NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F017514

Metagenome / Metatranscriptome Family F017514

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017514
Family Type Metagenome / Metatranscriptome
Number of Sequences 240
Average Sequence Length 41 residues
Representative Sequence MPIGQERTKEQLYRQAKRLGIKGRSKMNKGQLKAALTRRGH
Number of Associated Samples 160
Number of Associated Scaffolds 240

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.83 %
% of genes near scaffold ends (potentially truncated) 22.92 %
% of genes from short scaffolds (< 2000 bps) 85.83 %
Associated GOLD sequencing projects 147
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (57.083 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(12.500 % of family members)
Environment Ontology (ENVO) Unclassified
(25.833 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.250 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.68%    β-sheet: 0.00%    Coil/Unstructured: 62.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 240 Family Scaffolds
PF07498Rho_N 31.25
PF03309Pan_kinase 2.08
PF00902TatC 1.67
PF00072Response_reg 1.25
PF01988VIT1 0.83
PF06240COXG 0.83
PF01391Collagen 0.83
PF07883Cupin_2 0.83
PF00809Pterin_bind 0.83
PF01061ABC2_membrane 0.83
PF00211Guanylate_cyc 0.83
PF02771Acyl-CoA_dh_N 0.83
PF14019DUF4235 0.83
PF00903Glyoxalase 0.83
PF07676PD40 0.42
PF13365Trypsin_2 0.42
PF07687M20_dimer 0.42
PF13469Sulfotransfer_3 0.42
PF12681Glyoxalase_2 0.42
PF13424TPR_12 0.42
PF00999Na_H_Exchanger 0.42
PF00484Pro_CA 0.42
PF00246Peptidase_M14 0.42
PF00069Pkinase 0.42
PF13374TPR_10 0.42
PF00202Aminotran_3 0.42
PF03006HlyIII 0.42
PF04545Sigma70_r4 0.42
PF00733Asn_synthase 0.42
PF04185Phosphoesterase 0.42
PF00800PDT 0.42
PF07366SnoaL 0.42
PF04261Dyp_perox 0.42
PF05239PRC 0.42
PF08445FR47 0.42
PF08281Sigma70_r4_2 0.42
PF00583Acetyltransf_1 0.42
PF04007DUF354 0.42
PF00155Aminotran_1_2 0.42
PF00578AhpC-TSA 0.42
PF04542Sigma70_r2 0.42
PF01243Putative_PNPOx 0.42
PF00248Aldo_ket_red 0.42
PF00027cNMP_binding 0.42
PF085212CSK_N 0.42
PF13155Toprim_2 0.42
PF13189Cytidylate_kin2 0.42
PF03992ABM 0.42
PF00563EAL 0.42
PF01288HPPK 0.42
PF00877NLPC_P60 0.42

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 240 Family Scaffolds
COG1521Pantothenate kinase type IIICoenzyme transport and metabolism [H] 2.08
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.67
COG0805Twin-arginine protein secretion pathway component TatCIntracellular trafficking, secretion, and vesicular transport [U] 1.67
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.83
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.83
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.83
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.83
COG3427Carbon monoxide dehydrogenase subunit CoxGEnergy production and conversion [C] 0.83
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.42
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.42
COG2837Periplasmic deferrochelatase/peroxidase EfeBInorganic ion transport and metabolism [P] 0.42
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.42
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.42
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.42
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.42
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.42
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.42
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.42
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.42
COG1817Predicted glycosyltransferaseGeneral function prediction only [R] 0.42
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.42
COG1272Predicted membrane channel-forming protein YqfA, hemolysin III familyIntracellular trafficking, secretion, and vesicular transport [U] 0.42
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.42
COG08017,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis)Coenzyme transport and metabolism [H] 0.42
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 0.42
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.42
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.42
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.42
COG0381UDP-N-acetylglucosamine 2-epimeraseCell wall/membrane/envelope biogenesis [M] 0.42
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.42
COG0077Prephenate dehydrataseAmino acid transport and metabolism [E] 0.42


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.33 %
UnclassifiedrootN/A41.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_130338Not Available657Open in IMG/M
2228664021|ICCgaii200_c0411727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae → Glycomyces → Glycomyces artemisiae632Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2165401All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Zunongwangia → Zunongwangia profunda606Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_10824561Not Available553Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100355246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300000550|F24TB_10495496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300000550|F24TB_10958300All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10098382All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10171963Not Available515Open in IMG/M
3300000890|JGI11643J12802_10053726Not Available657Open in IMG/M
3300000890|JGI11643J12802_10822319All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300000956|JGI10216J12902_105390281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1536Open in IMG/M
3300000956|JGI10216J12902_106058976All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300001867|JGI12627J18819_10221467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium762Open in IMG/M
3300003911|JGI25405J52794_10042605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium962Open in IMG/M
3300004114|Ga0062593_100074965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2259Open in IMG/M
