| Basic Information | |
|---|---|
| Family ID | F017514 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 240 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MPIGQERTKEQLYRQAKRLGIKGRSKMNKGQLKAALTRRGH |
| Number of Associated Samples | 160 |
| Number of Associated Scaffolds | 240 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.83 % |
| % of genes near scaffold ends (potentially truncated) | 22.92 % |
| % of genes from short scaffolds (< 2000 bps) | 85.83 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.083 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.250 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.68% β-sheet: 0.00% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 240 Family Scaffolds |
|---|---|---|
| PF07498 | Rho_N | 31.25 |
| PF03309 | Pan_kinase | 2.08 |
| PF00902 | TatC | 1.67 |
| PF00072 | Response_reg | 1.25 |
| PF01988 | VIT1 | 0.83 |
| PF06240 | COXG | 0.83 |
| PF01391 | Collagen | 0.83 |
| PF07883 | Cupin_2 | 0.83 |
| PF00809 | Pterin_bind | 0.83 |
| PF01061 | ABC2_membrane | 0.83 |
| PF00211 | Guanylate_cyc | 0.83 |
| PF02771 | Acyl-CoA_dh_N | 0.83 |
| PF14019 | DUF4235 | 0.83 |
| PF00903 | Glyoxalase | 0.83 |
| PF07676 | PD40 | 0.42 |
| PF13365 | Trypsin_2 | 0.42 |
| PF07687 | M20_dimer | 0.42 |
| PF13469 | Sulfotransfer_3 | 0.42 |
| PF12681 | Glyoxalase_2 | 0.42 |
| PF13424 | TPR_12 | 0.42 |
| PF00999 | Na_H_Exchanger | 0.42 |
| PF00484 | Pro_CA | 0.42 |
| PF00246 | Peptidase_M14 | 0.42 |
| PF00069 | Pkinase | 0.42 |
| PF13374 | TPR_10 | 0.42 |
| PF00202 | Aminotran_3 | 0.42 |
| PF03006 | HlyIII | 0.42 |
| PF04545 | Sigma70_r4 | 0.42 |
| PF00733 | Asn_synthase | 0.42 |
| PF04185 | Phosphoesterase | 0.42 |
| PF00800 | PDT | 0.42 |
| PF07366 | SnoaL | 0.42 |
| PF04261 | Dyp_perox | 0.42 |
| PF05239 | PRC | 0.42 |
| PF08445 | FR47 | 0.42 |
| PF08281 | Sigma70_r4_2 | 0.42 |
| PF00583 | Acetyltransf_1 | 0.42 |
| PF04007 | DUF354 | 0.42 |
| PF00155 | Aminotran_1_2 | 0.42 |
| PF00578 | AhpC-TSA | 0.42 |
| PF04542 | Sigma70_r2 | 0.42 |
| PF01243 | Putative_PNPOx | 0.42 |
| PF00248 | Aldo_ket_red | 0.42 |
| PF00027 | cNMP_binding | 0.42 |
| PF08521 | 2CSK_N | 0.42 |
| PF13155 | Toprim_2 | 0.42 |
| PF13189 | Cytidylate_kin2 | 0.42 |
| PF03992 | ABM | 0.42 |
| PF00563 | EAL | 0.42 |
| PF01288 | HPPK | 0.42 |
| PF00877 | NLPC_P60 | 0.42 |
| COG ID | Name | Functional Category | % Frequency in 240 Family Scaffolds |
|---|---|---|---|
| COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 2.08 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.67 |
| COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 1.67 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.83 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.83 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.83 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.83 |
| COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 0.83 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.42 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.42 |
| COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.42 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.42 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.42 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.42 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.42 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.42 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.42 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.42 |
| COG1817 | Predicted glycosyltransferase | General function prediction only [R] | 0.42 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.42 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.42 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.42 |
| COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 0.42 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.42 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.42 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.42 |
| COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.42 |
| COG0077 | Prephenate dehydratase | Amino acid transport and metabolism [E] | 0.42 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.33 % |
| Unclassified | root | N/A | 41.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_130338 | Not Available | 657 | Open in IMG/M |
| 2228664021|ICCgaii200_c0411727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae → Glycomyces → Glycomyces artemisiae | 632 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2165401 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Zunongwangia → Zunongwangia profunda | 606 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_10824561 | Not Available | 553 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100355246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300000550|F24TB_10495496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300000550|F24TB_10958300 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10098382 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10171963 | Not Available | 515 | Open in IMG/M |
| 3300000890|JGI11643J12802_10053726 | Not Available | 657 | Open in IMG/M |
| 3300000890|JGI11643J12802_10822319 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300000956|JGI10216J12902_105390281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1536 | Open in IMG/M |
| 3300000956|JGI10216J12902_106058976 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300001867|JGI12627J18819_10221467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 762 | Open in IMG/M |
| 3300003911|JGI25405J52794_10042605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 962 | Open in IMG/M |
| 3300004114|Ga0062593_100074965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2259 | Open in IMG/M |
| 3300004114|Ga0062593_100502208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1124 | Open in IMG/M |
| 3300004114|Ga0062593_100858270 | Not Available | 912 | Open in IMG/M |
| 3300004114|Ga0062593_102088385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis | 632 | Open in IMG/M |
| 3300004114|Ga0062593_102258987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya → Sporichthya polymorpha | 611 | Open in IMG/M |
| 3300004463|Ga0063356_101095235 | Not Available | 1147 | Open in IMG/M |
| 3300004479|Ga0062595_100419872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 968 | Open in IMG/M |
| 3300004479|Ga0062595_100794853 | Not Available | 778 | Open in IMG/M |
