NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F017406

Metagenome / Metatranscriptome Family F017406

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F017406
Family Type Metagenome / Metatranscriptome
Number of Sequences 241
Average Sequence Length 42 residues
Representative Sequence DSPEEGFEFLRDGLTKYHLGPEPKHKGEQVPEIAKTNP
Number of Associated Samples 208
Number of Associated Scaffolds 241

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.41 %
% of genes near scaffold ends (potentially truncated) 99.17 %
% of genes from short scaffolds (< 2000 bps) 92.53 %
Associated GOLD sequencing projects 194
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.266 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(12.033 % of family members)
Environment Ontology (ENVO) Unclassified
(23.651 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.378 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.79%    β-sheet: 0.00%    Coil/Unstructured: 71.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 241 Family Scaffolds
PF02581TMP-TENI 70.54
PF03781FGE-sulfatase 2.90
PF13411MerR_1 2.49
PF13376OmdA 1.66
PF01121CoaE 0.83
PF064393keto-disac_hyd 0.41
PF13365Trypsin_2 0.41
PF01425Amidase 0.41
PF00575S1 0.41
PF13231PMT_2 0.41
PF01432Peptidase_M3 0.41
PF12681Glyoxalase_2 0.41
PF02517Rce1-like 0.41
PF04916Phospholip_B 0.41
PF03328HpcH_HpaI 0.41
PF07884VKOR 0.41
PF00128Alpha-amylase 0.41
PF01740STAS 0.41
PF01435Peptidase_M48 0.41
PF13620CarboxypepD_reg 0.41
PF00903Glyoxalase 0.41
PF01401Peptidase_M2 0.41
PF02545Maf 0.41
PF09992NAGPA 0.41
PF00196GerE 0.41
PF00106adh_short 0.41

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 241 Family Scaffolds
COG0352Thiamine monophosphate synthaseCoenzyme transport and metabolism [H] 70.54
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 2.90
COG0237Dephospho-CoA kinaseCoenzyme transport and metabolism [H] 0.83
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.41
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.41
COG4243Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formationGeneral function prediction only [R] 0.41
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 0.41
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 0.41
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 0.41
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.41
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.41
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.41
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.41
COG04247-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamilySecondary metabolites biosynthesis, transport and catabolism [Q] 0.41
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.41
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 0.41
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.41


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.27 %
UnclassifiedrootN/A3.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100080810All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3018Open in IMG/M
3300004080|Ga0062385_10650828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter673Open in IMG/M
3300004082|Ga0062384_101082555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter577Open in IMG/M
3300004092|Ga0062389_103249599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae609Open in IMG/M
3300004156|Ga0062589_100121636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1721Open in IMG/M
3300004479|Ga0062595_102649003All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300005171|Ga0066677_10305911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter909Open in IMG/M
3300005339|Ga0070660_100863008All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300005355|Ga0070671_101084935All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter703Open in IMG/M
3300005367|Ga0070667_101984602All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae548Open in IMG/M
3300005435|Ga0070714_101653844All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300005439|Ga0070711_101371540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter615Open in IMG/M
3300005468|Ga0070707_100164351All Organisms → cellular organisms → Bacteria2163Open in IMG/M
3300005526|Ga0073909_10565955All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter557Open in IMG/M
3300005529|Ga0070741_11465488All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005534|Ga0070735_10519017All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300005537|Ga0070730_10931078All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter544Open in IMG/M
3300005538|Ga0070731_10237239All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1210Open in IMG/M
3300005541|Ga0070733_10194793All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1324Open in IMG/M
3300005541|Ga0070733_10248925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1168Open in IMG/M
3300005545|Ga0070695_100225495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1352Open in IMG/M
3300005547|Ga0070693_100137784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1533Open in IMG/M
3300005569|Ga0066705_10945236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter511Open in IMG/M
3300005591|Ga0070761_10140085All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1413Open in IMG/M
3300005598|Ga0066706_11193201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae578Open in IMG/M
3300005602|Ga0070762_10635394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter711Open in IMG/M
3300005712|Ga0070764_10113078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1462Open in IMG/M
3300005764|Ga0066903_104896909All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300005764|Ga0066903_107172310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae577Open in IMG/M
3300005764|Ga0066903_108726669All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300005874|Ga0075288_1004031All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1866Open in IMG/M