3300004114|Ga0062593_100502208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1124Open in IMG/M
3300004114|Ga0062593_100858270Not Available912Open in IMG/M
3300004114|Ga0062593_102088385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter minatonensis632Open in IMG/M
3300004114|Ga0062593_102258987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya → Sporichthya polymorpha611Open in IMG/M
3300004463|Ga0063356_101095235Not Available1147Open in IMG/M
3300004479|Ga0062595_100419872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria968Open in IMG/M
3300004479|Ga0062595_100794853Not Available778Open in IMG/M
3300004479|Ga0062595_101170396Not Available679Open in IMG/M
3300004633|Ga0066395_10093444All Organisms → cellular organisms → Bacteria1435Open in IMG/M
3300004633|Ga0066395_10413416Not Available762Open in IMG/M
3300005093|Ga0062594_100126327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1608Open in IMG/M
3300005167|Ga0066672_10053489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2325Open in IMG/M
3300005172|Ga0066683_10499862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria743Open in IMG/M
3300005330|Ga0070690_100300072Not Available1152Open in IMG/M
3300005332|Ga0066388_100005687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium8742Open in IMG/M
3300005332|Ga0066388_100107050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3279Open in IMG/M
3300005332|Ga0066388_106344212Not Available596Open in IMG/M
3300005335|Ga0070666_10199644All Organisms → cellular organisms → Bacteria1407Open in IMG/M
3300005339|Ga0070660_100235710All Organisms → cellular organisms → Bacteria1489Open in IMG/M
3300005363|Ga0008090_14548380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300005406|Ga0070703_10452941Not Available569Open in IMG/M
3300005434|Ga0070709_10123902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1756Open in IMG/M
3300005435|Ga0070714_100090939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2673Open in IMG/M
3300005435|Ga0070714_100435416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1244Open in IMG/M
3300005437|Ga0070710_10009810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4692Open in IMG/M
3300005446|Ga0066686_10439870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia891Open in IMG/M
3300005526|Ga0073909_10044499Not Available1586Open in IMG/M
3300005537|Ga0070730_10265127All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300005544|Ga0070686_101770692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp.525Open in IMG/M
3300005548|Ga0070665_102114481Not Available567Open in IMG/M
3300005553|Ga0066695_10815612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300005563|Ga0068855_100195867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter2276Open in IMG/M
3300005615|Ga0070702_100538066Not Available865Open in IMG/M
3300005713|Ga0066905_101687375All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005764|Ga0066903_100026765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium6385Open in IMG/M
3300005764|Ga0066903_100037137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5662Open in IMG/M
3300005764|Ga0066903_100312096All Organisms → cellular organisms → Bacteria2501Open in IMG/M
3300005764|Ga0066903_100337097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2424Open in IMG/M
3300005764|Ga0066903_100461498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2129Open in IMG/M
3300005764|Ga0066903_100463899All Organisms → cellular organisms → Bacteria2125Open in IMG/M
3300005764|Ga0066903_100509469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2043Open in IMG/M
3300005764|Ga0066903_100837576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1652Open in IMG/M
3300005764|Ga0066903_100854905All Organisms → cellular organisms → Bacteria1638Open in IMG/M
3300005764|Ga0066903_100877979All Organisms → cellular organisms → Bacteria1619Open in IMG/M
3300005764|Ga0066903_100944664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1567Open in IMG/M
3300005764|Ga0066903_100955204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1560Open in IMG/M
3300005764|Ga0066903_100999114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1529Open in IMG/M
3300005764|Ga0066903_101200342Not Available1408Open in IMG/M
3300005764|Ga0066903_101634328All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300005764|Ga0066903_101946769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1127Open in IMG/M
3300005764|Ga0066903_102684788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales966Open in IMG/M
3300005764|Ga0066903_102772790All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300005764|Ga0066903_102854517All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300005764|Ga0066903_104307949All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005764|Ga0066903_106301923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300005764|Ga0066903_106771480Not Available596Open in IMG/M
3300005894|Ga0075270_1013834All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300005902|Ga0075273_10039614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium834Open in IMG/M
3300005937|Ga0081455_10022848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5833Open in IMG/M
3300005937|Ga0081455_10070339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes2906Open in IMG/M
3300005937|Ga0081455_10081128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2657Open in IMG/M
3300005937|Ga0081455_10663891All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300006038|Ga0075365_11320646Not Available507Open in IMG/M
3300006175|Ga0070712_100043724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3085Open in IMG/M
3300006237|Ga0097621_100214022All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300006755|Ga0079222_10515190All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300006844|Ga0075428_100132182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2714Open in IMG/M
3300006844|Ga0075428_100248007All Organisms → cellular organisms → Bacteria1919Open in IMG/M