| 3300004479|Ga0062595_101170396 | Not Available | 679 | Open in IMG/M |
| 3300004633|Ga0066395_10093444 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300004633|Ga0066395_10413416 | Not Available | 762 | Open in IMG/M |
| 3300005093|Ga0062594_100126327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1608 | Open in IMG/M |
| 3300005167|Ga0066672_10053489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2325 | Open in IMG/M |
| 3300005172|Ga0066683_10499862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
| 3300005330|Ga0070690_100300072 | Not Available | 1152 | Open in IMG/M |
| 3300005332|Ga0066388_100005687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 8742 | Open in IMG/M |
| 3300005332|Ga0066388_100107050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3279 | Open in IMG/M |
| 3300005332|Ga0066388_106344212 | Not Available | 596 | Open in IMG/M |
| 3300005335|Ga0070666_10199644 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300005339|Ga0070660_100235710 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
| 3300005363|Ga0008090_14548380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300005406|Ga0070703_10452941 | Not Available | 569 | Open in IMG/M |
| 3300005434|Ga0070709_10123902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1756 | Open in IMG/M |
| 3300005435|Ga0070714_100090939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2673 | Open in IMG/M |
| 3300005435|Ga0070714_100435416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1244 | Open in IMG/M |
| 3300005437|Ga0070710_10009810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4692 | Open in IMG/M |
| 3300005446|Ga0066686_10439870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 891 | Open in IMG/M |
| 3300005526|Ga0073909_10044499 | Not Available | 1586 | Open in IMG/M |
| 3300005537|Ga0070730_10265127 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300005544|Ga0070686_101770692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. | 525 | Open in IMG/M |
| 3300005548|Ga0070665_102114481 | Not Available | 567 | Open in IMG/M |
| 3300005553|Ga0066695_10815612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300005563|Ga0068855_100195867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2276 | Open in IMG/M |
| 3300005615|Ga0070702_100538066 | Not Available | 865 | Open in IMG/M |
| 3300005713|Ga0066905_101687375 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005764|Ga0066903_100026765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 6385 | Open in IMG/M |
| 3300005764|Ga0066903_100037137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5662 | Open in IMG/M |
| 3300005764|Ga0066903_100312096 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
| 3300005764|Ga0066903_100337097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2424 | Open in IMG/M |
| 3300005764|Ga0066903_100461498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2129 | Open in IMG/M |
| 3300005764|Ga0066903_100463899 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
| 3300005764|Ga0066903_100509469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2043 | Open in IMG/M |
| 3300005764|Ga0066903_100837576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1652 | Open in IMG/M |
| 3300005764|Ga0066903_100854905 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300005764|Ga0066903_100877979 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300005764|Ga0066903_100944664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1567 | Open in IMG/M |
| 3300005764|Ga0066903_100955204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1560 | Open in IMG/M |
| 3300005764|Ga0066903_100999114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1529 | Open in IMG/M |
| 3300005764|Ga0066903_101200342 | Not Available | 1408 | Open in IMG/M |
| 3300005764|Ga0066903_101634328 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300005764|Ga0066903_101946769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1127 | Open in IMG/M |
| 3300005764|Ga0066903_102684788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 966 | Open in IMG/M |
| 3300005764|Ga0066903_102772790 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300005764|Ga0066903_102854517 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005764|Ga0066903_104307949 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005764|Ga0066903_106301923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300005764|Ga0066903_106771480 | Not Available | 596 | Open in IMG/M |
| 3300005894|Ga0075270_1013834 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300005902|Ga0075273_10039614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 834 | Open in IMG/M |
| 3300005937|Ga0081455_10022848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5833 | Open in IMG/M |
| 3300005937|Ga0081455_10070339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2906 | Open in IMG/M |
| 3300005937|Ga0081455_10081128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2657 | Open in IMG/M |
| 3300005937|Ga0081455_10663891 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006038|Ga0075365_11320646 | Not Available | 507 | Open in IMG/M |
| 3300006175|Ga0070712_100043724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3085 | Open in IMG/M |
| 3300006237|Ga0097621_100214022 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300006755|Ga0079222_10515190 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300006844|Ga0075428_100132182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2714 | Open in IMG/M |
| 3300006844|Ga0075428_100248007 | All Organisms → cellular organisms → Bacteria | 1919 | Open in IMG/M |
| 3300006846|Ga0075430_100205761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1633 | Open in IMG/M |
| 3300006852|Ga0075433_11145616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300006871|Ga0075434_100715888 | Not Available | 1018 | Open in IMG/M |
| 3300006871|Ga0075434_101014926 | Not Available | 843 | Open in IMG/M |
| 3300009012|Ga0066710_100102951 | All Organisms → cellular organisms → Bacteria | 3826 | Open in IMG/M |
| 3300009012|Ga0066710_102116359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 826 | Open in IMG/M |
| 3300009088|Ga0099830_11420703 | Not Available | 577 | Open in IMG/M |
| 3300009094|Ga0111539_10098269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3438 | Open in IMG/M |
