Basic Information | |
---|---|
Family ID | F017406 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 241 |
Average Sequence Length | 42 residues |
Representative Sequence | DSPEEGFEFLRDGLTKYHLGPEPKHKGEQVPEIAKTNP |
Number of Associated Samples | 208 |
Number of Associated Scaffolds | 241 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.41 % |
% of genes near scaffold ends (potentially truncated) | 99.17 % |
% of genes from short scaffolds (< 2000 bps) | 92.53 % |
Associated GOLD sequencing projects | 194 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.266 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.033 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.651 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.378 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.79% β-sheet: 0.00% Coil/Unstructured: 71.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 241 Family Scaffolds |
---|---|---|
PF02581 | TMP-TENI | 70.54 |
PF03781 | FGE-sulfatase | 2.90 |
PF13411 | MerR_1 | 2.49 |
PF13376 | OmdA | 1.66 |
PF01121 | CoaE | 0.83 |
PF06439 | 3keto-disac_hyd | 0.41 |
PF13365 | Trypsin_2 | 0.41 |
PF01425 | Amidase | 0.41 |
PF00575 | S1 | 0.41 |
PF13231 | PMT_2 | 0.41 |
PF01432 | Peptidase_M3 | 0.41 |
PF12681 | Glyoxalase_2 | 0.41 |
PF02517 | Rce1-like | 0.41 |
PF04916 | Phospholip_B | 0.41 |
PF03328 | HpcH_HpaI | 0.41 |
PF07884 | VKOR | 0.41 |
PF00128 | Alpha-amylase | 0.41 |
PF01740 | STAS | 0.41 |
PF01435 | Peptidase_M48 | 0.41 |
PF13620 | CarboxypepD_reg | 0.41 |
PF00903 | Glyoxalase | 0.41 |
PF01401 | Peptidase_M2 | 0.41 |
PF02545 | Maf | 0.41 |
PF09992 | NAGPA | 0.41 |
PF00196 | GerE | 0.41 |
PF00106 | adh_short | 0.41 |
COG ID | Name | Functional Category | % Frequency in 241 Family Scaffolds |
---|---|---|---|
COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 70.54 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 2.90 |
COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.83 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.41 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.41 |
COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 0.41 |
COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.41 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.41 |
COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.41 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.41 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.41 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.41 |
COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.41 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.41 |
COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.41 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.41 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.27 % |
Unclassified | root | N/A | 3.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_100080810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3018 | Open in IMG/M |
3300004080|Ga0062385_10650828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 673 | Open in IMG/M |
3300004082|Ga0062384_101082555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 577 | Open in IMG/M |
3300004092|Ga0062389_103249599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 609 | Open in IMG/M |
3300004156|Ga0062589_100121636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1721 | Open in IMG/M |
3300004479|Ga0062595_102649003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300005171|Ga0066677_10305911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 909 | Open in IMG/M |
3300005339|Ga0070660_100863008 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300005355|Ga0070671_101084935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 703 | Open in IMG/M |
3300005367|Ga0070667_101984602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 548 | Open in IMG/M |
3300005435|Ga0070714_101653844 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300005439|Ga0070711_101371540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 615 | Open in IMG/M |
3300005468|Ga0070707_100164351 | All Organisms → cellular organisms → Bacteria | 2163 | Open in IMG/M |
3300005526|Ga0073909_10565955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 557 | Open in IMG/M |
3300005529|Ga0070741_11465488 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300005534|Ga0070735_10519017 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300005537|Ga0070730_10931078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 544 | Open in IMG/M |
3300005538|Ga0070731_10237239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1210 | Open in IMG/M |
3300005541|Ga0070733_10194793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1324 | Open in IMG/M |
3300005541|Ga0070733_10248925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1168 | Open in IMG/M |