3300006846|Ga0075430_100205761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1633Open in IMG/M
3300006852|Ga0075433_11145616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300006871|Ga0075434_100715888Not Available1018Open in IMG/M
3300006871|Ga0075434_101014926Not Available843Open in IMG/M
3300009012|Ga0066710_100102951All Organisms → cellular organisms → Bacteria3826Open in IMG/M
3300009012|Ga0066710_102116359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium826Open in IMG/M
3300009088|Ga0099830_11420703Not Available577Open in IMG/M
3300009094|Ga0111539_10098269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3438Open in IMG/M
3300009098|Ga0105245_10476359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1261Open in IMG/M
3300009148|Ga0105243_11780773Not Available646Open in IMG/M
3300009156|Ga0111538_10355113All Organisms → cellular organisms → Bacteria1855Open in IMG/M
3300009156|Ga0111538_12405408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300009162|Ga0075423_12648140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300009174|Ga0105241_11906551Not Available583Open in IMG/M
3300009176|Ga0105242_11154878Not Available791Open in IMG/M
3300010043|Ga0126380_12246146Not Available505Open in IMG/M
3300010047|Ga0126382_10415516Not Available1055Open in IMG/M
3300010047|Ga0126382_11841447Not Available570Open in IMG/M
3300010048|Ga0126373_12064730Not Available632Open in IMG/M
3300010145|Ga0126321_1505556Not Available556Open in IMG/M
3300010358|Ga0126370_10159331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1656Open in IMG/M
3300010358|Ga0126370_10669685All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium907Open in IMG/M
3300010360|Ga0126372_10114874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2063Open in IMG/M
3300010361|Ga0126378_12208718All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium628Open in IMG/M
3300010362|Ga0126377_11165887All Organisms → cellular organisms → Bacteria → Terrabacteria group840Open in IMG/M
3300010362|Ga0126377_11447395All Organisms → cellular organisms → Bacteria → Terrabacteria group760Open in IMG/M
3300010366|Ga0126379_10210214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1880Open in IMG/M
3300010366|Ga0126379_10232671All Organisms → cellular organisms → Bacteria1800Open in IMG/M
3300010366|Ga0126379_10434094Not Available1370Open in IMG/M
3300010366|Ga0126379_10565877Not Available1218Open in IMG/M
3300010371|Ga0134125_12129151Not Available610Open in IMG/M
3300010373|Ga0134128_11508734Not Available740Open in IMG/M
3300010375|Ga0105239_10158189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2531Open in IMG/M
3300010375|Ga0105239_11072732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium927Open in IMG/M
3300010376|Ga0126381_101186068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium R501103Open in IMG/M
3300010376|Ga0126381_102025972Not Available829Open in IMG/M
3300010376|Ga0126381_102256515Not Available782Open in IMG/M
3300010376|Ga0126381_102509111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300010376|Ga0126381_103416643Not Available625Open in IMG/M
3300010397|Ga0134124_12607086Not Available548Open in IMG/M
3300010398|Ga0126383_10259803All Organisms → cellular organisms → Bacteria1710Open in IMG/M
3300010398|Ga0126383_13297240Not Available527Open in IMG/M
3300010399|Ga0134127_11990988Not Available659Open in IMG/M
3300010937|Ga0137776_1018423Not Available1354Open in IMG/M
3300012199|Ga0137383_10428527Not Available969Open in IMG/M
3300012204|Ga0137374_10625343All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300012206|Ga0137380_11326997Not Available604Open in IMG/M
3300012209|Ga0137379_10900566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300012210|Ga0137378_10987068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium756Open in IMG/M
3300012211|Ga0137377_10784334Not Available886Open in IMG/M
3300012356|Ga0137371_11171833Not Available575Open in IMG/M
3300012358|Ga0137368_10481203Not Available803Open in IMG/M
3300012359|Ga0137385_11191047All Organisms → cellular organisms → Bacteria → Terrabacteria group623Open in IMG/M
3300012469|Ga0150984_111876997Not Available562Open in IMG/M
3300012469|Ga0150984_123327476Not Available1155Open in IMG/M
3300012882|Ga0157304_1021292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria826Open in IMG/M
3300012897|Ga0157285_10016788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1510Open in IMG/M
3300012898|Ga0157293_10114315Not Available715Open in IMG/M
3300012899|Ga0157299_10129336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300012905|Ga0157296_10021672Not Available1267Open in IMG/M
3300012916|Ga0157310_10282060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300012943|Ga0164241_10179915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1513Open in IMG/M
3300012957|Ga0164303_10542376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae753Open in IMG/M
3300012961|Ga0164302_11603676Not Available541Open in IMG/M
3300012971|Ga0126369_10507274Not Available1265Open in IMG/M
3300012971|Ga0126369_10981404Not Available932Open in IMG/M
3300012971|Ga0126369_11017661Not Available916Open in IMG/M
3300012971|Ga0126369_13360910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300012986|Ga0164304_11724006Not Available524Open in IMG/M
3300013096|Ga0157307_1003233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2306Open in IMG/M
3300013105|Ga0157369_10141090All Organisms → cellular organisms → Bacteria2550Open in IMG/M
3300013306|Ga0163162_10301568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1734Open in IMG/M
3300013307|Ga0157372_12398760Not Available606Open in IMG/M
3300013772|Ga0120158_10390593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300015201|Ga0173478_10109724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1032Open in IMG/M
3300015371|Ga0132258_10121579All Organisms → cellular organisms → Bacteria6205Open in IMG/M
3300015371|Ga0132258_10152288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5549Open in IMG/M