| 3300009098|Ga0105245_10476359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1261 | Open in IMG/M |
| 3300009148|Ga0105243_11780773 | Not Available | 646 | Open in IMG/M |
| 3300009156|Ga0111538_10355113 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300009156|Ga0111538_12405408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300009162|Ga0075423_12648140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300009174|Ga0105241_11906551 | Not Available | 583 | Open in IMG/M |
| 3300009176|Ga0105242_11154878 | Not Available | 791 | Open in IMG/M |
| 3300010043|Ga0126380_12246146 | Not Available | 505 | Open in IMG/M |
| 3300010047|Ga0126382_10415516 | Not Available | 1055 | Open in IMG/M |
| 3300010047|Ga0126382_11841447 | Not Available | 570 | Open in IMG/M |
| 3300010048|Ga0126373_12064730 | Not Available | 632 | Open in IMG/M |
| 3300010145|Ga0126321_1505556 | Not Available | 556 | Open in IMG/M |
| 3300010358|Ga0126370_10159331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1656 | Open in IMG/M |
| 3300010358|Ga0126370_10669685 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 907 | Open in IMG/M |
| 3300010360|Ga0126372_10114874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2063 | Open in IMG/M |
| 3300010361|Ga0126378_12208718 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 628 | Open in IMG/M |
| 3300010362|Ga0126377_11165887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 840 | Open in IMG/M |
| 3300010362|Ga0126377_11447395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 760 | Open in IMG/M |
| 3300010366|Ga0126379_10210214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1880 | Open in IMG/M |
| 3300010366|Ga0126379_10232671 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
| 3300010366|Ga0126379_10434094 | Not Available | 1370 | Open in IMG/M |
| 3300010366|Ga0126379_10565877 | Not Available | 1218 | Open in IMG/M |
| 3300010371|Ga0134125_12129151 | Not Available | 610 | Open in IMG/M |
| 3300010373|Ga0134128_11508734 | Not Available | 740 | Open in IMG/M |
| 3300010375|Ga0105239_10158189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2531 | Open in IMG/M |
| 3300010375|Ga0105239_11072732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 927 | Open in IMG/M |
| 3300010376|Ga0126381_101186068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium R50 | 1103 | Open in IMG/M |
| 3300010376|Ga0126381_102025972 | Not Available | 829 | Open in IMG/M |
| 3300010376|Ga0126381_102256515 | Not Available | 782 | Open in IMG/M |
| 3300010376|Ga0126381_102509111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300010376|Ga0126381_103416643 | Not Available | 625 | Open in IMG/M |
| 3300010397|Ga0134124_12607086 | Not Available | 548 | Open in IMG/M |
| 3300010398|Ga0126383_10259803 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300010398|Ga0126383_13297240 | Not Available | 527 | Open in IMG/M |
| 3300010399|Ga0134127_11990988 | Not Available | 659 | Open in IMG/M |
| 3300010937|Ga0137776_1018423 | Not Available | 1354 | Open in IMG/M |
| 3300012199|Ga0137383_10428527 | Not Available | 969 | Open in IMG/M |
| 3300012204|Ga0137374_10625343 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300012206|Ga0137380_11326997 | Not Available | 604 | Open in IMG/M |
| 3300012209|Ga0137379_10900566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
| 3300012210|Ga0137378_10987068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
| 3300012211|Ga0137377_10784334 | Not Available | 886 | Open in IMG/M |
| 3300012356|Ga0137371_11171833 | Not Available | 575 | Open in IMG/M |
| 3300012358|Ga0137368_10481203 | Not Available | 803 | Open in IMG/M |
| 3300012359|Ga0137385_11191047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 623 | Open in IMG/M |
| 3300012469|Ga0150984_111876997 | Not Available | 562 | Open in IMG/M |
| 3300012469|Ga0150984_123327476 | Not Available | 1155 | Open in IMG/M |
| 3300012882|Ga0157304_1021292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
| 3300012897|Ga0157285_10016788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1510 | Open in IMG/M |
| 3300012898|Ga0157293_10114315 | Not Available | 715 | Open in IMG/M |
| 3300012899|Ga0157299_10129336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
| 3300012905|Ga0157296_10021672 | Not Available | 1267 | Open in IMG/M |
| 3300012916|Ga0157310_10282060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300012943|Ga0164241_10179915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1513 | Open in IMG/M |
| 3300012957|Ga0164303_10542376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 753 | Open in IMG/M |
| 3300012961|Ga0164302_11603676 | Not Available | 541 | Open in IMG/M |
| 3300012971|Ga0126369_10507274 | Not Available | 1265 | Open in IMG/M |
| 3300012971|Ga0126369_10981404 | Not Available | 932 | Open in IMG/M |
| 3300012971|Ga0126369_11017661 | Not Available | 916 | Open in IMG/M |
| 3300012971|Ga0126369_13360910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300012986|Ga0164304_11724006 | Not Available | 524 | Open in IMG/M |
| 3300013096|Ga0157307_1003233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2306 | Open in IMG/M |
| 3300013105|Ga0157369_10141090 | All Organisms → cellular organisms → Bacteria | 2550 | Open in IMG/M |
| 3300013306|Ga0163162_10301568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1734 | Open in IMG/M |
| 3300013307|Ga0157372_12398760 | Not Available | 606 | Open in IMG/M |
| 3300013772|Ga0120158_10390593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300015201|Ga0173478_10109724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
| 3300015371|Ga0132258_10121579 | All Organisms → cellular organisms → Bacteria | 6205 | Open in IMG/M |
| 3300015371|Ga0132258_10152288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5549 | Open in IMG/M |
| 3300015371|Ga0132258_10300253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3949 | Open in IMG/M |
| 3300015371|Ga0132258_12400117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1321 | Open in IMG/M |
| 3300015372|Ga0132256_101418075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
| 3300015374|Ga0132255_100829072 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300018027|Ga0184605_10491798 | Not Available | 535 | Open in IMG/M |
| 3300018073|Ga0184624_10430561 | Not Available | 582 | Open in IMG/M |
| 3300019356|Ga0173481_10000896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6847 | Open in IMG/M |
