLSAAILIGVFAVAASACLYLAVRVYAAGGRRGD |
Ga0208324_10286663 | 3300027604 | Peatlands Soil | MHGMLSAAILIGVLAVMAVACLYVAIRVYAAGGRRGDPS |
Ga0209178_14241382 | 3300027725 | Agricultural Soil | SPVHLRAMHGMLSAAIVVGVFALAAAACLYLAVRVFAAGGRPGDKHSDAS |
Ga0209177_100883102 | 3300027775 | Agricultural Soil | MLSAAIVIGVFAVCAAACLYLAVRVFTAGGRRGDPS |
Ga0209074_101607971 | 3300027787 | Agricultural Soil | MLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDKH |
Ga0209656_100320102 | 3300027812 | Bog Forest Soil | MHGMLSAAILIGVFAVIAAACLYVAVRVYTAGGRRGDTS |
Ga0209590_101092322 | 3300027882 | Vadose Zone Soil | MHGMLSAAIVIGVFAVVAAACLYVAVRAFTAGGRRGDAP |
Ga0209488_100141336 | 3300027903 | Vadose Zone Soil | MHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRRGDAS |
Ga0209698_102810422 | 3300027911 | Watersheds | MHGMLSAAILIGVFAVAAAACLYLVVRVYTAGGRRGDSS |
Ga0209698_114321251 | 3300027911 | Watersheds | GMLSAAILIGVFAVIAAACLYVAVRVYAAGGRRGDTS |
Ga0209062_11062333 | 3300027965 | Surface Soil | MHGMLSAAVLIGVLAAVAAGCGWLAVRAYLAGGRRGDP |
Ga0209061_100097524 | 3300027968 | Surface Soil | MHGMLSAAVLIGVLAAVAAGCGWLAVRAYLAGGRRGDPS |
Ga0209061_100459614 | 3300027968 | Surface Soil | MHGMLSAGVLIGALAAVAAACGWLAVRAYLAGGRRGDPS |
Ga0222749_101131371 | 3300029636 | Soil | RAAPRTLPGMHGMLSAAIVIGVFAVTAVACLYLAVRVFAAGGRHGDPS |
Ga0311371_123417882 | 3300029951 | Palsa | MHGMLSAAILIGVLAVAAAACLYAVVRVYLAGTRRG |
Ga0310037_102275072 | 3300030494 | Peatlands Soil | MHGMLSAAILIGVFAVMAAACLYVAVRVYAAGGRRGDTS |
Ga0265763_10353911 | 3300030763 | Soil | LRPMHGMLSAAILIGVFAVTAAVCLYLVVRVYAAGGRRGDTS |
Ga0170834_1080581501 | 3300031057 | Forest Soil | GVSLVQLRPMHGMLSAAILIGVLAVTAAACLYLAVRVYAAGGRRDDPS |
Ga0308197_103837162 | 3300031093 | Soil | LSAAIVIGVFAVAAAACLYLAVRVLAAGGRRGDPS |
Ga0170820_176817972 | 3300031446 | Forest Soil | MHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRRGNPS |
Ga0170819_172288021 | 3300031469 | Forest Soil | LRAMHGMLSAAIVIGVFAVSAAVCLYLAVRVFAAGGRRGDAS |
Ga0318516_100570572 | 3300031543 | Soil | MHGMLSAAILIGVFAVAAAVCLYVAVRAYAAGGRRGDAS |
Ga0318516_102274662 | 3300031543 | Soil | MHGMLSAAIVIGVFALCAAACLYLAMRVFAAGGRPGDRHGDPS |
Ga0318516_106823412 | 3300031543 | Soil | TLRAMHGMLSAAILIGVLAVVAAACLYLAVRVYAAGGRRGDAS |
Ga0318541_106634722 | 3300031545 | Soil | MLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0318538_100576424 | 3300031546 | Soil | MHGMLSAAIVIGVFAVAAVACLYLAVRVLAAGGRRGDPS |
Ga0318571_102805482 | 3300031549 | Soil | RTAAILICLFAVTAVACLLAAVRVYAAGRQRGRDAR |
Ga0318515_105781731 | 3300031572 | Soil | GRLPRTLRVMHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0318574_105023372 | 3300031680 | Soil | HGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0318572_102921933 | 3300031681 | Soil | MHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDRHG |
Ga0318496_107751282 | 3300031713 | Soil | RTLRAMHGMLSAAILIGVLAVVAAACLYLAVRVYAAGGRRGDAS |
Ga0307468_1014509471 | 3300031740 | Hardwood Forest Soil | MHGMLSAAIVVGVFALAAATCLYLAVRVFAAGGRPGDKHSDAS |
Ga0318492_101468711 | 3300031748 | Soil | GRLARTLRAMHGMLSAAILIGVLAVVAAACLYLAVRVYAAGGRRGDAS |
Ga0318494_103567173 | 3300031751 | Soil | MHGMLSAAIVIGVFAVTAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0318494_104130623 | 3300031751 | Soil | MHGMLSAAIVIGVLAVSAAACLYLAVRMFAAGGRPGDRHGD |
Ga0318494_105576702 | 3300031751 | Soil | MHGMLSAAIVIGVLAVCAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0318548_104668682 | 3300031793 | Soil | PRTLRVMHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0318557_103469452 | 3300031795 | Soil | LPRTLRAMHGMLSAAIVIGVFAVAAVACLYLAVRVFAAGGRRGDPS |