3300005895|Ga0075277_1078039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter543Open in IMG/M
3300005921|Ga0070766_10796027All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005994|Ga0066789_10179147All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter896Open in IMG/M
3300006028|Ga0070717_10552825All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300006034|Ga0066656_10179021All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1340Open in IMG/M
3300006050|Ga0075028_100873690All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300006052|Ga0075029_101132493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae544Open in IMG/M
3300006086|Ga0075019_10140721All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300006163|Ga0070715_10796070All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300006172|Ga0075018_10817165All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300006173|Ga0070716_100423234All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae964Open in IMG/M
3300006175|Ga0070712_100683152All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae874Open in IMG/M
3300006175|Ga0070712_101208338All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300006800|Ga0066660_11014589All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae665Open in IMG/M
3300006800|Ga0066660_11116010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium624Open in IMG/M
3300006806|Ga0079220_10724238All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae736Open in IMG/M
3300006904|Ga0075424_100445251All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1382Open in IMG/M
3300009038|Ga0099829_11267926All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300009089|Ga0099828_11302969All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300009090|Ga0099827_10728465All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300009090|Ga0099827_11014974All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300009090|Ga0099827_11630828All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300009093|Ga0105240_10855109All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300009137|Ga0066709_104074504All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300009174|Ga0105241_10283768All Organisms → cellular organisms → Bacteria → Acidobacteria1415Open in IMG/M
3300009176|Ga0105242_11377579All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300009521|Ga0116222_1247527All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300009523|Ga0116221_1175931All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300009545|Ga0105237_11396973All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300009624|Ga0116105_1001767All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4854Open in IMG/M
3300009646|Ga0116132_1286277Not Available503Open in IMG/M
3300009665|Ga0116135_1152088All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300009700|Ga0116217_10949682All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300010358|Ga0126370_11674281All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300010366|Ga0126379_10381424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1451Open in IMG/M
3300010366|Ga0126379_12911409All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300010376|Ga0126381_101768800All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300010376|Ga0126381_102703176All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300010376|Ga0126381_102910934All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300010379|Ga0136449_102238922Not Available795Open in IMG/M
3300010398|Ga0126383_13544469All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300010403|Ga0134123_10769906All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300010876|Ga0126361_10972456All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300010937|Ga0137776_1330402All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300011269|Ga0137392_10345546All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1232Open in IMG/M
3300011270|Ga0137391_11398942All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300011271|Ga0137393_10337190All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1287Open in IMG/M
3300012096|Ga0137389_10475183All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1071Open in IMG/M
3300012199|Ga0137383_10726034All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300012207|Ga0137381_10709027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis874Open in IMG/M
3300012210|Ga0137378_11862431All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300012349|Ga0137387_10636507All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300012357|Ga0137384_10664417All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300012359|Ga0137385_11227073All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300012362|Ga0137361_10439419All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300012362|Ga0137361_11791322All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300012511|Ga0157332_1052272All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300012532|Ga0137373_10179087All Organisms → cellular organisms → Bacteria1764Open in IMG/M
3300012683|Ga0137398_10134583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1591Open in IMG/M
3300012917|Ga0137395_11095839All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300012918|Ga0137396_11158060All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300012923|Ga0137359_10153396All Organisms → cellular organisms → Bacteria → Acidobacteria2054Open in IMG/M
3300012929|Ga0137404_10564885All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300012930|Ga0137407_10331838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1397Open in IMG/M
3300012964|Ga0153916_10905809Not Available962Open in IMG/M
3300012971|Ga0126369_12546515All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300012972|Ga0134077_10105520All Organisms → cellular organisms → Bacteria → Acidobacteria1094Open in IMG/M