| 3300019356|Ga0173481_10008838 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300019356|Ga0173481_10009263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2741 | Open in IMG/M |
| 3300019356|Ga0173481_10880405 | Not Available | 503 | Open in IMG/M |
| 3300019361|Ga0173482_10026515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1707 | Open in IMG/M |
| 3300019361|Ga0173482_10364268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300019361|Ga0173482_10635370 | Not Available | 542 | Open in IMG/M |
| 3300019362|Ga0173479_10606401 | Not Available | 574 | Open in IMG/M |
| 3300020070|Ga0206356_11575345 | Not Available | 661 | Open in IMG/M |
| 3300020076|Ga0206355_1193867 | Not Available | 774 | Open in IMG/M |
| 3300020078|Ga0206352_10092442 | Not Available | 554 | Open in IMG/M |
| 3300021445|Ga0182009_10046172 | All Organisms → cellular organisms → Eukaryota | 1822 | Open in IMG/M |
| 3300021445|Ga0182009_10765283 | Not Available | 526 | Open in IMG/M |
| 3300021560|Ga0126371_10177893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2209 | Open in IMG/M |
| 3300021560|Ga0126371_10766790 | Not Available | 1111 | Open in IMG/M |
| 3300021560|Ga0126371_11279342 | Not Available | 868 | Open in IMG/M |
| 3300021560|Ga0126371_11438906 | Not Available | 819 | Open in IMG/M |
| 3300021560|Ga0126371_13628760 | Not Available | 521 | Open in IMG/M |
| 3300022195|Ga0222625_1226572 | Not Available | 524 | Open in IMG/M |
| 3300022467|Ga0224712_10302888 | Not Available | 748 | Open in IMG/M |
| 3300022467|Ga0224712_10645780 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300022737|Ga0247747_1003376 | Not Available | 1524 | Open in IMG/M |
| 3300022893|Ga0247787_1049109 | Not Available | 620 | Open in IMG/M |
| 3300023062|Ga0247791_1042289 | Not Available | 710 | Open in IMG/M |
| 3300024284|Ga0247671_1020675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 985 | Open in IMG/M |
| 3300025898|Ga0207692_10098083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea | 1603 | Open in IMG/M |
| 3300025899|Ga0207642_10042698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1995 | Open in IMG/M |
| 3300025901|Ga0207688_10086804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1793 | Open in IMG/M |
| 3300025903|Ga0207680_11020038 | Not Available | 592 | Open in IMG/M |
| 3300025912|Ga0207707_10074866 | All Organisms → cellular organisms → Bacteria | 2953 | Open in IMG/M |
| 3300025914|Ga0207671_10785450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
| 3300025916|Ga0207663_11428229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300025918|Ga0207662_10635026 | Not Available | 745 | Open in IMG/M |
| 3300025927|Ga0207687_10586361 | Not Available | 938 | Open in IMG/M |
| 3300025928|Ga0207700_10600679 | Not Available | 979 | Open in IMG/M |
| 3300025929|Ga0207664_10881870 | Not Available | 804 | Open in IMG/M |
| 3300025930|Ga0207701_11443498 | Not Available | 559 | Open in IMG/M |
| 3300025942|Ga0207689_10576737 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300025961|Ga0207712_10992188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300026118|Ga0207675_101458141 | Not Available | 705 | Open in IMG/M |
| 3300026552|Ga0209577_10422329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 947 | Open in IMG/M |
| 3300026752|Ga0207473_104363 | Not Available | 541 | Open in IMG/M |
| 3300026828|Ga0207502_107136 | Not Available | 577 | Open in IMG/M |
| 3300026861|Ga0207503_1014227 | Not Available | 516 | Open in IMG/M |
| 3300027821|Ga0209811_10052064 | Not Available | 1402 | Open in IMG/M |
| 3300027857|Ga0209166_10353239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 767 | Open in IMG/M |
| 3300027873|Ga0209814_10181663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 906 | Open in IMG/M |
| 3300027886|Ga0209486_11042714 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300027907|Ga0207428_10178276 | Not Available | 1606 | Open in IMG/M |
| 3300027907|Ga0207428_10179621 | Not Available | 1599 | Open in IMG/M |
| 3300027992|Ga0247750_1038912 | Not Available | 530 | Open in IMG/M |
| 3300028720|Ga0307317_10098072 | Not Available | 970 | Open in IMG/M |
| 3300028814|Ga0307302_10639651 | Not Available | 529 | Open in IMG/M |
| 3300028881|Ga0307277_10542307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300028885|Ga0307304_10116758 | Not Available | 1083 | Open in IMG/M |
| 3300031058|Ga0308189_10243706 | Not Available | 675 | Open in IMG/M |
| 3300031058|Ga0308189_10513293 | Not Available | 518 | Open in IMG/M |
| 3300031091|Ga0308201_10024963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1297 | Open in IMG/M |
| 3300031092|Ga0308204_10051669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1001 | Open in IMG/M |
| 3300031544|Ga0318534_10106882 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300031547|Ga0310887_11144641 | Not Available | 501 | Open in IMG/M |
| 3300031938|Ga0308175_100302452 | All Organisms → cellular organisms → Eukaryota → Sar | 1631 | Open in IMG/M |
| 3300031938|Ga0308175_100377638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1473 | Open in IMG/M |
| 3300031938|Ga0308175_100903574 | Not Available | 971 | Open in IMG/M |
| 3300031938|Ga0308175_101375257 | Not Available | 787 | Open in IMG/M |
| 3300031938|Ga0308175_101587378 | Not Available | 732 | Open in IMG/M |
| 3300031938|Ga0308175_102380268 | Not Available | 593 | Open in IMG/M |
| 3300031954|Ga0306926_12213959 | Not Available | 612 | Open in IMG/M |
| 3300031996|Ga0308176_10262358 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 1663 | Open in IMG/M |
| 3300031996|Ga0308176_11488731 | Not Available | 721 | Open in IMG/M |
| 3300032009|Ga0318563_10637563 | Not Available | 574 | Open in IMG/M |
| 3300032261|Ga0306920_100036714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7053 | Open in IMG/M |
| 3300033551|Ga0247830_10253974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1333 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.08% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.08% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.08% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.25% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.25% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.25% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.42% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.42% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.42% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.42% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.42% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005894 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 | Environmental | Open in IMG/M |