3300015371|Ga0132258_10300253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3949Open in IMG/M
3300015371|Ga0132258_12400117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1321Open in IMG/M
3300015372|Ga0132256_101418075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium806Open in IMG/M
3300015374|Ga0132255_100829072All Organisms → cellular organisms → Bacteria1380Open in IMG/M
3300018027|Ga0184605_10491798Not Available535Open in IMG/M
3300018073|Ga0184624_10430561Not Available582Open in IMG/M
3300019356|Ga0173481_10000896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6847Open in IMG/M
3300019356|Ga0173481_10008838All Organisms → cellular organisms → Bacteria2793Open in IMG/M
3300019356|Ga0173481_10009263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2741Open in IMG/M
3300019356|Ga0173481_10880405Not Available503Open in IMG/M
3300019361|Ga0173482_10026515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1707Open in IMG/M
3300019361|Ga0173482_10364268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300019361|Ga0173482_10635370Not Available542Open in IMG/M
3300019362|Ga0173479_10606401Not Available574Open in IMG/M
3300020070|Ga0206356_11575345Not Available661Open in IMG/M
3300020076|Ga0206355_1193867Not Available774Open in IMG/M
3300020078|Ga0206352_10092442Not Available554Open in IMG/M
3300021445|Ga0182009_10046172All Organisms → cellular organisms → Eukaryota1822Open in IMG/M
3300021445|Ga0182009_10765283Not Available526Open in IMG/M
3300021560|Ga0126371_10177893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2209Open in IMG/M
3300021560|Ga0126371_10766790Not Available1111Open in IMG/M
3300021560|Ga0126371_11279342Not Available868Open in IMG/M
3300021560|Ga0126371_11438906Not Available819Open in IMG/M
3300021560|Ga0126371_13628760Not Available521Open in IMG/M
3300022195|Ga0222625_1226572Not Available524Open in IMG/M
3300022467|Ga0224712_10302888Not Available748Open in IMG/M
3300022467|Ga0224712_10645780All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300022737|Ga0247747_1003376Not Available1524Open in IMG/M
3300022893|Ga0247787_1049109Not Available620Open in IMG/M
3300023062|Ga0247791_1042289Not Available710Open in IMG/M
3300024284|Ga0247671_1020675All Organisms → cellular organisms → Bacteria → Terrabacteria group985Open in IMG/M
3300025898|Ga0207692_10098083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea1603Open in IMG/M
3300025899|Ga0207642_10042698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1995Open in IMG/M
3300025901|Ga0207688_10086804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1793Open in IMG/M
3300025903|Ga0207680_11020038Not Available592Open in IMG/M
3300025912|Ga0207707_10074866All Organisms → cellular organisms → Bacteria2953Open in IMG/M
3300025914|Ga0207671_10785450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria755Open in IMG/M
3300025916|Ga0207663_11428229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300025918|Ga0207662_10635026Not Available745Open in IMG/M
3300025927|Ga0207687_10586361Not Available938Open in IMG/M
3300025928|Ga0207700_10600679Not Available979Open in IMG/M
3300025929|Ga0207664_10881870Not Available804Open in IMG/M
3300025930|Ga0207701_11443498Not Available559Open in IMG/M
3300025942|Ga0207689_10576737All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300025961|Ga0207712_10992188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300026118|Ga0207675_101458141Not Available705Open in IMG/M
3300026552|Ga0209577_10422329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium947Open in IMG/M
3300026752|Ga0207473_104363Not Available541Open in IMG/M
3300026828|Ga0207502_107136Not Available577Open in IMG/M
3300026861|Ga0207503_1014227Not Available516Open in IMG/M
3300027821|Ga0209811_10052064Not Available1402Open in IMG/M
3300027857|Ga0209166_10353239All Organisms → cellular organisms → Bacteria → Terrabacteria group767Open in IMG/M
3300027873|Ga0209814_10181663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium906Open in IMG/M
3300027886|Ga0209486_11042714All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300027907|Ga0207428_10178276Not Available1606Open in IMG/M
3300027907|Ga0207428_10179621Not Available1599Open in IMG/M
3300027992|Ga0247750_1038912Not Available530Open in IMG/M
3300028720|Ga0307317_10098072Not Available970Open in IMG/M
3300028814|Ga0307302_10639651Not Available529Open in IMG/M
3300028881|Ga0307277_10542307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300028885|Ga0307304_10116758Not Available1083Open in IMG/M
3300031058|Ga0308189_10243706Not Available675Open in IMG/M
3300031058|Ga0308189_10513293Not Available518Open in IMG/M
3300031091|Ga0308201_10024963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1297Open in IMG/M
3300031092|Ga0308204_10051669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1001Open in IMG/M
3300031544|Ga0318534_10106882All Organisms → cellular organisms → Bacteria1604Open in IMG/M
3300031547|Ga0310887_11144641Not Available501Open in IMG/M
3300031938|Ga0308175_100302452All Organisms → cellular organisms → Eukaryota → Sar1631Open in IMG/M
3300031938|Ga0308175_100377638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1473Open in IMG/M
3300031938|Ga0308175_100903574Not Available971Open in IMG/M
3300031938|Ga0308175_101375257Not Available787Open in IMG/M
3300031938|Ga0308175_101587378Not Available732Open in IMG/M
3300031938|Ga0308175_102380268Not Available593Open in IMG/M
3300031954|Ga0306926_12213959Not Available612Open in IMG/M
3300031996|Ga0308176_10262358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1663Open in IMG/M
3300031996|Ga0308176_11488731Not Available721Open in IMG/M
3300032009|Ga0318563_10637563Not Available574Open in IMG/M
3300032261|Ga0306920_100036714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7053Open in IMG/M