3300005545|Ga0070695_100225495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1352 | Open in IMG/M |
3300005547|Ga0070693_100137784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1533 | Open in IMG/M |
3300005569|Ga0066705_10945236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 511 | Open in IMG/M |
3300005591|Ga0070761_10140085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1413 | Open in IMG/M |
3300005598|Ga0066706_11193201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 578 | Open in IMG/M |
3300005602|Ga0070762_10635394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 711 | Open in IMG/M |
3300005712|Ga0070764_10113078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1462 | Open in IMG/M |
3300005764|Ga0066903_104896909 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300005764|Ga0066903_107172310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 577 | Open in IMG/M |
3300005764|Ga0066903_108726669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300005874|Ga0075288_1004031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1866 | Open in IMG/M |
3300005895|Ga0075277_1078039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 543 | Open in IMG/M |
3300005921|Ga0070766_10796027 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300005994|Ga0066789_10179147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 896 | Open in IMG/M |
3300006028|Ga0070717_10552825 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300006034|Ga0066656_10179021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1340 | Open in IMG/M |
3300006050|Ga0075028_100873690 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300006052|Ga0075029_101132493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 544 | Open in IMG/M |
3300006086|Ga0075019_10140721 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
3300006163|Ga0070715_10796070 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300006172|Ga0075018_10817165 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300006173|Ga0070716_100423234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 964 | Open in IMG/M |
3300006175|Ga0070712_100683152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 874 | Open in IMG/M |
3300006175|Ga0070712_101208338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300006800|Ga0066660_11014589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 665 | Open in IMG/M |
3300006800|Ga0066660_11116010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 624 | Open in IMG/M |
3300006806|Ga0079220_10724238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 736 | Open in IMG/M |
3300006904|Ga0075424_100445251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1382 | Open in IMG/M |
3300009038|Ga0099829_11267926 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300009089|Ga0099828_11302969 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300009090|Ga0099827_10728465 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300009090|Ga0099827_11014974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300009090|Ga0099827_11630828 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300009093|Ga0105240_10855109 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300009137|Ga0066709_104074504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300009174|Ga0105241_10283768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
3300009176|Ga0105242_11377579 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300009521|Ga0116222_1247527 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300009523|Ga0116221_1175931 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300009545|Ga0105237_11396973 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300009624|Ga0116105_1001767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4854 | Open in IMG/M |
3300009646|Ga0116132_1286277 | Not Available | 503 | Open in IMG/M |
3300009665|Ga0116135_1152088 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300009700|Ga0116217_10949682 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300010358|Ga0126370_11674281 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300010366|Ga0126379_10381424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1451 | Open in IMG/M |
3300010366|Ga0126379_12911409 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300010376|Ga0126381_101768800 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300010376|Ga0126381_102703176 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300010376|Ga0126381_102910934 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300010379|Ga0136449_102238922 | Not Available | 795 | Open in IMG/M |
3300010398|Ga0126383_13544469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300010403|Ga0134123_10769906 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300010876|Ga0126361_10972456 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300010937|Ga0137776_1330402 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300011269|Ga0137392_10345546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1232 | Open in IMG/M |