3300012989|Ga0164305_10410341All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300013100|Ga0157373_10257571All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300014159|Ga0181530_10593009Not Available543Open in IMG/M
3300014164|Ga0181532_10170210All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300014489|Ga0182018_10478195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae660Open in IMG/M
3300014501|Ga0182024_11872121All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300014654|Ga0181525_10025545All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3593Open in IMG/M
3300015241|Ga0137418_11026130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300015356|Ga0134073_10289813All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300017822|Ga0187802_10112647All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300017936|Ga0187821_10056545All Organisms → cellular organisms → Bacteria1411Open in IMG/M
3300017943|Ga0187819_10141301All Organisms → cellular organisms → Bacteria1435Open in IMG/M
3300017948|Ga0187847_10511181All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300017961|Ga0187778_10532424All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300017961|Ga0187778_11339745All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300017970|Ga0187783_10015935All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5552Open in IMG/M
3300017970|Ga0187783_10558777Not Available829Open in IMG/M
3300017972|Ga0187781_10408640All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300018019|Ga0187874_10434312All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300018035|Ga0187875_10562054All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300018037|Ga0187883_10756369All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300018042|Ga0187871_10860332All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300018042|Ga0187871_10875339All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300018043|Ga0187887_10101830All Organisms → cellular organisms → Bacteria1731Open in IMG/M
3300018058|Ga0187766_10899342All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300018085|Ga0187772_10722234All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300018085|Ga0187772_11142942All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300018088|Ga0187771_11747357All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes528Open in IMG/M
3300018468|Ga0066662_10073759All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2299Open in IMG/M
3300019887|Ga0193729_1144373All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300020006|Ga0193735_1170819All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae544Open in IMG/M
3300020580|Ga0210403_10431051All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300020580|Ga0210403_11359286All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300020580|Ga0210403_11455188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis517Open in IMG/M
3300020581|Ga0210399_10511005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae998Open in IMG/M
3300020582|Ga0210395_11391276All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300020583|Ga0210401_10702424All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium872Open in IMG/M
3300021088|Ga0210404_10616082All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300021168|Ga0210406_11006554All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300021168|Ga0210406_11139757All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300021178|Ga0210408_11374024All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300021180|Ga0210396_10858589All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300021401|Ga0210393_11647541All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300021405|Ga0210387_11583097All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300021407|Ga0210383_11129477All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300021420|Ga0210394_10643672All Organisms → cellular organisms → Bacteria → Acidobacteria931Open in IMG/M
3300021432|Ga0210384_10973524All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300021474|Ga0210390_10665653All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300021474|Ga0210390_10994121All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300021477|Ga0210398_11000302All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300021477|Ga0210398_11005457All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300021478|Ga0210402_11596312All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300021560|Ga0126371_12688895All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300021560|Ga0126371_12753688All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300022557|Ga0212123_10600146All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300022724|Ga0242665_10361377All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300023250|Ga0224544_1029511All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300024225|Ga0224572_1004945All Organisms → cellular organisms → Bacteria2354Open in IMG/M
3300024330|Ga0137417_1466456All Organisms → cellular organisms → Bacteria5948Open in IMG/M
3300025406|Ga0208035_1019419All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300025627|Ga0208220_1169503All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300025906|Ga0207699_10541241All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300025910|Ga0207684_10109543All Organisms → cellular organisms → Bacteria → Acidobacteria2364Open in IMG/M
3300025914|Ga0207671_11147081All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300025922|Ga0207646_10305683All Organisms → cellular organisms → Bacteria → Acidobacteria1437Open in IMG/M
3300025924|Ga0207694_10338054All Organisms → cellular organisms → Bacteria → Acidobacteria1245Open in IMG/M
3300025929|Ga0207664_10275384All Organisms → cellular organisms → Bacteria → Acidobacteria1475Open in IMG/M