3300033551|Ga0247830_10253974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1333Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil11.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.42%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.08%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.08%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.08%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.67%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.25%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.25%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.25%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.25%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.83%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.83%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.42%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.42%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.42%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.42%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.42%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.42%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.42%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.42%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.42%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.42%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.42%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.42%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005894Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203EnvironmentalOpen in IMG/M
3300005902Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300024284Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026752Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A4w-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026828Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026861Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027992Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S125-311R-5EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_023671302199352024SoilERRQHMPMTGRETKEQLYRKAKRLNIKGRSKMNKGALKAAIGRHR
ICCgaii200_041172712228664021SoilVATVGKQSKGGHFMTMGKERTKEQLYXEAKRLGVKGRSXMNKGQLKAALARRGH
ICChiseqgaiiDRAFT_216540113300000033SoilTETSFERGSLMAQGRERTKEQLYREAKRLGVKGRSKMNKGQLKAAV
ICChiseqgaiiFebDRAFT_1082456113300000363SoilMPLGNERTKEQLYRQAKSLGIKGRSKMNKGQLKAALARKGH*
INPhiseqgaiiFebDRAFT_10035524623300000364SoilMPLETKEQLYREARRLGIKGRSKMNKGQLKAAISRRS*
F24TB_1049549623300000550SoilMPTGHERTKEQLYREAKRLGIRGRSKMSKGQLKAAISRHRM*
F24TB_1095830023300000550SoilMPQVKERTKEALYREAKRLGIKGRSKMNKGALKAAVERRR*
AF_2010_repII_A1DRAFT_1009838213300000597Forest SoilMAIGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAALSRRGH*
AF_2010_repII_A1DRAFT_1017196323300000597Forest SoilMPISRELTKEQLYREARRLRVKGRSKMTKSQLKSAVARHRHM*
JGI11643J12802_1005372623300000890SoilMPQGKERTKEQLLKEAKKLGIKGRSRMNKGALKAAVDRRR*
JGI11643J12802_1082231913300000890SoilMPQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAV
JGI10216J12902_10539028123300000956SoilMPIETKEQLYREAKRLRIKGRSKMTKGQLKAAISRQRM*
JGI10216J12902_10605897633300000956SoilGKGVPMPLDTKEQLYREAKRLRIKGRSKMNKGQLKAAISRHRM*
JGI12627J18819_1022146713300001867Forest SoilMPIGHERTKEQLYREAKRLGVKGRSKMNKGQLKAALMRRGH*
JGI25405J52794_1004260523300003911Tabebuia Heterophylla RhizosphereMPQGTERTKEQLLREAKRLNIKGRSKMNKGALQAAINRRK*
Ga0062593_10007496513300004114SoilMAQERTKEQLYRQAKSAGIKGRSKMNKGQLKAALARKGY*
Ga0062593_10050220823300004114SoilMPLDTKEQLYREARRLGIKGRSKMNKGQLKAAISRRRGA*
Ga0062593_10085827023300004114SoilMAQGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERRR*
Ga0062593_10208838513300004114SoilMTQGKERTKEQLMREAKKLGIKGRSKMNKGALKAAVDRRS*
Ga0062593_10225898713300004114SoilMPTTGRETKEQLYRQAKRLGIKGRSKMNKGALKAAVGRHTHR*
Ga0063356_10109523533300004463Arabidopsis Thaliana RhizosphereMPMGQERTKEQLYREAKRLGIKGRSKMNKGQLKAALLRRGQ*
Ga0062595_10041987223300004479SoilMPIGRELTKEQLYRQAKRLGIKGRSKMSKTQLKMAVGRHHR*
Ga0062595_10079485313300004479SoilMTQGKERTKEQLMRQAKKLGIKGRSKMNKGALKAAVDRRS*
Ga0062595_10117039613300004479SoilMPMGQERTKEELYRAAKRLNIKGRSKMNKGQLKAALARRGH*
Ga0066395_1009344423300004633Tropical Forest SoilMAIGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAALTRRGH*
Ga0066395_1041341623300004633Tropical Forest SoilMPIGRRDLTKEQLYRQAKRLGIRGRSKMSKSQLKAAVGRHH*
Ga0062594_10012632743300005093SoilMPLSHERTKEQLYRQAKSLGIKGRSKMSKGQLKAALARKGH*
Ga0066672_1005348913300005167SoilMIGREPTKEQLYHKAKRLGIKGRSKMSKNQLKAAVGRHR*
Ga0066683_1049986213300005172SoilMPITREFTKEQLYREAKRLRIKGRSKMSKSQLKAAVSRHRHM*
Ga0070690_10030007233300005330Switchgrass RhizosphereMAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRS*
Ga0066388_10000568723300005332Tropical Forest SoilMPISHEPTKEQLYRQAKRLKVKGRSKMNKSQLKSAVARRSH*
Ga0066388_10010705033300005332Tropical Forest SoilMPITGRELTKEQLYRQAKRLGIRGRSKMSKSQLKAAVGRHHR*
Ga0066388_10634421223300005332Tropical Forest SoilMPTIGREPTKEQLYRQAKRLGIRGRSKMSKNQLKAAVGRHH*
Ga0070666_1019964433300005335Switchgrass RhizosphereMAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRS*
Ga0070660_10023571033300005339Corn RhizosphereMAQGKERTKEQLLREAKRLGIKGRSKMNKGALKAAVDRRS*
Ga0008090_1454838013300005363Tropical Rainforest SoilMAFSRDVTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHHH*
Ga0070703_1045294113300005406Corn, Switchgrass And Miscanthus RhizosphereMPQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0070709_1012390223300005434Corn, Switchgrass And Miscanthus RhizosphereMATGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAAVTRRGH*
Ga0070714_10009093933300005435Agricultural SoilMTQGKERTKEQLLREAKKLGIKGRSKMNKGALKAAVDRRS*
Ga0070714_10043541613300005435Agricultural SoilMPIGHERTKEQLYREAKRLRIKGRSKMNKGQLKAALTRHGH*
Ga0070710_1000981063300005437Corn, Switchgrass And Miscanthus RhizosphereMTQGKERTKEQLLRQAKKLGIKGRSKMNKGALKAAVDRRS*
Ga0066686_1043987023300005446SoilMATSERTKEQLYSQAKRFGVKGRSKMNKSQLKAALARRGH*
Ga0073909_1004449933300005526Surface SoilMTQGKERTKEELYREAKRLNITGRSKMNKGALKAALARRGH*
Ga0070730_1026512713300005537Surface SoilMTMGQERTKEQLYNQAKRLGVKGRSKMNKGQLKAALQRRGH*
Ga0070686_10177069223300005544Switchgrass RhizosphereMASGQERTKEQLYRQAASLGIKGRSKMNKGQLKAAIDRRR*