3300011270|Ga0137391_11398942 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300011271|Ga0137393_10337190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1287 | Open in IMG/M |
3300012096|Ga0137389_10475183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1071 | Open in IMG/M |
3300012199|Ga0137383_10726034 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300012207|Ga0137381_10709027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 874 | Open in IMG/M |
3300012210|Ga0137378_11862431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300012349|Ga0137387_10636507 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300012357|Ga0137384_10664417 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300012359|Ga0137385_11227073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300012362|Ga0137361_10439419 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300012362|Ga0137361_11791322 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300012511|Ga0157332_1052272 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300012532|Ga0137373_10179087 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
3300012683|Ga0137398_10134583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1591 | Open in IMG/M |
3300012917|Ga0137395_11095839 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300012918|Ga0137396_11158060 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300012923|Ga0137359_10153396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2054 | Open in IMG/M |
3300012929|Ga0137404_10564885 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300012930|Ga0137407_10331838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1397 | Open in IMG/M |
3300012964|Ga0153916_10905809 | Not Available | 962 | Open in IMG/M |
3300012971|Ga0126369_12546515 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300012972|Ga0134077_10105520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
3300012989|Ga0164305_10410341 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300013100|Ga0157373_10257571 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300014159|Ga0181530_10593009 | Not Available | 543 | Open in IMG/M |
3300014164|Ga0181532_10170210 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300014489|Ga0182018_10478195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 660 | Open in IMG/M |
3300014501|Ga0182024_11872121 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300014654|Ga0181525_10025545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3593 | Open in IMG/M |
3300015241|Ga0137418_11026130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
3300015356|Ga0134073_10289813 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300017822|Ga0187802_10112647 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300017936|Ga0187821_10056545 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
3300017943|Ga0187819_10141301 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
3300017948|Ga0187847_10511181 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300017961|Ga0187778_10532424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
3300017961|Ga0187778_11339745 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300017970|Ga0187783_10015935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5552 | Open in IMG/M |
3300017970|Ga0187783_10558777 | Not Available | 829 | Open in IMG/M |
3300017972|Ga0187781_10408640 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300018019|Ga0187874_10434312 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300018035|Ga0187875_10562054 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300018037|Ga0187883_10756369 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300018042|Ga0187871_10860332 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300018042|Ga0187871_10875339 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300018043|Ga0187887_10101830 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
3300018058|Ga0187766_10899342 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300018085|Ga0187772_10722234 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300018085|Ga0187772_11142942 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300018088|Ga0187771_11747357 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 528 | Open in IMG/M |
3300018468|Ga0066662_10073759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2299 | Open in IMG/M |
3300019887|Ga0193729_1144373 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300020006|Ga0193735_1170819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 544 | Open in IMG/M |