3300025939|Ga0207665_10606196All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300025944|Ga0207661_10129695All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2158Open in IMG/M
3300025949|Ga0207667_10090526All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3162Open in IMG/M
3300026023|Ga0207677_11354967All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300026078|Ga0207702_11145329All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300026310|Ga0209239_1069143All Organisms → cellular organisms → Bacteria1546Open in IMG/M
3300026322|Ga0209687_1246877All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300026330|Ga0209473_1037874All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2153Open in IMG/M
3300026548|Ga0209161_10308679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300026548|Ga0209161_10433887All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300027067|Ga0208602_1024064All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis606Open in IMG/M
3300027071|Ga0209214_1031097All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae705Open in IMG/M
3300027432|Ga0209421_1008796All Organisms → cellular organisms → Bacteria1898Open in IMG/M
3300027505|Ga0209218_1006257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1942Open in IMG/M
3300027565|Ga0209219_1166849All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300027570|Ga0208043_1144085All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300027696|Ga0208696_1050609All Organisms → cellular organisms → Bacteria1454Open in IMG/M
3300027725|Ga0209178_1263044All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300027737|Ga0209038_10203550All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300027738|Ga0208989_10248324All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300027768|Ga0209772_10298435All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300027812|Ga0209656_10259758All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300027842|Ga0209580_10063585All Organisms → cellular organisms → Bacteria1741Open in IMG/M
3300027842|Ga0209580_10469974All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300027867|Ga0209167_10068392All Organisms → cellular organisms → Bacteria1772Open in IMG/M
3300027879|Ga0209169_10192983All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300027882|Ga0209590_10104768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1696Open in IMG/M
3300027882|Ga0209590_10502482All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300027889|Ga0209380_10451105Not Available752Open in IMG/M
3300027889|Ga0209380_10545991All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300027895|Ga0209624_10836638Not Available603Open in IMG/M
3300027895|Ga0209624_10897776All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300027898|Ga0209067_10070786All Organisms → cellular organisms → Bacteria1788Open in IMG/M
3300027911|Ga0209698_10632714All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300027911|Ga0209698_10650772All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300028536|Ga0137415_11376378All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300028906|Ga0308309_11651646All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300028906|Ga0308309_11667197All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300029882|Ga0311368_10686379All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300029913|Ga0311362_11055967All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300029914|Ga0311359_10226299All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300029999|Ga0311339_10014487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae12105Open in IMG/M
3300030047|Ga0302286_10651590All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300030617|Ga0311356_10576583All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300030617|Ga0311356_11308468Not Available663Open in IMG/M
3300030991|Ga0073994_10052621All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300030991|Ga0073994_12402893All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300031028|Ga0302180_10002876All Organisms → cellular organisms → Bacteria13281Open in IMG/M
3300031090|Ga0265760_10063772All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300031258|Ga0302318_10415383All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300031573|Ga0310915_10392351All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300031715|Ga0307476_10401166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1013Open in IMG/M
3300031718|Ga0307474_10572040All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300031740|Ga0307468_101835229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. YIM 10575Open in IMG/M
3300031954|Ga0306926_11164407All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300031962|Ga0307479_10491402All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1211Open in IMG/M
3300031962|Ga0307479_10548491All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300032001|Ga0306922_10778740All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300032051|Ga0318532_10268458All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300032174|Ga0307470_10037911All Organisms → cellular organisms → Bacteria2360Open in IMG/M
3300032180|Ga0307471_101946813All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300032205|Ga0307472_100488283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1058Open in IMG/M
3300032770|Ga0335085_10820823All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1021Open in IMG/M
3300032783|Ga0335079_10917027All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300032783|Ga0335079_11737901All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300032805|Ga0335078_10332830All Organisms → cellular organisms → Bacteria2025Open in IMG/M
3300032828|Ga0335080_10252025All Organisms → cellular organisms → Bacteria1928Open in IMG/M
3300032829|Ga0335070_10123114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2677Open in IMG/M