| 3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
| 3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026752 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A4w-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026828 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026861 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027992 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S125-311R-5 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_02367130 | 2199352024 | Soil | ERRQHMPMTGRETKEQLYRKAKRLNIKGRSKMNKGALKAAIGRHR |
| ICCgaii200_04117271 | 2228664021 | Soil | VATVGKQSKGGHFMTMGKERTKEQLYXEAKRLGVKGRSXMNKGQLKAALARRGH |
| ICChiseqgaiiDRAFT_21654011 | 3300000033 | Soil | TETSFERGSLMAQGRERTKEQLYREAKRLGVKGRSKMNKGQLKAAV |
| ICChiseqgaiiFebDRAFT_108245611 | 3300000363 | Soil | MPLGNERTKEQLYRQAKSLGIKGRSKMNKGQLKAALARKGH* |
| INPhiseqgaiiFebDRAFT_1003552462 | 3300000364 | Soil | MPLETKEQLYREARRLGIKGRSKMNKGQLKAAISRRS* |
| F24TB_104954962 | 3300000550 | Soil | MPTGHERTKEQLYREAKRLGIRGRSKMSKGQLKAAISRHRM* |
| F24TB_109583002 | 3300000550 | Soil | MPQVKERTKEALYREAKRLGIKGRSKMNKGALKAAVERRR* |
| AF_2010_repII_A1DRAFT_100983821 | 3300000597 | Forest Soil | MAIGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAALSRRGH* |
| AF_2010_repII_A1DRAFT_101719632 | 3300000597 | Forest Soil | MPISRELTKEQLYREARRLRVKGRSKMTKSQLKSAVARHRHM* |
| JGI11643J12802_100537262 | 3300000890 | Soil | MPQGKERTKEQLLKEAKKLGIKGRSRMNKGALKAAVDRRR* |
| JGI11643J12802_108223191 | 3300000890 | Soil | MPQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAV |
| JGI10216J12902_1053902812 | 3300000956 | Soil | MPIETKEQLYREAKRLRIKGRSKMTKGQLKAAISRQRM* |
| JGI10216J12902_1060589763 | 3300000956 | Soil | GKGVPMPLDTKEQLYREAKRLRIKGRSKMNKGQLKAAISRHRM* |
| JGI12627J18819_102214671 | 3300001867 | Forest Soil | MPIGHERTKEQLYREAKRLGVKGRSKMNKGQLKAALMRRGH* |
| JGI25405J52794_100426052 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MPQGTERTKEQLLREAKRLNIKGRSKMNKGALQAAINRRK* |
| Ga0062593_1000749651 | 3300004114 | Soil | MAQERTKEQLYRQAKSAGIKGRSKMNKGQLKAALARKGY* |
| Ga0062593_1005022082 | 3300004114 | Soil | MPLDTKEQLYREARRLGIKGRSKMNKGQLKAAISRRRGA* |
| Ga0062593_1008582702 | 3300004114 | Soil | MAQGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERRR* |
| Ga0062593_1020883851 | 3300004114 | Soil | MTQGKERTKEQLMREAKKLGIKGRSKMNKGALKAAVDRRS* |
| Ga0062593_1022589871 | 3300004114 | Soil | MPTTGRETKEQLYRQAKRLGIKGRSKMNKGALKAAVGRHTHR* |
| Ga0063356_1010952353 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPMGQERTKEQLYREAKRLGIKGRSKMNKGQLKAALLRRGQ* |
| Ga0062595_1004198722 | 3300004479 | Soil | MPIGRELTKEQLYRQAKRLGIKGRSKMSKTQLKMAVGRHHR* |
| Ga0062595_1007948531 | 3300004479 | Soil | MTQGKERTKEQLMRQAKKLGIKGRSKMNKGALKAAVDRRS* |
| Ga0062595_1011703961 | 3300004479 | Soil | MPMGQERTKEELYRAAKRLNIKGRSKMNKGQLKAALARRGH* |
| Ga0066395_100934442 | 3300004633 | Tropical Forest Soil | MAIGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAALTRRGH* |
| Ga0066395_104134162 | 3300004633 | Tropical Forest Soil | MPIGRRDLTKEQLYRQAKRLGIRGRSKMSKSQLKAAVGRHH* |
| Ga0062594_1001263274 | 3300005093 | Soil | MPLSHERTKEQLYRQAKSLGIKGRSKMSKGQLKAALARKGH* |
| Ga0066672_100534891 | 3300005167 | Soil | MIGREPTKEQLYHKAKRLGIKGRSKMSKNQLKAAVGRHR* |
| Ga0066683_104998621 | 3300005172 | Soil | MPITREFTKEQLYREAKRLRIKGRSKMSKSQLKAAVSRHRHM* |
| Ga0070690_1003000723 | 3300005330 | Switchgrass Rhizosphere | MAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRS* |
| Ga0066388_1000056872 | 3300005332 | Tropical Forest Soil | MPISHEPTKEQLYRQAKRLKVKGRSKMNKSQLKSAVARRSH* |
| Ga0066388_1001070503 | 3300005332 | Tropical Forest Soil | MPITGRELTKEQLYRQAKRLGIRGRSKMSKSQLKAAVGRHHR* |
| Ga0066388_1063442122 | 3300005332 | Tropical Forest Soil | MPTIGREPTKEQLYRQAKRLGIRGRSKMSKNQLKAAVGRHH* |
| Ga0070666_101996443 | 3300005335 | Switchgrass Rhizosphere | MAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRS* |
| Ga0070660_1002357103 | 3300005339 | Corn Rhizosphere | MAQGKERTKEQLLREAKRLGIKGRSKMNKGALKAAVDRRS* |
| Ga0008090_145483801 | 3300005363 | Tropical Rainforest Soil | MAFSRDVTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHHH* |
| Ga0070703_104529411 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR* |
| Ga0070709_101239022 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MATGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAAVTRRGH* |
| Ga0070714_1000909393 | 3300005435 | Agricultural Soil | MTQGKERTKEQLLREAKKLGIKGRSKMNKGALKAAVDRRS* |
| Ga0070714_1004354161 | 3300005435 | Agricultural Soil | MPIGHERTKEQLYREAKRLRIKGRSKMNKGQLKAALTRHGH* |
| Ga0070710_100098106 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQGKERTKEQLLRQAKKLGIKGRSKMNKGALKAAVDRRS* |
| Ga0066686_104398702 | 3300005446 | Soil | MATSERTKEQLYSQAKRFGVKGRSKMNKSQLKAALARRGH* |
| Ga0073909_100444993 | 3300005526 | Surface Soil | MTQGKERTKEELYREAKRLNITGRSKMNKGALKAALARRGH* |
| Ga0070730_102651271 | 3300005537 | Surface Soil | MTMGQERTKEQLYNQAKRLGVKGRSKMNKGQLKAALQRRGH* |
| Ga0070686_1017706922 | 3300005544 | Switchgrass Rhizosphere | MASGQERTKEQLYRQAASLGIKGRSKMNKGQLKAAIDRRR* |
| Ga0070665_1021144811 | 3300005548 | Switchgrass Rhizosphere | MAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRT |
| Ga0066695_108156122 | 3300005553 | Soil | MATRERTKEQLYSQAKRFGVKGRSKMNKGQLKAALARRGH* |
| Ga0068855_1001958673 | 3300005563 | Corn Rhizosphere | MAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRT* |
| Ga0070702_1005380662 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRT* |
| Ga0066905_1016873751 | 3300005713 | Tropical Forest Soil | MPTRDKTKEQWYRDAKRLGIKGRSKMNKGQLKAAVNRRGH* |
| Ga0066903_1000267658 | 3300005764 | Tropical Forest Soil | MGRERTKEELYRTAKRLGIKGRSKMNKGQLKAAVARRGG* |
| Ga0066903_1000371375 | 3300005764 | Tropical Forest Soil | MTIGHERTKEQLYREAKRLRIKGRSKMNKGQLKAALTRHGH* |
| Ga0066903_1003120964 | 3300005764 | Tropical Forest Soil | MPITRELTKEQLYREAKRLHIKGRSKMSKTQLKAAVSRHRF* |
| Ga0066903_1003370972 | 3300005764 | Tropical Forest Soil | MPMIGRDLTKEQLYRQARRLGIKGRSKMSKSQLKAAVGRHHR* |
| Ga0066903_1004614982 | 3300005764 | Tropical Forest Soil | MPIGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALTRRGH* |