3300020580|Ga0210403_10431051 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300020580|Ga0210403_11359286 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300020580|Ga0210403_11455188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 517 | Open in IMG/M |
3300020581|Ga0210399_10511005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 998 | Open in IMG/M |
3300020582|Ga0210395_11391276 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300020583|Ga0210401_10702424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
3300021088|Ga0210404_10616082 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300021168|Ga0210406_11006554 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300021168|Ga0210406_11139757 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300021178|Ga0210408_11374024 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300021180|Ga0210396_10858589 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300021401|Ga0210393_11647541 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300021405|Ga0210387_11583097 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300021407|Ga0210383_11129477 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300021420|Ga0210394_10643672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
3300021432|Ga0210384_10973524 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300021474|Ga0210390_10665653 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300021474|Ga0210390_10994121 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300021477|Ga0210398_11000302 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300021477|Ga0210398_11005457 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300021478|Ga0210402_11596312 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300021560|Ga0126371_12688895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300021560|Ga0126371_12753688 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300022557|Ga0212123_10600146 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300022724|Ga0242665_10361377 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300023250|Ga0224544_1029511 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300024225|Ga0224572_1004945 | All Organisms → cellular organisms → Bacteria | 2354 | Open in IMG/M |
3300024330|Ga0137417_1466456 | All Organisms → cellular organisms → Bacteria | 5948 | Open in IMG/M |
3300025406|Ga0208035_1019419 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300025627|Ga0208220_1169503 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300025906|Ga0207699_10541241 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300025910|Ga0207684_10109543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2364 | Open in IMG/M |
3300025914|Ga0207671_11147081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300025922|Ga0207646_10305683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1437 | Open in IMG/M |
3300025924|Ga0207694_10338054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
3300025929|Ga0207664_10275384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1475 | Open in IMG/M |
3300025939|Ga0207665_10606196 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300025944|Ga0207661_10129695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2158 | Open in IMG/M |
3300025949|Ga0207667_10090526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3162 | Open in IMG/M |
3300026023|Ga0207677_11354967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300026078|Ga0207702_11145329 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300026310|Ga0209239_1069143 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
3300026322|Ga0209687_1246877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300026330|Ga0209473_1037874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2153 | Open in IMG/M |
3300026548|Ga0209161_10308679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
3300026548|Ga0209161_10433887 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300027067|Ga0208602_1024064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 606 | Open in IMG/M |
3300027071|Ga0209214_1031097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 705 | Open in IMG/M |
3300027432|Ga0209421_1008796 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
3300027505|Ga0209218_1006257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1942 | Open in IMG/M |
3300027565|Ga0209219_1166849 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300027570|Ga0208043_1144085 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300027696|Ga0208696_1050609 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
3300027725|Ga0209178_1263044 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300027737|Ga0209038_10203550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300027738|Ga0208989_10248324 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300027768|Ga0209772_10298435 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300027812|Ga0209656_10259758 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300027842|Ga0209580_10063585 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