3300032893|Ga0335069_10961231All Organisms → cellular organisms → Bacteria → Acidobacteria951Open in IMG/M
3300033004|Ga0335084_10449038All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1326Open in IMG/M
3300033004|Ga0335084_12337691All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300033158|Ga0335077_11135214All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300033233|Ga0334722_10149683All Organisms → cellular organisms → Bacteria → Acidobacteria1748Open in IMG/M
3300033289|Ga0310914_10944526All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300033402|Ga0326728_10440148Not Available1090Open in IMG/M
3300033412|Ga0310810_10696637All Organisms → cellular organisms → Bacteria946Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.20%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.15%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.15%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.73%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.73%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.73%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.73%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.32%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.90%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.90%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.49%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.49%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.07%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.07%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.66%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.24%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.24%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.24%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.24%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.83%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.41%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.41%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.41%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.41%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.41%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.41%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.41%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.41%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.41%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.41%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.41%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.41%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.41%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.41%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.41%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.41%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.41%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.41%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005895Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025406Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027067Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF007 (SPAdes)EnvironmentalOpen in IMG/M
3300027071Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10008081013300002245Forest SoilAGTVSPQDIDQFKIIDSPDEAFEFLRDGLTKFHLGGAPTKQGEVMPEIAKTRP*
Ga0062385_1065082823300004080Bog Forest SoilFKFVDTPEDAFTFLRDGLTEYHLGGQPKKEKEQEVLPEIAKTRP*
Ga0062384_10108255523300004082Bog Forest SoilDAGTISAEDLELFKIVDSPDEGFEFLREGLTKYHLGGAPKREGEAMPEIAKTNP*
Ga0062389_10324959923300004092Bog Forest SoilIVDSPEEGFEFLRDGLTKYHLVQETKHKGESAERAPEIAKTNP*
Ga0062589_10012163643300004156SoilMVDTPEEGFEVLKQGLTKYHLGPDRPRRVGEVVPEIAKTNP*
Ga0062595_10264900313300004479SoilTVSPQDLDLIRVVDNPEEAFEFLRDGLIKYHLGAAPKKQGEVMPEIAKTRP*
Ga0066677_1030591113300005171SoilMVDSPEEGFEYLREGLTQYHLGGAPKSSGEGLPEIAKTRP*
Ga0070660_10086300823300005339Corn RhizosphereSPHDLDLFKVVDSPEEGFEYLRENLIKYHLTPQPKSPAQAVPEIAKTRP*
Ga0070671_10108493513300005355Switchgrass RhizosphereNASDLDLFHMADSPEAGFEYLRDGLTKYHLGPQPKAPEAVPEIAKTNP*
Ga0070667_10198460223300005367Switchgrass RhizosphereMVDTPEEGVDFLKQGLTKYHLGPERVRRVGEVVPEIAKTNP*
Ga0070714_10165384413300005435Agricultural SoilTVSPEDVDLFRIVNSPDEGFEFLRDGLTKYHLGSPPREGAPEIAKTRP*
Ga0070711_10137154023300005439Corn, Switchgrass And Miscanthus RhizosphereLFKVVDSPEEGFEYLRAGLTKYHLGPDHPRRAGEAVPEIAKTNP*
Ga0070707_10016435113300005468Corn, Switchgrass And Miscanthus RhizosphereDAGVISPQDLDLFKIADSPEESFEFLKAGLTKYHLGPPPKRAAEFAPEIAKTRP*
Ga0073909_1056595523300005526Surface SoilFKIVDNPQEAFEFLRAGLTKHHLGEAPKKKGDVMPEIAKTRP*
Ga0070741_1146548823300005529Surface SoilGFEFLKEGLTKYHLGPDRPRRVGEVVPEIAKTNP*
Ga0070735_1051901723300005534Surface SoilAFKFLTDGLTKYHLGGSPAKKKEDHEVTPEIAKTRP*
Ga0070730_1093107813300005537Surface SoilKIVDTPEEGFEFLRDGLTRYHLGPEQKSKGEALPEIAKTNP*
Ga0070731_1023723933300005538Surface SoilDPNEAFEYLREGLTKHHLGGTPKKQGDVMPDIAKTRP*
Ga0070733_1019479333300005541Surface SoilEDLDQFKILDSPDEAFEFLRDGLTKYHLGGTPKKQGEVLPEIAKTRP*
Ga0070733_1024892533300005541Surface SoilPGDLDQFKIVDSPDEAFEFLRDGLTKYHLGGTPKKHGEILPEIAKTRP*
Ga0070695_10022549513300005545Corn, Switchgrass And Miscanthus RhizosphereTMVDTPEEGFEVLKQGLTKYHLGPDRPRRVGEVVPEIAKTNP*
Ga0070693_10013778413300005547Corn, Switchgrass And Miscanthus RhizosphereISADDLDLFTIVDTPEEGMEFLKQALTKYHLGPERPRRLGEVVPEIAKTNP*
Ga0066705_1094523613300005569SoilKIVDSPEDAFAFLREGLTAYHLEQPKKPEVVPEIAKTRP*
Ga0070761_1014008533300005591SoilVDTPEDAFEFLRDGLTKYHLGGTPKKEGEALPEIAKTRP*
Ga0066706_1119320113300005598SoilSPVDLELFKMVDTPEEGFAYLKEGLTKYHLGPDRPRRVGEVVPEIAKTNP*
Ga0070762_1063539423300005602SoilIVDSPEEGFEFLRDGLTKYHLGPEPKHKGEPGERVPEIAKTNP*
Ga0070764_1011307813300005712SoilAGTVSPQDIDQFKIIDSPDEAFEFLRDGLTKFHLGGAPTKQGEVMPEIAKTRL*
Ga0066903_10489690913300005764Tropical Forest SoilSPEEGFEFLREGLTRYHLAPPQPRHPGERVPEIAKTNP*
Ga0066903_10717231023300005764Tropical Forest SoilAKDLDLFKLVNSPEEGFEFLRDGLTQYHLGGVKQKEGEVLPEIAKTRP*
Ga0066903_10872666923300005764Tropical Forest SoilVDSPEEGFEYLREGLIKHHLQRPPKHVGETVPEIAKTNP*