| Ga0066903_1004638992 | 3300005764 | Tropical Forest Soil | MPVGEMTKEKLYKEATRLRIKGRSKMTKSQLKSAIDRHSHR* |
| Ga0066903_1005094691 | 3300005764 | Tropical Forest Soil | MPLETKEQLYREAKRLRIKGRSKMNKGQLKAAVSRHRI* |
| Ga0066903_1008375762 | 3300005764 | Tropical Forest Soil | MPISREMTKEQLYREAKRLHVKGRSKMTKSQLKSALARQRHI* |
| Ga0066903_1008549053 | 3300005764 | Tropical Forest Soil | MPISREPTKEQLYREAKRLRVNGRSTMTKSQLKSAVARHRHM* |
| Ga0066903_1008779792 | 3300005764 | Tropical Forest Soil | MMPTREPTKETLYREAKRLRIKGRSKMSKTQLKSAIARHRF* |
| Ga0066903_1009446642 | 3300005764 | Tropical Forest Soil | MPMGHDRTKEQLYRQAKRLGIKGRSKMNKGQLKAALSRRGH* |
| Ga0066903_1009552042 | 3300005764 | Tropical Forest Soil | MTMGHERTKEELYRQAKRLGIKGRSKMNKGQLKAALTRRGH* |
| Ga0066903_1009991142 | 3300005764 | Tropical Forest Soil | MPTTEPTKEKLYREARRLRIKGRSKMNKTQLKSAIARHRY* |
| Ga0066903_1012003422 | 3300005764 | Tropical Forest Soil | MPIGRDLTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHH* |
| Ga0066903_1016343282 | 3300005764 | Tropical Forest Soil | MPIGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALSRRGH* |
| Ga0066903_1019467691 | 3300005764 | Tropical Forest Soil | NPRRWDMPMGQEQTKAKLYQHAKRLNIKGRSKMNKGQLKAALARKGH* |
| Ga0066903_1026847882 | 3300005764 | Tropical Forest Soil | MPTTEPSKEKLYREAQRLRIKGRSKMTKTQLQSAIARHRF* |
| Ga0066903_1027727902 | 3300005764 | Tropical Forest Soil | MPIGQERTKEQLYRQAKRLGIKGRSKMNKGQLKAALTRRGH* |
| Ga0066903_1028545171 | 3300005764 | Tropical Forest Soil | TSPKGGHLMPMGHERTKQELYRTAKRLNIKGRSKMSKGQLKAALARRGH* |
| Ga0066903_1043079492 | 3300005764 | Tropical Forest Soil | MPEWGGTCNSMKGVYMPQGTERTKEQLLRDAKRLNIKGRSKMNKGALKAAVDRRK* |
| Ga0066903_1063019231 | 3300005764 | Tropical Forest Soil | MPIGRRDLTKEQLYRQAKRLGIRGRSKMSKSQLKA |
| Ga0066903_1067714801 | 3300005764 | Tropical Forest Soil | MPTGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALARRGH* |
| Ga0075270_10138341 | 3300005894 | Rice Paddy Soil | MPTTRRETKEQLYRQAKSLGIKGRSKMNKGTLKAAIGRHR* |
| Ga0075273_100396142 | 3300005902 | Rice Paddy Soil | MPIGRDLTKEQLYRQAKRLGIKGRSKMSKSQLKTAVGRRHR* |
| Ga0081455_100228482 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPMETKEQLYREAKRLRIKGRSKMSKGQLKAAVSRHRI* |
| Ga0081455_100703393 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPTTRDKTKEQWYREAKRLGIKGRSKMNKGQLKAAVNRRGG* |
| Ga0081455_100811285 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPMGHERTKEQLYLQAKRLNIKGHSKMNKGQLKAALQRRGH* |
| Ga0081455_106638912 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPTTTGATKEQLYKEAKRLGIKGRSKMKKGALKAAIERRRGH* |
| Ga0075365_113206461 | 3300006038 | Populus Endosphere | MAMGQERTKEQLYRQAKSLNIKGRSKMTKTQLKAALSRKGH* |
| Ga0070712_1000437241 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIGHERTKEQLYREAKRLGVKGRSKMNKGQLKAALTRR |
| Ga0097621_1002140223 | 3300006237 | Miscanthus Rhizosphere | EERGCRMTQGKERTKEQLLRQAKKLGIKGRSKMNKGALKAAVDRRS* |
| Ga0079222_105151902 | 3300006755 | Agricultural Soil | RTKEQLYREAKRLDIKGRSKMNKGALKAALARRGH* |
| Ga0075428_1001321824 | 3300006844 | Populus Rhizosphere | MPTTRDKTKEQWYRQAKRLGIKGRSKMNKGQLKAAVNRRSS* |
| Ga0075428_1002480072 | 3300006844 | Populus Rhizosphere | MPQGKERTKEQLLKEAKRLGIQGRSKMNKGALKAAVERRR* |
| Ga0075430_1002057614 | 3300006846 | Populus Rhizosphere | MTRDELYKEAKRLGIKGRSKMTKGLLKAAVDRRRSS* |
| Ga0075433_111456162 | 3300006852 | Populus Rhizosphere | MPLDTKEQLYREAKRLRIKGRSKMNKGQLKAAISRQRV* |
| Ga0075434_1007158881 | 3300006871 | Populus Rhizosphere | MPMGHERTKEELYRQAKRLNIKGRSKMNKGQLKAALARRGH* |
| Ga0075434_1010149262 | 3300006871 | Populus Rhizosphere | MPTGHERTKEELYRQAKRLNIKGRSKMNKGQLKAALARRGQ* |
| Ga0066710_1001029513 | 3300009012 | Grasslands Soil | MPITREFTKEQLYREAKRLRIKGRSKMSKSQLKAAVSRHRHM |
| Ga0066710_1021163591 | 3300009012 | Grasslands Soil | MPMGHERTKEQLYREAKRLGIKGRSRMNKGQLKAALARRGH |
| Ga0099830_114207032 | 3300009088 | Vadose Zone Soil | MPIGREITKEQLYREARRLGIRGRSKMRKSQLKMAVERRRHR* |
| Ga0111539_100982695 | 3300009094 | Populus Rhizosphere | MATVKETKEKLYREAKRLNIKGRSKMNKGQLKAALARRGR* |
| Ga0105245_104763591 | 3300009098 | Miscanthus Rhizosphere | KERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRT* |
| Ga0105243_117807731 | 3300009148 | Miscanthus Rhizosphere | MPMGQERTKQQLYSQAKRLDIKGRSKMNKGQLKAAVARRGH* |
| Ga0111538_103551132 | 3300009156 | Populus Rhizosphere | MPTTREKSKEQLYREAKRLGIKGRSKMNKGQLKSAVNRRSG* |
| Ga0111538_124054082 | 3300009156 | Populus Rhizosphere | KERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR* |
| Ga0075423_126481402 | 3300009162 | Populus Rhizosphere | RTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR* |
| Ga0105241_119065511 | 3300009174 | Corn Rhizosphere | MPLGNERTKEQLYWQAKSLGIRGRSKMNKGQLKAALARKGH* |
| Ga0105242_111548781 | 3300009176 | Miscanthus Rhizosphere | MPMGKERTKEELYREAKRLNIRGRSKMNKGALKAALARRGQ* |
| Ga0126380_122461461 | 3300010043 | Tropical Forest Soil | MAMGKERTKEQLYRAAKRLNIKGRSKMNKGQLKAAVA |
| Ga0126382_104155161 | 3300010047 | Tropical Forest Soil | MPTELTKEKLYREAKRLGIKGRSKMSKSQLKSAIARRRQF* |
| Ga0126382_118414471 | 3300010047 | Tropical Forest Soil | VCVVSMDHERTKEQRYREAKRLKIKGRSKMNKGQLKAAVQRRGH* |
| Ga0126373_120647301 | 3300010048 | Tropical Forest Soil | MPISREMTKEQLYREAKRLHVKGRSKMTKSQLKSAVARHRHF* |
| Ga0126321_15055562 | 3300010145 | Soil | LEGGERMPTTSGTTKEQLYKEAKRLGIKGRSKMRKGALKAAIERRRGH* |
| Ga0126370_101593313 | 3300010358 | Tropical Forest Soil | MAIGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAAITRRGH* |
| Ga0126370_106696851 | 3300010358 | Tropical Forest Soil | RRDQTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHH* |
| Ga0126372_101148742 | 3300010360 | Tropical Forest Soil | MKGVYMPQGTERTKEQLLREAKRLNIKGRSKMNKGALKAAVDRRK* |
| Ga0126378_122087182 | 3300010361 | Tropical Forest Soil | MPITRELTKEQLYREAKRLRIKGRSKMSKTQLKAAVSRHRF* |
| Ga0126377_111658872 | 3300010362 | Tropical Forest Soil | MPMETKEQLYREAKRLRIKGRSKMNKGQLKAAISRLR* |
| Ga0126377_114473952 | 3300010362 | Tropical Forest Soil | MPMETKEQLYREAKRLRIKGRSKMNKGQLKAAISRGR* |
| Ga0126379_102102141 | 3300010366 | Tropical Forest Soil | MPISHEPTKEQLYRQAKRLKVKGRSKMNKSQLKSVVARRSH* |
| Ga0126379_102326713 | 3300010366 | Tropical Forest Soil | MPMIGRDLTKEQLYHQAKRLGIKGRSKMSKSQLKAAVGRHHR* |
| Ga0126379_104340941 | 3300010366 | Tropical Forest Soil | MPIGRRDLTKEQLYHQAKRLGIRGRSKMSKSQLKAAVGRHH* |
| Ga0126379_105658772 | 3300010366 | Tropical Forest Soil | MGQEQTKAKLYQHAKRLNIKGRSKMNKGQLKAALARKGH* |