Ga0070665_10211448113300005548Switchgrass RhizosphereMAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRT
Ga0066695_1081561223300005553SoilMATRERTKEQLYSQAKRFGVKGRSKMNKGQLKAALARRGH*
Ga0068855_10019586733300005563Corn RhizosphereMAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRT*
Ga0070702_10053806623300005615Corn, Switchgrass And Miscanthus RhizosphereMAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRT*
Ga0066905_10168737513300005713Tropical Forest SoilMPTRDKTKEQWYRDAKRLGIKGRSKMNKGQLKAAVNRRGH*
Ga0066903_10002676583300005764Tropical Forest SoilMGRERTKEELYRTAKRLGIKGRSKMNKGQLKAAVARRGG*
Ga0066903_10003713753300005764Tropical Forest SoilMTIGHERTKEQLYREAKRLRIKGRSKMNKGQLKAALTRHGH*
Ga0066903_10031209643300005764Tropical Forest SoilMPITRELTKEQLYREAKRLHIKGRSKMSKTQLKAAVSRHRF*
Ga0066903_10033709723300005764Tropical Forest SoilMPMIGRDLTKEQLYRQARRLGIKGRSKMSKSQLKAAVGRHHR*
Ga0066903_10046149823300005764Tropical Forest SoilMPIGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALTRRGH*
Ga0066903_10046389923300005764Tropical Forest SoilMPVGEMTKEKLYKEATRLRIKGRSKMTKSQLKSAIDRHSHR*
Ga0066903_10050946913300005764Tropical Forest SoilMPLETKEQLYREAKRLRIKGRSKMNKGQLKAAVSRHRI*
Ga0066903_10083757623300005764Tropical Forest SoilMPISREMTKEQLYREAKRLHVKGRSKMTKSQLKSALARQRHI*
Ga0066903_10085490533300005764Tropical Forest SoilMPISREPTKEQLYREAKRLRVNGRSTMTKSQLKSAVARHRHM*
Ga0066903_10087797923300005764Tropical Forest SoilMMPTREPTKETLYREAKRLRIKGRSKMSKTQLKSAIARHRF*
Ga0066903_10094466423300005764Tropical Forest SoilMPMGHDRTKEQLYRQAKRLGIKGRSKMNKGQLKAALSRRGH*
Ga0066903_10095520423300005764Tropical Forest SoilMTMGHERTKEELYRQAKRLGIKGRSKMNKGQLKAALTRRGH*
Ga0066903_10099911423300005764Tropical Forest SoilMPTTEPTKEKLYREARRLRIKGRSKMNKTQLKSAIARHRY*
Ga0066903_10120034223300005764Tropical Forest SoilMPIGRDLTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHH*
Ga0066903_10163432823300005764Tropical Forest SoilMPIGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALSRRGH*
Ga0066903_10194676913300005764Tropical Forest SoilNPRRWDMPMGQEQTKAKLYQHAKRLNIKGRSKMNKGQLKAALARKGH*
Ga0066903_10268478823300005764Tropical Forest SoilMPTTEPSKEKLYREAQRLRIKGRSKMTKTQLQSAIARHRF*
Ga0066903_10277279023300005764Tropical Forest SoilMPIGQERTKEQLYRQAKRLGIKGRSKMNKGQLKAALTRRGH*
Ga0066903_10285451713300005764Tropical Forest SoilTSPKGGHLMPMGHERTKQELYRTAKRLNIKGRSKMSKGQLKAALARRGH*
Ga0066903_10430794923300005764Tropical Forest SoilMPEWGGTCNSMKGVYMPQGTERTKEQLLRDAKRLNIKGRSKMNKGALKAAVDRRK*
Ga0066903_10630192313300005764Tropical Forest SoilMPIGRRDLTKEQLYRQAKRLGIRGRSKMSKSQLKA
Ga0066903_10677148013300005764Tropical Forest SoilMPTGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALARRGH*
Ga0075270_101383413300005894Rice Paddy SoilMPTTRRETKEQLYRQAKSLGIKGRSKMNKGTLKAAIGRHR*
Ga0075273_1003961423300005902Rice Paddy SoilMPIGRDLTKEQLYRQAKRLGIKGRSKMSKSQLKTAVGRRHR*
Ga0081455_1002284823300005937Tabebuia Heterophylla RhizosphereMPMETKEQLYREAKRLRIKGRSKMSKGQLKAAVSRHRI*
Ga0081455_1007033933300005937Tabebuia Heterophylla RhizosphereMPTTRDKTKEQWYREAKRLGIKGRSKMNKGQLKAAVNRRGG*
Ga0081455_1008112853300005937Tabebuia Heterophylla RhizosphereMPMGHERTKEQLYLQAKRLNIKGHSKMNKGQLKAALQRRGH*
Ga0081455_1066389123300005937Tabebuia Heterophylla RhizosphereMPTTTGATKEQLYKEAKRLGIKGRSKMKKGALKAAIERRRGH*
Ga0075365_1132064613300006038Populus EndosphereMAMGQERTKEQLYRQAKSLNIKGRSKMTKTQLKAALSRKGH*
Ga0070712_10004372413300006175Corn, Switchgrass And Miscanthus RhizosphereMPIGHERTKEQLYREAKRLGVKGRSKMNKGQLKAALTRR
Ga0097621_10021402233300006237Miscanthus RhizosphereEERGCRMTQGKERTKEQLLRQAKKLGIKGRSKMNKGALKAAVDRRS*
Ga0079222_1051519023300006755Agricultural SoilRTKEQLYREAKRLDIKGRSKMNKGALKAALARRGH*
Ga0075428_10013218243300006844Populus RhizosphereMPTTRDKTKEQWYRQAKRLGIKGRSKMNKGQLKAAVNRRSS*
Ga0075428_10024800723300006844Populus RhizosphereMPQGKERTKEQLLKEAKRLGIQGRSKMNKGALKAAVERRR*
Ga0075430_10020576143300006846Populus RhizosphereMTRDELYKEAKRLGIKGRSKMTKGLLKAAVDRRRSS*
Ga0075433_1114561623300006852Populus RhizosphereMPLDTKEQLYREAKRLRIKGRSKMNKGQLKAAISRQRV*
Ga0075434_10071588813300006871Populus RhizosphereMPMGHERTKEELYRQAKRLNIKGRSKMNKGQLKAALARRGH*
Ga0075434_10101492623300006871Populus RhizosphereMPTGHERTKEELYRQAKRLNIKGRSKMNKGQLKAALARRGQ*
Ga0066710_10010295133300009012Grasslands SoilMPITREFTKEQLYREAKRLRIKGRSKMSKSQLKAAVSRHRHM
Ga0066710_10211635913300009012Grasslands SoilMPMGHERTKEQLYREAKRLGIKGRSRMNKGQLKAALARRGH
Ga0099830_1142070323300009088Vadose Zone SoilMPIGREITKEQLYREARRLGIRGRSKMRKSQLKMAVERRRHR*
Ga0111539_1009826953300009094Populus RhizosphereMATVKETKEKLYREAKRLNIKGRSKMNKGQLKAALARRGR*
Ga0105245_1047635913300009098Miscanthus RhizosphereKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRT*
Ga0105243_1178077313300009148Miscanthus RhizosphereMPMGQERTKQQLYSQAKRLDIKGRSKMNKGQLKAAVARRGH*
Ga0111538_1035511323300009156Populus RhizosphereMPTTREKSKEQLYREAKRLGIKGRSKMNKGQLKSAVNRRSG*
Ga0111538_1240540823300009156Populus RhizosphereKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0075423_1264814023300009162Populus RhizosphereRTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0105241_1190655113300009174Corn RhizosphereMPLGNERTKEQLYWQAKSLGIRGRSKMNKGQLKAALARKGH*
Ga0105242_1115487813300009176Miscanthus RhizosphereMPMGKERTKEELYREAKRLNIRGRSKMNKGALKAALARRGQ*
Ga0126380_1224614613300010043Tropical Forest SoilMAMGKERTKEQLYRAAKRLNIKGRSKMNKGQLKAAVA
Ga0126382_1041551613300010047Tropical Forest SoilMPTELTKEKLYREAKRLGIKGRSKMSKSQLKSAIARRRQF*
Ga0126382_1184144713300010047Tropical Forest SoilVCVVSMDHERTKEQRYREAKRLKIKGRSKMNKGQLKAAVQRRGH*
Ga0126373_1206473013300010048Tropical Forest SoilMPISREMTKEQLYREAKRLHVKGRSKMTKSQLKSAVARHRHF*
Ga0126321_150555623300010145SoilLEGGERMPTTSGTTKEQLYKEAKRLGIKGRSKMRKGALKAAIERRRGH*
Ga0126370_1015933133300010358Tropical Forest SoilMAIGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAAITRRGH*
Ga0126370_1066968513300010358Tropical Forest SoilRRDQTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHH*
Ga0126372_1011487423300010360Tropical Forest SoilMKGVYMPQGTERTKEQLLREAKRLNIKGRSKMNKGALKAAVDRRK*