Ga0075288_100403133300005874Rice Paddy SoilEEAFEFLSDGLTKYHLGGTPKRQGEVLPEIAKTRP*
Ga0075277_107803923300005895Rice Paddy SoilLDLIKVVDNPEEAFEFLSDGLTKYHLGGTPKRQGEVLPEIAKTRP*
Ga0070766_1079602723300005921SoilEGFEFLRDGLTKYHLVQETKHKGEPAERVPEIAKTNP*
Ga0066789_1017914723300005994SoilDTPEDAFEYLRDGLTKYHLGGAPQKTGEALPEIAKTRP*
Ga0070717_1055282513300006028Corn, Switchgrass And Miscanthus RhizospherePQDLDLIKVVDNPEEAFESLRDGLTKFHLGPPPKKQAEVMPEIAKTRP*
Ga0066656_1017902113300006034SoilVDSPEEGFEYLRDGLTKYHLGPLQPKRVGEAVPEIAKTNP*
Ga0075028_10087369013300006050WatershedsIVDSPEEGFEFLKENLTKYHLGPQQPKRAGEAAMPEIAKTRP*
Ga0075029_10113249323300006052WatershedsAVSPEDLDQFKIIDSPEEAFEFLRDGLTTYHLGGTPKKQGEVLPDIAKTRP*
Ga0075019_1014072133300006086WatershedsFSFVDTPEEAFEQLKNGLTKHHLGGIKRHGETLPEIAKTRL*
Ga0070715_1079607013300006163Corn, Switchgrass And Miscanthus RhizosphereQEAFEFLRAGLTKHHLGEAPKKKGDVMPEIAKTRP*
Ga0075018_1081716523300006172WatershedsTVVDSPEEGFAYLRDGLTEHHLGGQPKAPAEGLPEIAKTRP*
Ga0070716_10042323413300006173Corn, Switchgrass And Miscanthus RhizosphereEGFEYLREGLTKYHLGPDRPRRAGEAVPEIAKTNP*
Ga0070712_10068315223300006175Corn, Switchgrass And Miscanthus RhizosphereKMADTPEEGFEYLKEGLTKYHLGPDRPRRVGEVSPEIAKTNP*
Ga0070712_10120833823300006175Corn, Switchgrass And Miscanthus RhizosphereEAFESLRDGLTKFHLGPPPKKQAEVMPEIAKTRP*
Ga0066660_1101458913300006800SoilDLGLFKIVDSPEEGYEYLREGLTKYHLDAERPRGAGEKAPEIAKTNP*
Ga0066660_1111601013300006800SoilEAFEFLRGGLTSYHLGDTPKKKGEVLPEIAKTRP*
Ga0079220_1072423823300006806Agricultural SoilEAMVETGVISPNDYKLFKMVDTPEEGFQYLKEGLTRYHLGPHRPEKAPEIAKTNP*
Ga0075424_10044525113300006904Populus RhizospherePDLELFKVVDTPEEGFEYLRAGLTKYHLGPDRPRRAGEVVPEIAKTNP*
Ga0099829_1126792623300009038Vadose Zone SoilDSPEEGFEYLRDGLTKYHLGSPQPKRVGEVVPEIAKTNP*
Ga0099828_1130296923300009089Vadose Zone SoilDSPEEGFEFLRDGLTKYHLGPQQPKAPEVMPEIAKTNP*
Ga0099827_1072846513300009090Vadose Zone SoilMVDSPEEGFEYLRNALTKYHLGPQPKHIGEAMPEIAKTNP*
Ga0099827_1101497423300009090Vadose Zone SoilRIVDSPEEGFEGLRQGLTRYHLDTERPRRAGEVAPEIAKTNP*
Ga0099827_1163082813300009090Vadose Zone SoilEEGFEFLRDGLTKYHLGPQQPKAPEAMPEIAKTNP*
Ga0105240_1085510923300009093Corn RhizosphereIVDNPEEGFEFLREGLIKYHMGPDRPKRVGEVVPEIAKTNP*
Ga0066709_10407450423300009137Grasslands SoilVLDLFKLVDSPEEGFEFLKAGLTKYHLGPDRPRRVGEVVPEIAKTNP*
Ga0105241_1028376833300009174Corn RhizosphereEEGVDFLKQGLTKYHLGPERVRRVGEVVPEIAKTNP*
Ga0105242_1137757923300009176Miscanthus RhizosphereDSPEEGFEVLKDGLTKYHLGPPKAAGEGVPEIAKTRP*
Ga0116222_124752723300009521Peatlands SoilAVSPQDLDQFKIVDSPDEAFEFLRDGLTKYHLGGTPKKEREVLPEIAKTRP*
Ga0116221_117593133300009523Peatlands SoilDSPEEGFEFLRDGLTKYHLGPEPKHKGEQVPEIAKTNP*
Ga0105237_1139697323300009545Corn RhizosphereGFEFLREGLIKYHMGPDRPKRVGEVVPEIAKTNP*
Ga0116105_100176713300009624PeatlandDTPEDAFTFLREGLTEYHLGGPPKKEKEQEVLPEIAKTRP*
Ga0116132_128627713300009646PeatlandSPEDAFTFLRDGLTEYHLGGPLPKKEKEQEVLPEIAKTRP*
Ga0116135_115208823300009665PeatlandFKFVDSPEDAFAFLRDGLTEYHLGGPKKEKEKEQEVEPEIAKTRP*
Ga0116217_1094968223300009700Peatlands SoilQFKIVDSPDEAFEFLRDGLTKYHLGGTPKKEREVLPEIAKTRP*
Ga0126370_1167428123300010358Tropical Forest SoilDSPEEGYEFLRDGLTKYHLEAPPPRRAGEVAPEIAKTNP*
Ga0126379_1038142413300010366Tropical Forest SoilEEGFAFLQDGLTKYHLGAERPRHVAEVVPEIAKTNP*
Ga0126379_1291140923300010366Tropical Forest SoilFKIVDSPEDGFEVLRDGLTKYHLGGVVKKEGEVVPDIAKTRP*
Ga0126381_10176880013300010376Tropical Forest SoilEEGFEFLKDGLTRYHLGPERTRRVGEVVPEIAKTNP*
Ga0126381_10270317613300010376Tropical Forest SoilLFKVVDTPEEGFEFLRAGLTQYHLGAERARRVGEVVPEIAKTNP*
Ga0126381_10291093413300010376Tropical Forest SoilISPEDLELFKMTDSPDEGFEFLREGLTKYHLGPQPKRAPEAVPEIAKTNP*
Ga0136449_10223892213300010379Peatlands SoilVLAISGKTSPSFQFKIVDSPEDAFEFLRDGLTKYHLGGTPKKEGEVLPEIAKTRP*
Ga0126383_1354446923300010398Tropical Forest SoilALDPDGTIAAADLALFKLVDSPDEGFEFLRDGLTKYHLAGIGKKEGEVMPDIARTRP*
Ga0134123_1076990623300010403Terrestrial SoilVDTPEEGVDFLKQGLTKYHLGPERVRRVGEVVPEIAKTNP*
Ga0126361_1097245613300010876Boreal Forest SoilFVDTPEDAFAFLRDGLTEYHLGGPPKKEKEREVLPEIAKTRP*
Ga0137776_133040233300010937SedimentAEDLQLFKIVDTPEEGFEYLKEGLTKYHLGPNRPHRVGEAVPEIAKTNP*
Ga0137392_1034554613300011269Vadose Zone SoilVDSPEEGFEFLREGLTQYHLGTERPRHVVEVVPEIAKTNP*
Ga0137391_1139894223300011270Vadose Zone SoilDSPEEGFEFLRDGLIKYHLAPQQVKRTGEAVPEIAKTNP*
Ga0137393_1033719033300011271Vadose Zone SoilPEEGFEFLREGLTQYHLGTERPRHVVEVVPEIAKTNP*
Ga0137389_1047518333300012096Vadose Zone SoilSPEEGFEFLRDGLTKYHLGPQQPKAPEVMPEIAKTNP*
Ga0137383_1072603413300012199Vadose Zone SoilSPEEGFEFLREGLTRYHLDTERPRRVGEVAPEIAKTNP*
Ga0137381_1070902723300012207Vadose Zone SoilLNQFKIVDTPEDAFEFLRDGLTKYHLGGTPKKEGEVLPEIAKTRP*
Ga0137378_1186243113300012210Vadose Zone SoilAGTVSPQDIDQFKIVDDPDEAFDFLRDGLIKYHLGGTPKKQGEVLPEIAKTRP*
Ga0137387_1063650713300012349Vadose Zone SoilVDSPEEGYEYLREGLTKYHLDAERPRGAGEKAPEIAKTNP*
Ga0137384_1066441723300012357Vadose Zone SoilIVDSPEEGYEYLREGLTKYHLDAERPRGAGEKAPEIAKTNP*
Ga0137385_1122707313300012359Vadose Zone SoilLFRFVDSPEEGFEALREGLIKYHLGAPRREAAPEIAKTL*
Ga0137361_1043941933300012362Vadose Zone SoilDLFRIVDSPEEGFEYLRDGLTKYHLGPLQPKRVGEVVPEIAKTNP*
Ga0137361_1179132213300012362Vadose Zone SoilSPEEGFEFLRDGLTKYHLGPRQPKAPEAMPEIAKTNP*
Ga0157332_105227223300012511SoilADLDLFTIVDTPEEGFDFLKQGLTKYHLGPDRPRRVGEVVPEIAKTNP*
Ga0137373_1017908753300012532Vadose Zone SoilGFEYLKEGLTKYHLGPDRPRRVGEVSPEIAKTNP*
Ga0137398_1013458313300012683Vadose Zone SoilDSPKEAFEFLRDGLTKYHLVPKPKAEQLPEIARTRL*
Ga0137395_1109583923300012917Vadose Zone SoilFTFLRDGLTEYHLGGPPKKQKEQEVLPEIAKTRP*
Ga0137396_1115806013300012918Vadose Zone SoilNLLKIVDSPEEGFEFLKENLTKYHLGPQQPKRTGEAAAPEIAKTRP*
Ga0137359_1015339643300012923Vadose Zone SoilEEGFEYLRDGLTKYHLGPLQPKRVGEAVPEIAKTNP*
Ga0137404_1056488513300012929Vadose Zone SoilVDSPEEGFEYLRDGLTKYHLGALQPKRVGEVVPEIAKTNP*
Ga0137407_1033183833300012930Vadose Zone SoilSPEEGFEFLRDGLMKYHLVPQQPKRTGEAVPEIAKTNP*
Ga0153916_1090580913300012964Freshwater WetlandsDLQLFQKVDSPEEGFEYLRENLSRYHLAPQPQPKQQEKAPEIARTRP*