Ga0318523_100504664 | 3300031798 | Soil | RLPRTLRAMHGMLSAAIVIGVFAVAAVACLYLAVRVFAAGGRRGDPS |
Ga0318523_102842991 | 3300031798 | Soil | TLRVMHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRRGDPS |
Ga0318568_102724813 | 3300031819 | Soil | MHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRPGDRHG |
Ga0307473_105250312 | 3300031820 | Hardwood Forest Soil | MHGMLSAAIVVGVFALAAAACLYLAVRMLAAGGRPGDKHGDPS |
Ga0307478_116287311 | 3300031823 | Hardwood Forest Soil | RTLRAMHGMLSAAIVIGVFAVAAAACLYLAVRVFAAGGRRGDPS |
Ga0318499_102586001 | 3300031832 | Soil | PVHCGTMHGMLSAAIVIGVFALCAAACLYLAMRVFAAGGRPGDRHGDPS |
Ga0318536_105194031 | 3300031893 | Soil | MHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDR |
Ga0318520_107722721 | 3300031897 | Soil | MHGMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRPGDR |
Ga0318520_109876932 | 3300031897 | Soil | RTLRVMHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0310910_112661372 | 3300031946 | Soil | MHGMLSAAILIGVFAVAAAACLYVAVRAYAAGGRRGDAS |
Ga0318531_101016863 | 3300031981 | Soil | MHGMLSAAIVIGVFAVCSAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0318531_102286692 | 3300031981 | Soil | PRTLRAMHGMLSAAIVIGVFAVAAVACLYLAVRVFAAGGRRGDPS |
Ga0318575_103761682 | 3300032055 | Soil | TLRPMHGMLSAAILIGVFAVAAAVCLYVAVRAYAAGGRRGDAS |
Ga0318510_100789202 | 3300032064 | Soil | MHGMLSAAIVIGVLAVSAAACLYLAVRMFAAGGRPGDRHGDSS |
Ga0318513_102501552 | 3300032065 | Soil | GMLSAAIVIGVLAVSAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0318553_107658332 | 3300032068 | Soil | AGWRRARTLRVMHGMLSAAILIGVFAVAAAACLYAAVRVYAAGRR |
Ga0311301_124891332 | 3300032160 | Peatlands Soil | MHGMLSAAILIGVLAVMAVACLYVAIRVYAAGGRHGDPS |
Ga0348332_101538572 | 3300032515 | Plant Litter | PMHGMLSAAILIGVFAVTAAACLYLAVRVYAAGGRRGDTS |
Ga0335085_101601942 | 3300032770 | Soil | MHGMLSAAIVIGVFAVTAAACLYLAVRVFAAGGRPGERHVDPS |
Ga0335085_104735473 | 3300032770 | Soil | MHGMLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDKHGDPS |
Ga0335085_106655081 | 3300032770 | Soil | AIVIGVLAVSATACLYLAVRVFAAGGRPGDRHGDPS |
Ga0335085_107941092 | 3300032770 | Soil | MHGMLSAAIVIGVFAVTAAACLYLAVRVFAAGGRPGDKHVDPS |
Ga0335085_108231942 | 3300032770 | Soil | MHGMLSAAIVLGVFAVCAAACLYLAVRVFAAGGRPGDRHGDPS |
Ga0335082_100388712 | 3300032782 | Soil | MHGMLSAAIVIGVFAVCAAACLYLAVRVFAAGGRRGDPS |
Ga0335082_102620292 | 3300032782 | Soil | MHGMLSAAILIGVFAVAAAACLYVAVRAYAAGGRRGDAP |
Ga0335082_115578612 | 3300032782 | Soil | MHGMLSAAIVIGGFAVVAAACLYLAVRVFAAGGRRGDAS |
Ga0335079_101889082 | 3300032783 | Soil | MHGMLSAAIVIGVFAACAAACLYLAVRVFAAGARPGDKHGDPS |
Ga0335079_104034303 | 3300032783 | Soil | MHGMLSAAIVIGVFAVIAAACLYLAVRVLAAGGPPGDSHGDPS |
Ga0335078_101687193 | 3300032805 | Soil | MHGMLSAAILIGVLAVVAAACLYLAVRVYADARDKQGRRGDAS |
Ga0335080_104559553 | 3300032828 | Soil | MHGMLSAAIVIGVFAVIAAACLYLAVRVLAAGARPGDKHGDPS |
Ga0335080_114515701 | 3300032828 | Soil | MHGMLSAAILIGVLAVVAAACLYLAVRVYAGARDKQGRRGDAS |
Ga0335069_116642781 | 3300032893 | Soil | MLSAAIVIGVFAVAAAACLYLAVRVLAAGGRPGDKHGDPS |
Ga0335069_120180951 | 3300032893 | Soil | LSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDKHGDPS |
Ga0335072_115738342 | 3300032898 | Soil | MHGMLSAAIVIGVFAVSAAACLYLAVRVFAAGGRPGDTHGDPS |
Ga0335083_102611313 | 3300032954 | Soil | MHGMLSAAIVIGVLAVTAAACLYLAVRVFAAGGRPGERHVDPS |
Ga0335083_104567482 | 3300032954 | Soil | MHGMLSAGIVIGVFAVSAAACLYLAVRVFVAGGRRGDPS |
Ga0335076_107818333 | 3300032955 | Soil | MHGMLSAAILIGVFAVIAAACLYVAVRVHAVGGRHGDTS |
Ga0335076_112671161 | 3300032955 | Soil | RTLPGMHGMLSAAIVIGVFAVTAVACLYLAVRVFAAGGRPGDNHGDPS |
Ga0335077_105206572 | 3300033158 | Soil | MHGMLSAAIVIGVFAVTAVACLYPAVRVFAAGGRPGDKHGDPS |
⦗Top⦘ |