Ga0126378_1220871823300010361Tropical Forest SoilMPITRELTKEQLYREAKRLRIKGRSKMSKTQLKAAVSRHRF*
Ga0126377_1116588723300010362Tropical Forest SoilMPMETKEQLYREAKRLRIKGRSKMNKGQLKAAISRLR*
Ga0126377_1144739523300010362Tropical Forest SoilMPMETKEQLYREAKRLRIKGRSKMNKGQLKAAISRGR*
Ga0126379_1021021413300010366Tropical Forest SoilMPISHEPTKEQLYRQAKRLKVKGRSKMNKSQLKSVVARRSH*
Ga0126379_1023267133300010366Tropical Forest SoilMPMIGRDLTKEQLYHQAKRLGIKGRSKMSKSQLKAAVGRHHR*
Ga0126379_1043409413300010366Tropical Forest SoilMPIGRRDLTKEQLYHQAKRLGIRGRSKMSKSQLKAAVGRHH*
Ga0126379_1056587723300010366Tropical Forest SoilMGQEQTKAKLYQHAKRLNIKGRSKMNKGQLKAALARKGH*
Ga0134125_1212915113300010371Terrestrial SoilMPIGHERTKEQLYREAKRLGVKGRSKMNKGQLKAAL
Ga0134128_1150873413300010373Terrestrial SoilMAQGKERTKEQLLREAKRLGIKGRSKMNKGALRAAVDRRS*
Ga0105239_1015818933300010375Corn RhizosphereRQSKGGRFMAQERTKEQLYRQAKSAGIKGRSKMNKGQLKAALARKGY*
Ga0105239_1107273213300010375Corn RhizosphereMAQGEERTKEQLLREAKRLGIKGRSKMNKGALKAAVDRRS*
Ga0126381_10118606823300010376Tropical Forest SoilMPTIGREPTKEQLYRQAKRLGIRGRSKMSKSQLKAAVGRHH*
Ga0126381_10202597223300010376Tropical Forest SoilMPIDRRDLTKEQLYRQAKRLGIRGRSKMSKNQLKAAVGRHH*
Ga0126381_10225651513300010376Tropical Forest SoilMAISREMTKEQLYREAKRLHVKGRSKMTKSQLKSAVARHRHF*
Ga0126381_10250911123300010376Tropical Forest SoilMAIGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALTRRGH*
Ga0126381_10341664323300010376Tropical Forest SoilMAFSRDVTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHH
Ga0134124_1260708623300010397Terrestrial SoilHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALTRRGH*
Ga0126383_1025980333300010398Tropical Forest SoilMRMSVTSDLTKEQLYRQAKRLGIKGRSKMSKAQLKSALSRHGWRS*
Ga0126383_1329724023300010398Tropical Forest SoilMPTTEPTKEKLYREARRLHIKGRSKMNKTQLKSAIARHRY*
Ga0134127_1199098813300010399Terrestrial SoilSAIEEGGVVMPLSHERTKEQLYRQAKSLGIRGRSKMNTGQLKAALARKGH*
Ga0137776_101842323300010937SedimentMTMGHERTKEQLYNQAKRFGIKGRSKMNKGQLKAALARRGH*
Ga0137383_1042852723300012199Vadose Zone SoilMAISRDLTKEQLYHQAKRLGIRGRSKMSKSQLKMAVGRHHR*
Ga0137374_1062534313300012204Vadose Zone SoilMATRERTKEQLYNHAKRLGVKGRSKMNKGQLKAALARRGH*
Ga0137380_1132699713300012206Vadose Zone SoilMPMIDRELTKEQLYRQAKRLGIKGRSKMSKSQLKSAVGRHHR*
Ga0137379_1090056623300012209Vadose Zone SoilMPTERTKEQLYREAKRLGIKGRSRMNKGQLKAALTRRGH*
Ga0137378_1098706823300012210Vadose Zone SoilMPISRDVTKEQLYRQAKRLGIKGRSKMSKSQLKSAVGRHHH*
Ga0137377_1078433413300012211Vadose Zone SoilTMPIGHERTKEQLYREAKRLRIKGRSRMNKGQLKAALTRHGH*
Ga0137371_1117183313300012356Vadose Zone SoilMPTERTKEQLYREAKRLGIKGRSRMNKGQLKAALTRRTQ*
Ga0137368_1048120333300012358Vadose Zone SoilMASRERTKEQLYSQAKRFGVKGRSKMNKGQLKAALARRGH*
Ga0137385_1119104713300012359Vadose Zone SoilGNSPKGGETMPIGHERTKEQLYREAKRLRIKGRSRMNKGQLKSALTRHGH*
Ga0150984_11187699713300012469Avena Fatua RhizosphereEGGFAMPIETKEQLYREARRLGIKGRSKMNKGQLKAALSRRRSM*
Ga0150984_12332747623300012469Avena Fatua RhizosphereERTKEQLYREAKRLGIPGRSKMNKGALKAAVERRR*
Ga0157304_102129223300012882SoilMPQGKERTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0157285_1001678823300012897SoilMPQGKDRTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0157293_1011431513300012898SoilMAQGKERTKEQHLNEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0157299_1012933613300012899SoilMTQGKERTKEELLREAKKLGIKGRSKMNKGALKAAVDRRR*
Ga0157296_1002167213300012905SoilGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERRR*
Ga0157310_1028206023300012916SoilMQQGKERTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0164241_1017991523300012943SoilMPTGHERTKEELYRQAKRLNIKGRSKMNKGQLKAALA
Ga0164303_1054237623300012957SoilSANRRGSFKPLGNERTKEQLYRQAKSLGIRGRSKMNKGQLKAALARKGH*
Ga0164302_1160367623300012961SoilMTMGKERTKEELYSQAKRLGVKGRSKMNKGQLKAALARQGH*
Ga0126369_1050727423300012971Tropical Forest SoilMGQEQTNAKLYQHAKRLNIKGRSKMNKGQLKAALARKGH*
Ga0126369_1098140413300012971Tropical Forest SoilMGHERTKEQLYNQAKRLDIKGRSKMNKGQLKAALARRGH*
Ga0126369_1101766113300012971Tropical Forest SoilMPTGHERTKEQLYSQAKRLGIKGRSKMNKGQLKAALTRRGH*
Ga0126369_1336091023300012971Tropical Forest SoilMGHERTKEELYRQAKRLGIKGRSKMNKGQLKAALSRRGH*
Ga0164304_1172400623300012986SoilMTTGHERTKEQLYRQAKRLGIKGRSKMNKGQLKAALSRRGH*
Ga0157307_100323353300013096SoilMPQGKERTKEQLLKEAKRLGIKGHSRMNKGALKAAVDRRR*
Ga0157369_1014109023300013105Corn RhizosphereMPMGQERTKEQLYNQAKRLGVKGRSKMNKGQLKAALSRRGH*
Ga0163162_1030156843300013306Switchgrass RhizosphereMAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0157372_1239876013300013307Corn RhizosphereRGSFMPLGNERTKEQLYRQAKSLGIRGRSKMNKGQLKAALARKGH*
Ga0120158_1039059323300013772PermafrostNNRREALMAQGKERTKEQLLREARRLNIPGRSKMTKGALKAAVDRRK*
Ga0173478_1010972413300015201SoilQGKERTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR*
Ga0132258_10121579133300015371Arabidopsis RhizosphereMIVREPTKEQLYRQAKRLDIKGRSKMNKGQLKAAIGRHHR*
Ga0132258_1015228863300015371Arabidopsis RhizosphereMPMGKERTKEELYREAKRLDIKGRSKMTKGALKAALARRGR*
Ga0132258_1030025353300015371Arabidopsis RhizosphereMPMETKEQLYREAKRLGIKGRSRMNKGQLKAAVSRRRGG*
Ga0132258_1240011713300015371Arabidopsis RhizosphereMAEGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERRR*
Ga0132256_10141807533300015372Arabidopsis RhizosphereMAQGKETTKDELLREAKRLGIKGRSKMNKGALKAAVERRR*
Ga0132255_10082907223300015374Arabidopsis RhizosphereMAQGKERTKEQLMRQAKKLGIKGRSKMNKGALKAAVDRRS*
Ga0184605_1049179813300018027Groundwater SedimentVAQVRERSKEQLYREAKRLGVKGRSKMNKGQLKAAVNRRSS
Ga0184624_1043056113300018073Groundwater SedimentMPTGQERTKEELYQQAKRLNIKGRSKMNKGALKAALARRGL
Ga0173481_1000089683300019356SoilMPQGKDRTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR
Ga0173481_1000883833300019356SoilMAQGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERRR
Ga0173481_1000926363300019356SoilMPQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR
Ga0173481_1088040523300019356SoilMPTTGRETKEQLYRQAKRLGIKGRSKMNKGALKAAVGRHTHR
Ga0173482_1002651533300019361SoilMPQGKERTKEQLLNEAKRLGIKGRSRMNKGALKAAVDRRR
Ga0173482_1036426813300019361SoilMTMGKERTREELYREAKRLNIKGRSKMNKRQLLAAVNRKK