Ga0126369_1254651513300012971Tropical Forest SoilDLDLFKIVDNPEEAFEFLRDGLSKYHLGATPKKQGEVTPEIAKTRP*
Ga0134077_1010552013300012972Grasslands SoilEGFEYLRDGLTKYHLGPLQPKRVGEAVPEIAKTNP*
Ga0164305_1041034123300012989SoilDTPEEGFEYLKQGLTEFHLGADRPRRSGETMPEIAKTNP*
Ga0157373_1025757133300013100Corn RhizosphereLDLIRVVDNPEEAFEFLRDGLIKYHLGAAPKKQGEVMPEIAKTRP*
Ga0181530_1059300923300014159BogVIDSPEEAFEYLRDGLTKHHRGPAPRKVGEIVPEIAKTRP*
Ga0181532_1017021033300014164BogSPEEGFEFLRDGLTKYHLVQETKHKGESAERVPEIAKTNP*
Ga0182018_1047819513300014489PalsaDLDLFKMADTPEEGFEFLREGLTKYHLVDPRRAAETVPEIAKTNP*
Ga0182024_1187212113300014501PermafrostLFKIVDSPEEGFEFLRDGLTKYHLGPEPKYKAETERAPEIAKTNP*
Ga0181525_1002554513300014654BogEEGFEYLRDSLTEHHLGPTPKRVGEAMPEIAKTNP*
Ga0137418_1102613013300015241Vadose Zone SoilGFEFLRDGLAKYHLVPQQPKRTGEVTPEIAKTNP*
Ga0134073_1028981323300015356Grasslands SoilGFVLAISAEDLELFKIVDTPVEGYEFLREGLTKYHLEERPRRVGEAVPEIAKTNP*
Ga0187802_1011264713300017822Freshwater SedimentSPEEGFEFLRDGLTKYHLGPEPRRKGEAMPEIAKTNP
Ga0187821_1005654513300017936Freshwater SedimentPEEGFEFLRDGLTQHHLGGVTRKEEGLPDIAKTRP
Ga0187819_1014130133300017943Freshwater SedimentIVDNPEEAFEFLRDGLTKYHLGDTPKKKGEVLPEIAKTRP
Ga0187847_1051118123300017948PeatlandFAFLRDGLTEYHLGGGQPKKEKEQEVEPEIAKTRP
Ga0187778_1053242423300017961Tropical PeatlandISPQDLHLFKMVDTPEQGFEFLREGLTKHHLAQEFKKVPEITKTNP
Ga0187778_1133974513300017961Tropical PeatlandIVDSPEEGFEFLRDGLTKYHLGPPPKRVGEVMPEIAKTNP
Ga0187783_1001593583300017970Tropical PeatlandSPEEGFEFLRDGLVRYHLRPDTERKAEAMPEIAKTNP
Ga0187783_1055877723300017970Tropical PeatlandVDSPEAAFEFLRDGLTKYHLGGTPKKEREVLPEIAKTRP
Ga0187781_1040864033300017972Tropical PeatlandTPEDAFAFLRDGLTEHHLGGTPKKQQEREVLPEIAKTRP
Ga0187874_1043431213300018019PeatlandTPEDAFTFLRDGLTEYHLGGPPRKEKEQEVLPEIAKTRP
Ga0187875_1056205423300018035PeatlandELFKIVDSPEEGFEFLRDGLTKYHLVQETKHKGESAERVPEIAKTNP
Ga0187883_1075636913300018037PeatlandDTPEDAFEFLRDGLTQYHLGGAPKKEGEALPEIAKTRP
Ga0187871_1086033213300018042PeatlandVDSPEEGFEFLRDGLTKYHLVQETKHKGESAERVPEIAKTNP
Ga0187871_1087533913300018042PeatlandDSPEEGFEFLRDGLTKYHLVQETKHKGESAERVPEIAKTNP
Ga0187887_1010183043300018043PeatlandFEFLRDGLTKYHLVQETKHKGESAERVPEIAKTNP
Ga0187766_1089934223300018058Tropical PeatlandDLELFKIVDNPREAFEFLRDGLTKYHLGGTPPKKVGDILPEIAKTRP
Ga0187772_1072223413300018085Tropical PeatlandPEEAFEFLRDGLTKHHLGGVPKKTGEMLPEIAKTRP
Ga0187772_1114294223300018085Tropical PeatlandVVDSPEEGFEFLRDGLTKYHLGPEPKRKGEAMPEIAKTNP
Ga0187771_1174735723300018088Tropical PeatlandDAFEFLRDGLTKYHLGGPAPKKVGEILPEIAKTRP
Ga0066662_1007375943300018468Grasslands SoilPQDLDLIKVVDNPEEAFESLRDGLTKFHLGPPPKKQGEVLPEIAKTRP
Ga0193729_114437323300019887SoilLDLFRMVDSPEEGFEFLRDGLVNYHLGPQQAKRPGEAMPEIAKTNP
Ga0193735_117081913300020006SoilGAISAEDLELFKIVDTPEEGYEFLREGLTKYHLEERPRRVGEALPEIAKTNP
Ga0210403_1043105123300020580SoilPEAAFEYLRDGLTKYHLGGTPKKEGEVLPEIAKTRP
Ga0210403_1135928623300020580SoilLELFKMVDSPEEGFEFLRDGLTQYHLGGVTKKEGEVLPDIAKTLP
Ga0210403_1145518823300020580SoilLFKIADNPEEAFEFLRGGLTSYHLGDTPKKKGEVLPEIAKTRP
Ga0210399_1051100513300020581SoilAEDLELFKIVDSPEEGFEFLRDGLTKYHLGPEPKHKGEQGERVPEIAKTNP
Ga0210395_1139127613300020582SoilELFKIVDSPEEGFEFLRDGLTKYHLVQETKHKGESTERVPEIAKTNP
Ga0210401_1070242423300020583SoilVDAGTIAAEDLDLFKIVDSPEDAFAFLREGLTAYHLDQPKKPEVVPEIAKTRP
Ga0210404_1061608213300021088SoilVDSPEEGFEFLRDGLTKYHLTPEPKHKGEPAERVPEIAKTNP
Ga0210406_1100655423300021168SoilMADSPEEGFEFLRDGLTKYHLGPQQPKAPEAMPEIAKTNP
Ga0210406_1113975723300021168SoilEDAFTFLRDGLTEYHLGGQPKKEKEQEVLPEIAKTRP
Ga0210408_1137402413300021178SoilFKLVDSPEEGFEVLRDGLTEYHLGGIAKKEGEVLPDIARTRP
Ga0210396_1085858913300021180SoilSPEEGFEFLRDGLTKYHLGPEPKHKGEQGERVPEIAKTNP
Ga0210393_1164754113300021401SoilEAFEFLRDGLTKYHLGGVVKKEKEGEVTPEIAKTRP
Ga0210387_1158309713300021405SoilKFVDTPEDAFTFLRDGLTEHHLGGQPKKEKEQEVLPEIAKTRP
Ga0210383_1112947713300021407SoilKIVDDPHDAFELLRDGLTKHHLGGTPKKQGDVMPEIARTRP
Ga0210394_1064367213300021420SoilTIAPEDLKQFKIVDSPEDAFEFLRDGLTKYHLGGAPKKEGEALPEIAKTRP
Ga0210384_1097352423300021432SoilEEGFEFLRDGLTKYHLEHETKHKGERVPEIAKTNP
Ga0210390_1066565323300021474SoilDTPEEAFEFLKDGLTKYHLGGEPKKEKEREVTPEIAKTRP
Ga0210390_1099412113300021474SoilFKIVDSPEEGFEFLRDGLTKYHLGPEPKHKGEPGERVPEIAKTNP
Ga0210398_1100030213300021477SoilFKFVDSPEEGFEFLRDGLTKYHLGPEPKRNATAMPEIAKTNP
Ga0210398_1100545723300021477SoilIVDTPEDAFEYLRDGLTKYHLGGAPKKTGEVLPEIAKTRP
Ga0210402_1159631213300021478SoilEGFEVLRDGLVRYHLGPQQAKHPGEATPEIAKTNP
Ga0126371_1268889513300021560Tropical Forest SoilMVDSPEEGYEFLRDGLTKYHLEAPPPRRANEVVPEIAKTNP
Ga0126371_1275368813300021560Tropical Forest SoilLFKIVDSPEEGFEFLRDGLIRYHLRPEGEHKTEAMPEIAKTNR
Ga0212123_1060014623300022557Iron-Sulfur Acid SpringLHQFKIVDSPDDAFEFLRDGLTKYHLGGAPKKEGEVLPEIAKTRP
Ga0242665_1036137723300022724SoilDSPEEGFEFLRDGLTKYHLVPEPKHKGERVPEIAKTNP
Ga0224544_102951123300023250SoilDAFAFLRDGLTEYHLGGGQPKKEKEQEVLPEIAKTRP
Ga0224572_100494563300024225RhizosphereVETPEDAFTFLRDGLTEYHLGGTPKKEKEEVLPEIAKTRP
Ga0137417_146645693300024330Vadose Zone SoilMVDSPEEGFEFLRDGLAKYHLAPPQPKRTGEVVPEIAKTNP
Ga0208035_101941913300025406PeatlandFKFVDSPEDAFAFLRDGLTEYHLGGPKKEKEKEQEVEPEIAKTRP
Ga0208220_116950313300025627Arctic Peat SoilEGFEFLRDGLTKYHLDFESPRRARETVPEIAKTNP
Ga0207699_1054124113300025906Corn, Switchgrass And Miscanthus RhizosphereVELFRIVDSPEEGFEFLRDGLVKYHLGAQPKRVVESLPEIAKTNP
Ga0207684_1010954343300025910Corn, Switchgrass And Miscanthus RhizosphereEEGFEVLRDGLTLYHLGEQPNKKKQGEVLPEIAKTRP
Ga0207671_1114708113300025914Corn RhizosphereEEGFEFLKEGLTKYHLGPDRPRRVGEVVPEIAKTNP
Ga0207646_1030568333300025922Corn, Switchgrass And Miscanthus RhizosphereDAGVISPQDLDLFKIADSPEESFEFLKAGLTKYHLGPPPKRAAEFAPEIAKTRP
Ga0207694_1033805433300025924Corn RhizosphereVDTPEEGFEYLRDGLTKYHLGPQPKTTGEAAPEIAKTRP
Ga0207664_1027538433300025929Agricultural SoilLIRVVDNPEEAFEFLRDGLIKYHLGAAPKKQGEVMPEIAKTRP
Ga0207665_1060619623300025939Corn, Switchgrass And Miscanthus RhizosphereVDSPEEGFEVLRDGLTKYHLGGVVKKEGEVLPDIAKTRP
Ga0207661_1012969513300025944Corn RhizosphereDSPEEGFEYLRENLIKYHLAPQPKSPAQAVPEIAKTRP
Ga0207667_1009052613300025949Corn RhizospherePEEGFDFLKEGLTKYHLGPDRPRRVGEVVPEIAKTNP