3300027842|Ga0209580_10469974 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300027867|Ga0209167_10068392 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
3300027879|Ga0209169_10192983 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300027882|Ga0209590_10104768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1696 | Open in IMG/M |
3300027882|Ga0209590_10502482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
3300027889|Ga0209380_10451105 | Not Available | 752 | Open in IMG/M |
3300027889|Ga0209380_10545991 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300027895|Ga0209624_10836638 | Not Available | 603 | Open in IMG/M |
3300027895|Ga0209624_10897776 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300027898|Ga0209067_10070786 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
3300027911|Ga0209698_10632714 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300027911|Ga0209698_10650772 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300028536|Ga0137415_11376378 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300028906|Ga0308309_11651646 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300028906|Ga0308309_11667197 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300029882|Ga0311368_10686379 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300029913|Ga0311362_11055967 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300029914|Ga0311359_10226299 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
3300029999|Ga0311339_10014487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12105 | Open in IMG/M |
3300030047|Ga0302286_10651590 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300030617|Ga0311356_10576583 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300030617|Ga0311356_11308468 | Not Available | 663 | Open in IMG/M |
3300030991|Ga0073994_10052621 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300030991|Ga0073994_12402893 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300031028|Ga0302180_10002876 | All Organisms → cellular organisms → Bacteria | 13281 | Open in IMG/M |
3300031090|Ga0265760_10063772 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300031258|Ga0302318_10415383 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300031573|Ga0310915_10392351 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300031715|Ga0307476_10401166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1013 | Open in IMG/M |
3300031718|Ga0307474_10572040 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300031740|Ga0307468_101835229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. YIM 10 | 575 | Open in IMG/M |
3300031954|Ga0306926_11164407 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300031962|Ga0307479_10491402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1211 | Open in IMG/M |
3300031962|Ga0307479_10548491 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300032001|Ga0306922_10778740 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300032051|Ga0318532_10268458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300032174|Ga0307470_10037911 | All Organisms → cellular organisms → Bacteria | 2360 | Open in IMG/M |
3300032180|Ga0307471_101946813 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300032205|Ga0307472_100488283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1058 | Open in IMG/M |
3300032770|Ga0335085_10820823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1021 | Open in IMG/M |
3300032783|Ga0335079_10917027 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300032783|Ga0335079_11737901 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300032805|Ga0335078_10332830 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300032828|Ga0335080_10252025 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
3300032829|Ga0335070_10123114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2677 | Open in IMG/M |
3300032893|Ga0335069_10961231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
3300033004|Ga0335084_10449038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1326 | Open in IMG/M |
3300033004|Ga0335084_12337691 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300033158|Ga0335077_11135214 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300033233|Ga0334722_10149683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1748 | Open in IMG/M |
3300033289|Ga0310914_10944526 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300033402|Ga0326728_10440148 | Not Available | 1090 | Open in IMG/M |