| Ga0134125_121291511 | 3300010371 | Terrestrial Soil | MPIGHERTKEQLYREAKRLGVKGRSKMNKGQLKAAL |
| Ga0134128_115087341 | 3300010373 | Terrestrial Soil | MAQGKERTKEQLLREAKRLGIKGRSKMNKGALRAAVDRRS* |
| Ga0105239_101581893 | 3300010375 | Corn Rhizosphere | RQSKGGRFMAQERTKEQLYRQAKSAGIKGRSKMNKGQLKAALARKGY* |
| Ga0105239_110727321 | 3300010375 | Corn Rhizosphere | MAQGEERTKEQLLREAKRLGIKGRSKMNKGALKAAVDRRS* |
| Ga0126381_1011860682 | 3300010376 | Tropical Forest Soil | MPTIGREPTKEQLYRQAKRLGIRGRSKMSKSQLKAAVGRHH* |
| Ga0126381_1020259722 | 3300010376 | Tropical Forest Soil | MPIDRRDLTKEQLYRQAKRLGIRGRSKMSKNQLKAAVGRHH* |
| Ga0126381_1022565151 | 3300010376 | Tropical Forest Soil | MAISREMTKEQLYREAKRLHVKGRSKMTKSQLKSAVARHRHF* |
| Ga0126381_1025091112 | 3300010376 | Tropical Forest Soil | MAIGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALTRRGH* |
| Ga0126381_1034166432 | 3300010376 | Tropical Forest Soil | MAFSRDVTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHH |
| Ga0134124_126070862 | 3300010397 | Terrestrial Soil | HERTKEQLYSQAKRLGIKGRSKMNKGQLKAALTRRGH* |
| Ga0126383_102598033 | 3300010398 | Tropical Forest Soil | MRMSVTSDLTKEQLYRQAKRLGIKGRSKMSKAQLKSALSRHGWRS* |
| Ga0126383_132972402 | 3300010398 | Tropical Forest Soil | MPTTEPTKEKLYREARRLHIKGRSKMNKTQLKSAIARHRY* |
| Ga0134127_119909881 | 3300010399 | Terrestrial Soil | SAIEEGGVVMPLSHERTKEQLYRQAKSLGIRGRSKMNTGQLKAALARKGH* |
| Ga0137776_10184232 | 3300010937 | Sediment | MTMGHERTKEQLYNQAKRFGIKGRSKMNKGQLKAALARRGH* |
| Ga0137383_104285272 | 3300012199 | Vadose Zone Soil | MAISRDLTKEQLYHQAKRLGIRGRSKMSKSQLKMAVGRHHR* |
| Ga0137374_106253431 | 3300012204 | Vadose Zone Soil | MATRERTKEQLYNHAKRLGVKGRSKMNKGQLKAALARRGH* |
| Ga0137380_113269971 | 3300012206 | Vadose Zone Soil | MPMIDRELTKEQLYRQAKRLGIKGRSKMSKSQLKSAVGRHHR* |
| Ga0137379_109005662 | 3300012209 | Vadose Zone Soil | MPTERTKEQLYREAKRLGIKGRSRMNKGQLKAALTRRGH* |
| Ga0137378_109870682 | 3300012210 | Vadose Zone Soil | MPISRDVTKEQLYRQAKRLGIKGRSKMSKSQLKSAVGRHHH* |
| Ga0137377_107843341 | 3300012211 | Vadose Zone Soil | TMPIGHERTKEQLYREAKRLRIKGRSRMNKGQLKAALTRHGH* |
| Ga0137371_111718331 | 3300012356 | Vadose Zone Soil | MPTERTKEQLYREAKRLGIKGRSRMNKGQLKAALTRRTQ* |
| Ga0137368_104812033 | 3300012358 | Vadose Zone Soil | MASRERTKEQLYSQAKRFGVKGRSKMNKGQLKAALARRGH* |
| Ga0137385_111910471 | 3300012359 | Vadose Zone Soil | GNSPKGGETMPIGHERTKEQLYREAKRLRIKGRSRMNKGQLKSALTRHGH* |
| Ga0150984_1118769971 | 3300012469 | Avena Fatua Rhizosphere | EGGFAMPIETKEQLYREARRLGIKGRSKMNKGQLKAALSRRRSM* |
| Ga0150984_1233274762 | 3300012469 | Avena Fatua Rhizosphere | ERTKEQLYREAKRLGIPGRSKMNKGALKAAVERRR* |
| Ga0157304_10212922 | 3300012882 | Soil | MPQGKERTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR* |
| Ga0157285_100167882 | 3300012897 | Soil | MPQGKDRTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR* |
| Ga0157293_101143151 | 3300012898 | Soil | MAQGKERTKEQHLNEAKRLGIKGRSRMNKGALKAAVDRRR* |
| Ga0157299_101293361 | 3300012899 | Soil | MTQGKERTKEELLREAKKLGIKGRSKMNKGALKAAVDRRR* |
| Ga0157296_100216721 | 3300012905 | Soil | GKERTKDELLREAKRLGIKGRSKMNKGALKAAVERRR* |
| Ga0157310_102820602 | 3300012916 | Soil | MQQGKERTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR* |
| Ga0164241_101799152 | 3300012943 | Soil | MPTGHERTKEELYRQAKRLNIKGRSKMNKGQLKAALA |
| Ga0164303_105423762 | 3300012957 | Soil | SANRRGSFKPLGNERTKEQLYRQAKSLGIRGRSKMNKGQLKAALARKGH* |
| Ga0164302_116036762 | 3300012961 | Soil | MTMGKERTKEELYSQAKRLGVKGRSKMNKGQLKAALARQGH* |
| Ga0126369_105072742 | 3300012971 | Tropical Forest Soil | MGQEQTNAKLYQHAKRLNIKGRSKMNKGQLKAALARKGH* |
| Ga0126369_109814041 | 3300012971 | Tropical Forest Soil | MGHERTKEQLYNQAKRLDIKGRSKMNKGQLKAALARRGH* |
| Ga0126369_110176611 | 3300012971 | Tropical Forest Soil | MPTGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALTRRGH* |
| Ga0126369_133609102 | 3300012971 | Tropical Forest Soil | MGHERTKEELYRQAKRLGIKGRSKMNKGQLKAALSRRGH* |
| Ga0164304_117240062 | 3300012986 | Soil | MTTGHERTKEQLYRQAKRLGIKGRSKMNKGQLKAALSRRGH* |
| Ga0157307_10032335 | 3300013096 | Soil | MPQGKERTKEQLLKEAKRLGIKGHSRMNKGALKAAVDRRR* |
| Ga0157369_101410902 | 3300013105 | Corn Rhizosphere | MPMGQERTKEQLYNQAKRLGVKGRSKMNKGQLKAALSRRGH* |
| Ga0163162_103015684 | 3300013306 | Switchgrass Rhizosphere | MAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR* |
| Ga0157372_123987601 | 3300013307 | Corn Rhizosphere | RGSFMPLGNERTKEQLYRQAKSLGIRGRSKMNKGQLKAALARKGH* |
| Ga0120158_103905932 | 3300013772 | Permafrost | NNRREALMAQGKERTKEQLLREARRLNIPGRSKMTKGALKAAVDRRK* |
| Ga0173478_101097241 | 3300015201 | Soil | QGKERTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR* |
| Ga0132258_1012157913 | 3300015371 | Arabidopsis Rhizosphere | MIVREPTKEQLYRQAKRLDIKGRSKMNKGQLKAAIGRHHR* |
| Ga0132258_101522886 | 3300015371 | Arabidopsis Rhizosphere | MPMGKERTKEELYREAKRLDIKGRSKMTKGALKAALARRGR* |
| Ga0132258_103002535 | 3300015371 | Arabidopsis Rhizosphere | MPMETKEQLYREAKRLGIKGRSRMNKGQLKAAVSRRRGG* |
| Ga0132258_124001171 | 3300015371 | Arabidopsis Rhizosphere | MAEGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERRR* |
| Ga0132256_1014180753 | 3300015372 | Arabidopsis Rhizosphere | MAQGKETTKDELLREAKRLGIKGRSKMNKGALKAAVERRR* |
| Ga0132255_1008290722 | 3300015374 | Arabidopsis Rhizosphere | MAQGKERTKEQLMRQAKKLGIKGRSKMNKGALKAAVDRRS* |
| Ga0184605_104917981 | 3300018027 | Groundwater Sediment | VAQVRERSKEQLYREAKRLGVKGRSKMNKGQLKAAVNRRSS |
| Ga0184624_104305611 | 3300018073 | Groundwater Sediment | MPTGQERTKEELYQQAKRLNIKGRSKMNKGALKAALARRGL |
| Ga0173481_100008968 | 3300019356 | Soil | MPQGKDRTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR |
| Ga0173481_100088383 | 3300019356 | Soil | MAQGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERRR |
| Ga0173481_100092636 | 3300019356 | Soil | MPQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR |
| Ga0173481_108804052 | 3300019356 | Soil | MPTTGRETKEQLYRQAKRLGIKGRSKMNKGALKAAVGRHTHR |
| Ga0173482_100265153 | 3300019361 | Soil | MPQGKERTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR |
| Ga0173482_103642681 | 3300019361 | Soil | MTMGKERTREELYREAKRLNIKGRSKMNKRQLLAAVNRKK |
| Ga0173482_106353702 | 3300019361 | Soil | MPTGQERTKEELYQQAKRLNIKGRSKMNKGALKAALARRGH |
| Ga0173479_106064012 | 3300019362 | Soil | MATGHERTKEQLYREAKRLGVKGRSKMNKGQLKAALMRRGH |
| Ga0206356_115753452 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMGQERTKEQLYNQAKRLGVKGRSKMNKGQLKAALSRRGH |