Ga0173482_1063537023300019361SoilMPTGQERTKEELYQQAKRLNIKGRSKMNKGALKAALARRGH
Ga0173479_1060640123300019362SoilMATGHERTKEQLYREAKRLGVKGRSKMNKGQLKAALMRRGH
Ga0206356_1157534523300020070Corn, Switchgrass And Miscanthus RhizosphereMPMGQERTKEQLYNQAKRLGVKGRSKMNKGQLKAALSRRGH
Ga0206355_119386723300020076Corn, Switchgrass And Miscanthus RhizosphereGGAMPMGKERTKEQLYSEAKRLDIKGRSKMNKGALKAALARRGH
Ga0206352_1009244213300020078Corn, Switchgrass And Miscanthus RhizosphereMPMGKERTKEQLYSEAKRLDIKGRSKMNKGALKAALARRGH
Ga0182009_1004617223300021445SoilMPTTNRETKEQLYRQAKRLGVKGRSKMNKGALKAAIARRTGS
Ga0182009_1076528313300021445SoilMPVSHGPTKEQLLREAKRLNIKGRSKMNKGALQAAVNRRK
Ga0126371_1017789333300021560Tropical Forest SoilMAIGHERTKEQLYRQAQRLGIKGRSKMNKGQLKAALTRRGH
Ga0126371_1076679033300021560Tropical Forest SoilMPIGRRDLTKEQLYRQAKRLGIRGRSKMSKSQLKAAVGRHH
Ga0126371_1127934233300021560Tropical Forest SoilMPIGRDLTKEQLYRQAKRLGIKGRSKMSKSQLKAAVGRHH
Ga0126371_1143890623300021560Tropical Forest SoilMAMGKERTKEQLYNEAKRLKIKGRSKMNKGALKAALARRGH
Ga0126371_1362876023300021560Tropical Forest SoilMAISREMTKEQLYREAKRLHVKGRSKMSKSQLKSAVARHRNL
Ga0222625_122657213300022195Groundwater SedimentMTMGHERTKEQLYRQAKSLDIKGRSKMNKGQLKAALARKGH
Ga0224712_1030288813300022467Corn, Switchgrass And Miscanthus RhizosphereERRQQMPTTGRETKEQLYRQAKRLNIKGRSKMNKGALKAAIGRHR
Ga0224712_1064578023300022467Corn, Switchgrass And Miscanthus RhizosphereRKEANMPIGRELTKEQLYRQAKRLGIKGRSKMSKTQLKMAVGRHHR
Ga0247747_100337613300022737SoilMAQGKERTKDELLREAKRLGIKGRSKMNKGALKAAVERR
Ga0247787_104910913300022893SoilMAQGKERTKEQLLREAKRLGIKGRSKMNKGALKAAVERRR
Ga0247791_104228913300023062SoilKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR
Ga0247671_102067523300024284SoilCRMTQGKERTKEQLLRQAKKLGIKGRSKMNKGALKAAVDRRS
Ga0207692_1009808313300025898Corn, Switchgrass And Miscanthus RhizosphereTQREAEQLYREAKRLGVKGRSKMNKGQLKAALTRRGH
Ga0207642_1004269813300025899Miscanthus RhizosphereMAQGKERTKEQLLREAKRLGIKGRSKMNKGALKAAVDRRS
Ga0207688_1008680443300025901Corn, Switchgrass And Miscanthus RhizosphereMAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAA
Ga0207680_1102003813300025903Switchgrass RhizosphereMAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRS
Ga0207707_1007486633300025912Corn RhizosphereMPIGRELTKEQLYRQAKRLGIKGRSKMSKTQLKMAVGRHHR
Ga0207671_1078545023300025914Corn RhizosphereMPMGQERTKQQLYSQAKRLDIKGRSKMNKGQLKAAVARRGH
Ga0207663_1142822913300025916Corn, Switchgrass And Miscanthus RhizosphereMPIETKEQLYREARRLGIKGRSKMNKGQLKAALSRRRSS
Ga0207662_1063502613300025918Switchgrass RhizosphereMAQGKERTKEQLLREAKRLGIKGRSRMNKGALKAAVDRRS
Ga0207687_1058636113300025927Miscanthus RhizosphereMPLSHERTKEQLYRQAKSLGIKGRSKMSKGQLKAALARKGH
Ga0207700_1060067923300025928Corn, Switchgrass And Miscanthus RhizosphereMPIGHERTKAQLYREAKRLGVKGRSKMNKGQLKAALTRRGH
Ga0207664_1088187023300025929Agricultural SoilMPIGHERTKEQLYREAKRLRIKGRSKMNKGQLKAALTRHGH
Ga0207701_1144349823300025930Corn, Switchgrass And Miscanthus RhizosphereMAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRT
Ga0207689_1057673713300025942Miscanthus RhizosphereIDRRGKGWRMAQGEERTKGQLLREAKRLGIKGRSKMNKGALKAAVDRRS
Ga0207712_1099218823300025961Switchgrass RhizosphereQERTKEQLYRQAKSAGIKGRSKMNKGQLKAALARKGY
Ga0207675_10145814113300026118Switchgrass RhizosphereMAQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDRRR
Ga0209577_1042232913300026552SoilMIGREPTKEQLYHKAKRLGIKGRSKMSKNQLKAAVGRHR
Ga0207473_10436323300026752SoilMAQGKERTKDELLREAKRLGIKGRSKMNKGALKAAVDRRR
Ga0207502_10713613300026828SoilMPQGKERTKEQLLKEAKRLGIKGRSRMNKGALKAAVDR
Ga0207503_101422713300026861SoilMPTTGRETKEQLYRQAKRLGIKGRSKMNKGQLKAAVNRRGR
Ga0209811_1005206433300027821Surface SoilMTQGKERTKEELYREAKRLNITGRSKMNKGALKAALARRGH
Ga0209166_1035323913300027857Surface SoilMTMGQERTKEQLYNQAKRLGVKGRSKMNKGQLKAALQRRGH
Ga0209814_1018166313300027873Populus RhizosphereMPQGKERTKEQLLKEAKRLGIQGRSKMNKGALKAAVDRRR
Ga0209486_1104271423300027886Agricultural SoilMPTTTRFTKEQLYREAKRLGIKGRSKMNKGALKAAVERRRGH
Ga0207428_1017827633300027907Populus RhizosphereMPTTRDKTKEQWYRQAKRLGIKGRSKMNKGQLKAAVNRRSS
Ga0207428_1017962133300027907Populus RhizosphereMATVKETKEKLYREAKRLNIKGRSKMNKGQLKAALARRGR
Ga0247750_103891213300027992SoilQSKGGRFMAQERTKEQLYRQAKSAGIKGRSKMNKGQLKAALARKGY
Ga0307317_1009807223300028720SoilMANNRREALMAQGKERTKEQLLREARRLNIAGRSKMTKGALKAAVDRRK
Ga0307302_1063965113300028814SoilMPTGQERTKEELYQQAKRLNIKGRSKMNKGALKAA
Ga0307277_1054230723300028881SoilMAQGKERTKEQLLREARRLNIPGRSKMTKGALKAAVDRRK
Ga0307304_1011675813300028885SoilMAQGKERTKEQLLREARRLNIAGRSKMTKGALKAAVDRRK
Ga0308189_1024370623300031058SoilARVGRRTANNRREALMAQGKERTKEQLLREARRLNIPGRSKMTKGALKAAVDRRK
Ga0308189_1051329323300031058SoilANNRREALMAQGKERTKEQLLREARRLNIAGRSKMTKGALKAAVDRRK
Ga0308201_1002496333300031091SoilTMGHERTKEQLYRQAKSLDIKGRSKMNKGQLKAALARKGH
Ga0308204_1005166923300031092SoilISMPTGQERTKEELYQQAKRLNIKGRSKMNKGALKAALARRGH
Ga0318534_1010688223300031544SoilMPTTEPTKEKLYREARRLHIKGRSKMNKTQLKSAIARHRY
Ga0310887_1114464113300031547SoilMTQGKERTKEQLLREAKKLGIKGRSKMNKGALKAAVDRRR
Ga0308175_10030245233300031938SoilEGRHQMPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAAIAPHR
Ga0308175_10037763813300031938SoilWRMAQGKERTKEQLLREAKKLGIKGRSKMNKGALKAAVDRRS
Ga0308175_10090357423300031938SoilRHQMPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAAIARRTGR
Ga0308175_10137525723300031938SoilMPMTGRETKEQLYRKAKRLNIKGRSKMNKGALKAAIGRHR
Ga0308175_10158737813300031938SoilMPIGHERTKEQLYREAKRFGIKGRSKMNKGQLKAALSKRGH
Ga0308175_10238026813300031938SoilMPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAA
Ga0306926_1221395923300031954SoilMATGHERTNEQLYRQAQRLGNKGRSKMNKGQLKVALTRRGH
Ga0308176_1026235823300031996SoilMPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAAIAPHR
Ga0308176_1148873113300031996SoilMPTTNRETKEQLYRQAKRLGVRGRSKMNKGALKAAIA
Ga0318563_1063756313300032009SoilMPTIGRELTKEQLYRQARRLGIKGRSKMSKSQLKSAVGRHHR
Ga0306920_10003671443300032261SoilMPTEITKEQLYREARRLRIRGRSKMTKSQLRAAISRQRGM
Ga0247830_1025397423300033551SoilMPMETKEQLYREAKRLGIKGRSRMNKGQLKAAVSRRRGG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.