3300033412|Ga0310810_10696637 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.20% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.39% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.15% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.15% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.73% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.73% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.73% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.73% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.32% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.90% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.90% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.49% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.49% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.07% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.07% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.66% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.24% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.24% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.24% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.24% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.24% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.83% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.41% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.41% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.41% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.41% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.41% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.41% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.41% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.41% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.41% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.41% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.41% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.41% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.41% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.41% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.41% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.41% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.41% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.41% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.41% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.41% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027067 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF007 (SPAdes) | Environmental | Open in IMG/M |
3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1000808101 | 3300002245 | Forest Soil | AGTVSPQDIDQFKIIDSPDEAFEFLRDGLTKFHLGGAPTKQGEVMPEIAKTRP* |
Ga0062385_106508282 | 3300004080 | Bog Forest Soil | FKFVDTPEDAFTFLRDGLTEYHLGGQPKKEKEQEVLPEIAKTRP* |
Ga0062384_1010825552 | 3300004082 | Bog Forest Soil | DAGTISAEDLELFKIVDSPDEGFEFLREGLTKYHLGGAPKREGEAMPEIAKTNP* |
Ga0062389_1032495992 | 3300004092 | Bog Forest Soil | IVDSPEEGFEFLRDGLTKYHLVQETKHKGESAERAPEIAKTNP* |
Ga0062589_1001216364 | 3300004156 | Soil | MVDTPEEGFEVLKQGLTKYHLGPDRPRRVGEVVPEIAKTNP* |
Ga0062595_1026490031 | 3300004479 | Soil | TVSPQDLDLIRVVDNPEEAFEFLRDGLIKYHLGAAPKKQGEVMPEIAKTRP* |
Ga0066677_103059111 | 3300005171 | Soil | MVDSPEEGFEYLREGLTQYHLGGAPKSSGEGLPEIAKTRP* |
Ga0070660_1008630082 | 3300005339 | Corn Rhizosphere | SPHDLDLFKVVDSPEEGFEYLRENLIKYHLTPQPKSPAQAVPEIAKTRP* |
Ga0070671_1010849351 | 3300005355 | Switchgrass Rhizosphere | NASDLDLFHMADSPEAGFEYLRDGLTKYHLGPQPKAPEAVPEIAKTNP* |
Ga0070667_1019846022 | 3300005367 | Switchgrass Rhizosphere | MVDTPEEGVDFLKQGLTKYHLGPERVRRVGEVVPEIAKTNP* |
Ga0070714_1016538441 | 3300005435 | Agricultural Soil | TVSPEDVDLFRIVNSPDEGFEFLRDGLTKYHLGSPPREGAPEIAKTRP* |
Ga0070711_1013715402 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LFKVVDSPEEGFEYLRAGLTKYHLGPDHPRRAGEAVPEIAKTNP* |
Ga0070707_1001643511 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | DAGVISPQDLDLFKIADSPEESFEFLKAGLTKYHLGPPPKRAAEFAPEIAKTRP* |
Ga0073909_105659552 | 3300005526 | Surface Soil | FKIVDNPQEAFEFLRAGLTKHHLGEAPKKKGDVMPEIAKTRP* |
Ga0070741_114654882 | 3300005529 | Surface Soil | GFEFLKEGLTKYHLGPDRPRRVGEVVPEIAKTNP* |
Ga0070735_105190172 | 3300005534 | Surface Soil | AFKFLTDGLTKYHLGGSPAKKKEDHEVTPEIAKTRP* |
Ga0070730_109310781 | 3300005537 | Surface Soil | KIVDTPEEGFEFLRDGLTRYHLGPEQKSKGEALPEIAKTNP* |
Ga0070731_102372393 | 3300005538 | Surface Soil | DPNEAFEYLREGLTKHHLGGTPKKQGDVMPDIAKTRP* |
Ga0070733_101947933 | 3300005541 | Surface Soil | EDLDQFKILDSPDEAFEFLRDGLTKYHLGGTPKKQGEVLPEIAKTRP* |
Ga0070733_102489253 | 3300005541 | Surface Soil | PGDLDQFKIVDSPDEAFEFLRDGLTKYHLGGTPKKHGEILPEIAKTRP* |
Ga0070695_1002254951 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TMVDTPEEGFEVLKQGLTKYHLGPDRPRRVGEVVPEIAKTNP* |
Ga0070693_1001377841 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | ISADDLDLFTIVDTPEEGMEFLKQALTKYHLGPERPRRLGEVVPEIAKTNP* |
Ga0066705_109452361 | 3300005569 | Soil | KIVDSPEDAFAFLREGLTAYHLEQPKKPEVVPEIAKTRP* |