| Ga0206355_11938672 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | GGAMPMGKERTKEQLYSEAKRLDIKGRSKMNKGALKAALARRGH |
| Ga0206352_100924421 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMGKERTKEQLYSEAKRLDIKGRSKMNKGALKAALARRGH |
| Ga0182009_100461722 | 3300021445 | Soil | MPTTNRETKEQLYRQAKRLGVKGRSKMNKGALKAAIARRTGS |
| Ga0182009_107652831 | 3300021445 | Soil | MPVSHGPTKEQLLREAKRLNIKGRSKMNKGALQAAVNRRK |
| Ga0126371_101778933 | 3300021560 | Tropical Forest Soil | MAIGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAALTRRGH |
| Ga0126371_107667903 | 3300021560 | Tropical Forest Soil | MPIGRRDLTKEQLYRQAKRLGIRGRSKMSKSQLKAAVGRHH |
| Ga0126371_112793423 | 3300021560 | Tropical Forest Soil | MPIGRDLTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHH |
| Ga0126371_114389062 | 3300021560 | Tropical Forest Soil | MAMGKERTKEQLYNEAKRLKIKGRSKMNKGALKAALARRGH |
| Ga0126371_136287602 | 3300021560 | Tropical Forest Soil | MAISREMTKEQLYREAKRLHVKGRSKMSKSQLKSAVARHRNL |
| Ga0222625_12265721 | 3300022195 | Groundwater Sediment | MTMGHERTKEQLYRQAKSLDIKGRSKMNKGQLKAALARKGH |
| Ga0224712_103028881 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | ERRQQMPTTGRETKEQLYRQAKRLNIKGRSKMNKGALKAAIGRHR |
| Ga0224712_106457802 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | RKEANMPIGRELTKEQLYRQAKRLGIKGRSKMSKTQLKMAVGRHHR |
| Ga0247747_10033761 | 3300022737 | Soil | MAQGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERR |
| Ga0247787_10491091 | 3300022893 | Soil | MAQGKERTKEQLLREAKRLGIKGRSKMNKGALKAAVERRR |
| Ga0247791_10422891 | 3300023062 | Soil | KERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR |
| Ga0247671_10206752 | 3300024284 | Soil | CRMTQGKERTKEQLLRQAKKLGIKGRSKMNKGALKAAVDRRS |
| Ga0207692_100980831 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TQREAEQLYREAKRLGVKGRSKMNKGQLKAALTRRGH |
| Ga0207642_100426981 | 3300025899 | Miscanthus Rhizosphere | MAQGKERTKEQLLREAKRLGIKGRSKMNKGALKAAVDRRS |
| Ga0207688_100868044 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAA |
| Ga0207680_110200381 | 3300025903 | Switchgrass Rhizosphere | MAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRS |
| Ga0207707_100748663 | 3300025912 | Corn Rhizosphere | MPIGRELTKEQLYRQAKRLGIKGRSKMSKTQLKMAVGRHHR |
| Ga0207671_107854502 | 3300025914 | Corn Rhizosphere | MPMGQERTKQQLYSQAKRLDIKGRSKMNKGQLKAAVARRGH |
| Ga0207663_114282291 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIETKEQLYREARRLGIKGRSKMNKGQLKAALSRRRSS |
| Ga0207662_106350261 | 3300025918 | Switchgrass Rhizosphere | MAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRS |
| Ga0207687_105863611 | 3300025927 | Miscanthus Rhizosphere | MPLSHERTKEQLYRQAKSLGIKGRSKMSKGQLKAALARKGH |
| Ga0207700_106006792 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIGHERTKAQLYREAKRLGVKGRSKMNKGQLKAALTRRGH |
| Ga0207664_108818702 | 3300025929 | Agricultural Soil | MPIGHERTKEQLYREAKRLRIKGRSKMNKGQLKAALTRHGH |
| Ga0207701_114434982 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRT |
| Ga0207689_105767371 | 3300025942 | Miscanthus Rhizosphere | IDRRGKGWRMAQGEERTKGQLLREAKRLGIKGRSKMNKGALKAAVDRRS |
| Ga0207712_109921882 | 3300025961 | Switchgrass Rhizosphere | QERTKEQLYRQAKSAGIKGRSKMNKGQLKAALARKGY |
| Ga0207675_1014581411 | 3300026118 | Switchgrass Rhizosphere | MAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR |
| Ga0209577_104223291 | 3300026552 | Soil | MIGREPTKEQLYHKAKRLGIKGRSKMSKNQLKAAVGRHR |
| Ga0207473_1043632 | 3300026752 | Soil | MAQGKERTKDELLREAKRLGIKGRSKMNKGALKAAVDRRR |
| Ga0207502_1071361 | 3300026828 | Soil | MPQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDR |
| Ga0207503_10142271 | 3300026861 | Soil | MPTTGRETKEQLYRQAKRLGIKGRSKMNKGQLKAAVNRRGR |
| Ga0209811_100520643 | 3300027821 | Surface Soil | MTQGKERTKEELYREAKRLNITGRSKMNKGALKAALARRGH |
| Ga0209166_103532391 | 3300027857 | Surface Soil | MTMGQERTKEQLYNQAKRLGVKGRSKMNKGQLKAALQRRGH |
| Ga0209814_101816631 | 3300027873 | Populus Rhizosphere | MPQGKERTKEQLLKEAKRLGIQGRSKMNKGALKAAVDRRR |
| Ga0209486_110427142 | 3300027886 | Agricultural Soil | MPTTTRFTKEQLYREAKRLGIKGRSKMNKGALKAAVERRRGH |
| Ga0207428_101782763 | 3300027907 | Populus Rhizosphere | MPTTRDKTKEQWYRQAKRLGIKGRSKMNKGQLKAAVNRRSS |
| Ga0207428_101796213 | 3300027907 | Populus Rhizosphere | MATVKETKEKLYREAKRLNIKGRSKMNKGQLKAALARRGR |
| Ga0247750_10389121 | 3300027992 | Soil | QSKGGRFMAQERTKEQLYRQAKSAGIKGRSKMNKGQLKAALARKGY |
| Ga0307317_100980722 | 3300028720 | Soil | MANNRREALMAQGKERTKEQLLREARRLNIAGRSKMTKGALKAAVDRRK |
| Ga0307302_106396511 | 3300028814 | Soil | MPTGQERTKEELYQQAKRLNIKGRSKMNKGALKAA |
| Ga0307277_105423072 | 3300028881 | Soil | MAQGKERTKEQLLREARRLNIPGRSKMTKGALKAAVDRRK |
| Ga0307304_101167581 | 3300028885 | Soil | MAQGKERTKEQLLREARRLNIAGRSKMTKGALKAAVDRRK |
| Ga0308189_102437062 | 3300031058 | Soil | ARVGRRTANNRREALMAQGKERTKEQLLREARRLNIPGRSKMTKGALKAAVDRRK |
| Ga0308189_105132932 | 3300031058 | Soil | ANNRREALMAQGKERTKEQLLREARRLNIAGRSKMTKGALKAAVDRRK |
| Ga0308201_100249633 | 3300031091 | Soil | TMGHERTKEQLYRQAKSLDIKGRSKMNKGQLKAALARKGH |
| Ga0308204_100516692 | 3300031092 | Soil | ISMPTGQERTKEELYQQAKRLNIKGRSKMNKGALKAALARRGH |
| Ga0318534_101068822 | 3300031544 | Soil | MPTTEPTKEKLYREARRLHIKGRSKMNKTQLKSAIARHRY |
| Ga0310887_111446411 | 3300031547 | Soil | MTQGKERTKEQLLREAKKLGIKGRSKMNKGALKAAVDRRR |
| Ga0308175_1003024523 | 3300031938 | Soil | EGRHQMPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAAIAPHR |
| Ga0308175_1003776381 | 3300031938 | Soil | WRMAQGKERTKEQLLREAKKLGIKGRSKMNKGALKAAVDRRS |
| Ga0308175_1009035742 | 3300031938 | Soil | RHQMPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAAIARRTGR |
| Ga0308175_1013752572 | 3300031938 | Soil | MPMTGRETKEQLYRKAKRLNIKGRSKMNKGALKAAIGRHR |
| Ga0308175_1015873781 | 3300031938 | Soil | MPIGHERTKEQLYREAKRFGIKGRSKMNKGQLKAALSKRGH |
| Ga0308175_1023802681 | 3300031938 | Soil | MPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAA |
| Ga0306926_122139592 | 3300031954 | Soil | MATGHERTNEQLYRQAQRLGNKGRSKMNKGQLKVALTRRGH |
| Ga0308176_102623582 | 3300031996 | Soil | MPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAAIAPHR |
| Ga0308176_114887311 | 3300031996 | Soil | MPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAAIA |
| Ga0318563_106375631 | 3300032009 | Soil | MPTIGRELTKEQLYRQARRLGIKGRSKMSKSQLKSAVGRHHR |
| Ga0306920_1000367144 | 3300032261 | Soil | MPTEITKEQLYREARRLRIRGRSKMTKSQLRAAISRQRGM |
| Ga0247830_102539742 | 3300033551 | Soil | MPMETKEQLYREAKRLGIKGRSRMNKGQLKAAVSRRRGG |
| ⦗Top⦘ |