Ga0207677_1135496723300026023Miscanthus RhizosphereDSPEEGFEYLRENLIKYHLTPQPKSPAQAVPEIAKTRP
Ga0207702_1114532913300026078Corn RhizosphereEEGFEFLREGLVKYHLAPQQPKRPGEAVPEIAKTNP
Ga0209239_106914333300026310Grasslands SoilEGFEYLRDGLTKYHLGPLQPKRVGEAVPEIAKTNP
Ga0209687_124687713300026322SoilDLFKIVDSPEEGFEYLRENLVKYHLGPQPKSPAQAVPEIAKTRP
Ga0209473_103787413300026330SoilMVDSPEEGFEYLREGLTKYHLGPDRPKRVGEVVPEIAKTNP
Ga0209161_1030867913300026548SoilDLDLFKIVDSPEEGFEYLRAGLTTYHLVGEPKRVGERVPEIAKTNP
Ga0209161_1043388723300026548SoilSPVDLELFKMVDTPEEGFAYLKEGLTKYHLGPDRPRRVGEVVPEIAKTNP
Ga0208602_102406423300027067Forest SoilDAGSVSPEDMELFKIVDTPEAAFEFLRDGLTKYHLGGAVKKEGEVTPEIAKTRP
Ga0209214_103109723300027071Forest SoilDAGTVSPQDLDLFKIVDNPEEAFEFLRGGLTSYHLGDTPKKKGEVLPEIAKTRP
Ga0209421_100879643300027432Forest SoilRIVDTPEEGFEYLREGLTQHHLGQDRPRHVSEVAPEIAKTNP
Ga0209218_100625743300027505Forest SoilNLLKIVDSPEDAFEFLRDGLTNYHLGGTPKKEGEVLPEIAKTRG
Ga0209219_116684913300027565Forest SoilKIVDSPEEGFEFLRDGLTKHHLTPEPKHKGEPAERVPEIAKTNP
Ga0208043_114408523300027570Peatlands SoilEEGFEFLRDGLTKYHLGPEPKHKGEQVPEIAKTNP
Ga0208696_105060913300027696Peatlands SoilIVDSPEEGFEFLRDGLTKYHLGPEPKHKGEQGERVPEIAKTNP
Ga0209178_126304413300027725Agricultural SoilSTEEGFEFLRDGLVKYHLGPQPKTPEAMPEIAKTNP
Ga0209038_1020355013300027737Bog Forest SoilDLDLLKMVDTPEEAFEFLRDGLTKYHLGGAPKKEGEVLPEIAKTRG
Ga0208989_1024832423300027738Forest SoilEGFEFLRDGLTRYHLAPEPKHKGEPAERVPEIAKTNP
Ga0209772_1029843523300027768Bog Forest SoilIVDSPDEGFEFLREGLTKYHLGGAPKREGEAMPEIAKTNP
Ga0209656_1025975813300027812Bog Forest SoilLDQFKFVDTPEEAFEFLRDGLTKYHLGGTPKKQGEVLPEIAKTRP
Ga0209580_1006358543300027842Surface SoilPDEAFAFLRDGLTKYHLGGAPKKEREVLPEIAKTRP
Ga0209580_1046997413300027842Surface SoilDVNQFKLVDSPVDAFEFLRDGLTKYHLGGTQKKEGEVLPEIAKTRP
Ga0209167_1006839243300027867Surface SoilVDSPEEGFEFLRDGLTKYHLGPEPRRAATAMPEIAKTNP
Ga0209169_1019298323300027879SoilIVDTPEAAFEYLRDGLTKYHLGGTPKKEGEVLPEIAKTRP
Ga0209590_1010476813300027882Vadose Zone SoilDSPEEGFEYLRAGLTTYHLVGEPKRVGERVPEIAKTNP
Ga0209590_1050248223300027882Vadose Zone SoilIVDSPEEGFEYLREGLTRHHLVPQPRHVEAVPEIAKTNP
Ga0209380_1045110513300027889SoilFVDSPEDAFTFLRDGLTEYHLGGPPKKEKEEAIPEIAKTRP
Ga0209380_1054599113300027889SoilELFKIVDSPEEGFEFLRDGLTKYHLVQETKHKGEPAERVPEIAKTNP
Ga0209624_1083663813300027895Forest SoilAFTFLRDGLTEYHLGGPPKKEKEQEVLPEIAKTRP
Ga0209624_1089777623300027895Forest SoilPEDAFEVLRDGLTTYHLGGTPKKEGEALPEIAKTRP
Ga0209067_1007078613300027898WatershedsLFSFVDTPEEAFEQLKNGLTKHHLGGIKRHGETLPEIAKTRL
Ga0209698_1063271413300027911WatershedsFKIVNSPEEGFEFLRDGLTKYHLGPEPKRKGERVPEIAKTNP
Ga0209698_1065077223300027911WatershedsIVNSPEEGFEFLREGLTRYHLGPEPKRKGERVPEIAKTNP
Ga0137415_1137637823300028536Vadose Zone SoilEEGFEVLKNGLTQYHLGEQPKKKQGEVLPEIAKTRP
Ga0308309_1165164623300028906SoilSPEDAFEVLRDGLTTYHLGGTPKREGEALPEIAKTRP
Ga0308309_1166719713300028906SoilEEGFEFLRDGLTKYHLVQETKHKGESAERAPEIAKTNP
Ga0311368_1068637923300029882PalsaLFHFANTPEEGFEFLRDGLTKYHLGGAMKKAEPQEVLPEIAKTRP
Ga0311362_1105596713300029913BogAFSFLREGLTEHHLGGPPKKEKEQEVLPEIAKTRP
Ga0311359_1022629943300029914BogNLFKFVDSPEAAFTFLREGLTEHHLGGSVKKEKELEVLPEIAKTRP
Ga0311339_10014487113300029999PalsaPEDAFEFLRDGLTKHHLGGAPKKEGEVLPEIAKTRG
Ga0302286_1065159013300030047FenLFKMVDSPEEGFEFLKENLTRYHLGPHQPKNAGEAATPEIAKTRP
Ga0311356_1057658333300030617PalsaTVSQGDLDRLKVVDSPEDAFEFLRDGLTKHHLGGAPKKEGEVLPEIAKTRG
Ga0311356_1130846813300030617PalsaVDSPEDAFSFLRDGLTEYHLGGSPKKEKEQEVLPEIAKTRP
Ga0073994_1005262113300030991SoilLELFKIVDSPEEGFEFLRDGLTKYHMGPQPKPVGESVPEIAKTNP
Ga0073994_1240289313300030991SoilLVQFVNSPEEGFEVLRDGLTQYHLGEQPKKKPGEVLPEIAKTRP
Ga0302180_1000287613300031028PalsaDTPEDAFTFLRDGLTEYHLGGPPKKEKEQEVLPEIAKTRP
Ga0265760_1006377213300031090SoilTPEEGFEFLRDGLTKYHLGGETKKTETREVVPDIARTRP
Ga0302318_1041538313300031258BogAEDIDLFKIVDTPEAGFEYLREGLTQHHLGSQPRNTGEIVPEIAKTNP
Ga0310915_1039235133300031573SoilDTPEEGFEVLRNGLTAHHLGDAAKKKEIDVTPDIAKTRP
Ga0307476_1040116613300031715Hardwood Forest SoilEDVNQFKVVDSPEDAFEFLRDGLTQYHLGGAPKKEGEVLPEIAKTRP
Ga0307474_1057204033300031718Hardwood Forest SoilLELFKIVDSPEEGFEFLRDGLTKYHLGPEPKNKGEQGERVPEIAKTNP
Ga0307468_10183522923300031740Hardwood Forest SoilKMVDSPEEGFEYLKDGLSKYHLAGIPKKEAEVLPDIARTRP
Ga0306926_1116440723300031954SoilQLFKIVDSPEDAFEFLRDGLTKYHLGGPPKKEKEREVTPEIAKTRP
Ga0307479_1049140233300031962Hardwood Forest SoilMVDSPEEGFEFLRDGLIQYHLGPDKSKRAGEIVPEIAKTNP
Ga0307479_1054849113300031962Hardwood Forest SoilAEDLDLFKIVDSPEDAFAFLREGLTAYHLDQPKKPEVVPEIAKTRP
Ga0306922_1077874033300032001SoilTPEEGFEVLRNGLTAHHLGDAAKKKEIDVTPDIAKTRP
Ga0318532_1026845823300032051SoilFKIVDNPEEAFEFLRDGLTKYHLGEQPKKKGEVLPEIAKTRP
Ga0307470_1003791113300032174Hardwood Forest SoilDNPEEAFEFLRGGLTSYHLGDTPKKKGEVLPEIAKTRP
Ga0307471_10194681313300032180Hardwood Forest SoilDSPEEGFEYLRDGLTKYHLGALQPKRVGEVVPEIAKTNP
Ga0307472_10048828323300032205Hardwood Forest SoilALADSGTISLQDLELFKMVDSPQEGFEFLRDSLTRYHLGPPPKRAGEFVPEIAKTNP
Ga0335085_1082082333300032770SoilQFKIVDNPEEAFEFLRDGLTKHHLGGTPKKEREVLPEIAKTRP
Ga0335079_1091702723300032783SoilSPEEGFEFLRDGLTKYHLQPEPKYKAEAMPEIAKTNP
Ga0335079_1173790123300032783SoilLELFKVVDSPEEGFEFLREGLTRYHLGPEPKHKGHAVPEIAKTNP
Ga0335078_1033283013300032805SoilDPEQAFEFLRDGLTKYHLGEAPKKKAEVLPEIAKTRP
Ga0335080_1025202543300032828SoilEDAFEFLRDGLTKYHLGDAPKKKGEVLPEIAKTRP
Ga0335070_1012311453300032829SoilNDVNLFKLVDSPEEGFEVLRAGLTEYHLGEPKKKEAEVLPEIAKTRP
Ga0335069_1096123123300032893SoilLDLFKIVDSPEEGFEYLKEGLTRYHLGPQPKRPAEAAMPEIAKTRP
Ga0335084_1044903833300033004SoilLDLFKVVDNPEEAFEFLRDGLTKYHLGEQPKKKGEVLPEIAKTRP
Ga0335084_1233769123300033004SoilDPTEAFEYLRDGLTKYHLGEAPKKKGEVLPEIAKTRP
Ga0335077_1113521413300033158SoilVDTPEEGFEFLREGLTQYHLGPEPKRVGERVPEIAKTNP
Ga0334722_1014968313300033233SedimentDTPEEGFEFLRDGLTNYHLGQQPKKAEGETTMPEIAKTRP
Ga0310914_1094452613300033289SoilDSPEDAFEFLRDGLTKYHLGGPPKKEKEREVTPEIAKTRP
Ga0326728_1044014823300033402Peat SoilSPEEAFEYLRDGLTKHHLGPAPRKVGEIVPEIAKTRP
Ga0310810_1069663713300033412SoilEEGFEYLRDGLTEHHLGVPQSKVGERVPEIAKTRP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.