Ga0070761_101400853 | 3300005591 | Soil | VDTPEDAFEFLRDGLTKYHLGGTPKKEGEALPEIAKTRP* |
Ga0066706_111932011 | 3300005598 | Soil | SPVDLELFKMVDTPEEGFAYLKEGLTKYHLGPDRPRRVGEVVPEIAKTNP* |
Ga0070762_106353942 | 3300005602 | Soil | IVDSPEEGFEFLRDGLTKYHLGPEPKHKGEPGERVPEIAKTNP* |
Ga0070764_101130781 | 3300005712 | Soil | AGTVSPQDIDQFKIIDSPDEAFEFLRDGLTKFHLGGAPTKQGEVMPEIAKTRL* |
Ga0066903_1048969091 | 3300005764 | Tropical Forest Soil | SPEEGFEFLREGLTRYHLAPPQPRHPGERVPEIAKTNP* |
Ga0066903_1071723102 | 3300005764 | Tropical Forest Soil | AKDLDLFKLVNSPEEGFEFLRDGLTQYHLGGVKQKEGEVLPEIAKTRP* |
Ga0066903_1087266692 | 3300005764 | Tropical Forest Soil | VDSPEEGFEYLREGLIKHHLQRPPKHVGETVPEIAKTNP* |
Ga0075288_10040313 | 3300005874 | Rice Paddy Soil | EEAFEFLSDGLTKYHLGGTPKRQGEVLPEIAKTRP* |
Ga0075277_10780392 | 3300005895 | Rice Paddy Soil | LDLIKVVDNPEEAFEFLSDGLTKYHLGGTPKRQGEVLPEIAKTRP* |
Ga0070766_107960272 | 3300005921 | Soil | EGFEFLRDGLTKYHLVQETKHKGEPAERVPEIAKTNP* |
Ga0066789_101791472 | 3300005994 | Soil | DTPEDAFEYLRDGLTKYHLGGAPQKTGEALPEIAKTRP* |
Ga0070717_105528251 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PQDLDLIKVVDNPEEAFESLRDGLTKFHLGPPPKKQAEVMPEIAKTRP* |
Ga0066656_101790211 | 3300006034 | Soil | VDSPEEGFEYLRDGLTKYHLGPLQPKRVGEAVPEIAKTNP* |
Ga0075028_1008736901 | 3300006050 | Watersheds | IVDSPEEGFEFLKENLTKYHLGPQQPKRAGEAAMPEIAKTRP* |
Ga0075029_1011324932 | 3300006052 | Watersheds | AVSPEDLDQFKIIDSPEEAFEFLRDGLTTYHLGGTPKKQGEVLPDIAKTRP* |
Ga0075019_101407213 | 3300006086 | Watersheds | FSFVDTPEEAFEQLKNGLTKHHLGGIKRHGETLPEIAKTRL* |
Ga0070715_107960701 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | QEAFEFLRAGLTKHHLGEAPKKKGDVMPEIAKTRP* |
Ga0075018_108171652 | 3300006172 | Watersheds | TVVDSPEEGFAYLRDGLTEHHLGGQPKAPAEGLPEIAKTRP* |
Ga0070716_1004232341 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EGFEYLREGLTKYHLGPDRPRRAGEAVPEIAKTNP* |
Ga0070712_1006831522 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KMADTPEEGFEYLKEGLTKYHLGPDRPRRVGEVSPEIAKTNP* |
Ga0070712_1012083382 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EAFESLRDGLTKFHLGPPPKKQAEVMPEIAKTRP* |
Ga0066660_110145891 | 3300006800 | Soil | DLGLFKIVDSPEEGYEYLREGLTKYHLDAERPRGAGEKAPEIAKTNP* |
Ga0066660_111160101 | 3300006800 | Soil | EAFEFLRGGLTSYHLGDTPKKKGEVLPEIAKTRP* |
Ga0079220_107242382 | 3300006806 | Agricultural Soil | EAMVETGVISPNDYKLFKMVDTPEEGFQYLKEGLTRYHLGPHRPEKAPEIAKTNP* |
Ga0075424_1004452511 | 3300006904 | Populus Rhizosphere | PDLELFKVVDTPEEGFEYLRAGLTKYHLGPDRPRRAGEVVPEIAKTNP* |
Ga0099829_112679262 | 3300009038 | Vadose Zone Soil | DSPEEGFEYLRDGLTKYHLGSPQPKRVGEVVPEIAKTNP* |
Ga0099828_113029692 | 3300009089 | Vadose Zone Soil | DSPEEGFEFLRDGLTKYHLGPQQPKAPEVMPEIAKTNP* |
Ga0099827_107284651 | 3300009090 | Vadose Zone Soil | MVDSPEEGFEYLRNALTKYHLGPQPKHIGEAMPEIAKTNP* |
Ga0099827_110149742 | 3300009090 | Vadose Zone Soil | RIVDSPEEGFEGLRQGLTRYHLDTERPRRAGEVAPEIAKTNP* |
Ga0099827_116308281 | 3300009090 | Vadose Zone Soil | EEGFEFLRDGLTKYHLGPQQPKAPEAMPEIAKTNP* |
Ga0105240_108551092 | 3300009093 | Corn Rhizosphere | IVDNPEEGFEFLREGLIKYHMGPDRPKRVGEVVPEIAKTNP* |
Ga0066709_1040745042 | 3300009137 | Grasslands Soil | VLDLFKLVDSPEEGFEFLKAGLTKYHLGPDRPRRVGEVVPEIAKTNP* |
Ga0105241_102837683 | 3300009174 | Corn Rhizosphere | EEGVDFLKQGLTKYHLGPERVRRVGEVVPEIAKTNP* |
Ga0105242_113775792 | 3300009176 | Miscanthus Rhizosphere | DSPEEGFEVLKDGLTKYHLGPPKAAGEGVPEIAKTRP* |
Ga0116222_12475272 | 3300009521 | Peatlands Soil | AVSPQDLDQFKIVDSPDEAFEFLRDGLTKYHLGGTPKKEREVLPEIAKTRP* |
Ga0116221_11759313 | 3300009523 | Peatlands Soil | DSPEEGFEFLRDGLTKYHLGPEPKHKGEQVPEIAKTNP* |
Ga0105237_113969732 | 3300009545 | Corn Rhizosphere | GFEFLREGLIKYHMGPDRPKRVGEVVPEIAKTNP* |
Ga0116105_10017671 | 3300009624 | Peatland | DTPEDAFTFLREGLTEYHLGGPPKKEKEQEVLPEIAKTRP* |
Ga0116132_12862771 | 3300009646 | Peatland | SPEDAFTFLRDGLTEYHLGGPLPKKEKEQEVLPEIAKTRP* |
Ga0116135_11520882 | 3300009665 | Peatland | FKFVDSPEDAFAFLRDGLTEYHLGGPKKEKEKEQEVEPEIAKTRP* |
Ga0116217_109496822 | 3300009700 | Peatlands Soil | QFKIVDSPDEAFEFLRDGLTKYHLGGTPKKEREVLPEIAKTRP* |
Ga0126370_116742812 | 3300010358 | Tropical Forest Soil | DSPEEGYEFLRDGLTKYHLEAPPPRRAGEVAPEIAKTNP* |
Ga0126379_103814241 | 3300010366 | Tropical Forest Soil | EEGFAFLQDGLTKYHLGAERPRHVAEVVPEIAKTNP* |
Ga0126379_129114092 | 3300010366 | Tropical Forest Soil | FKIVDSPEDGFEVLRDGLTKYHLGGVVKKEGEVVPDIAKTRP* |
Ga0126381_1017688001 | 3300010376 | Tropical Forest Soil | EEGFEFLKDGLTRYHLGPERTRRVGEVVPEIAKTNP* |
Ga0126381_1027031761 | 3300010376 | Tropical Forest Soil | LFKVVDTPEEGFEFLRAGLTQYHLGAERARRVGEVVPEIAKTNP* |
Ga0126381_1029109341 | 3300010376 | Tropical Forest Soil | ISPEDLELFKMTDSPDEGFEFLREGLTKYHLGPQPKRAPEAVPEIAKTNP* |
Ga0136449_1022389221 | 3300010379 | Peatlands Soil | VLAISGKTSPSFQFKIVDSPEDAFEFLRDGLTKYHLGGTPKKEGEVLPEIAKTRP* |
Ga0126383_135444692 | 3300010398 | Tropical Forest Soil | ALDPDGTIAAADLALFKLVDSPDEGFEFLRDGLTKYHLAGIGKKEGEVMPDIARTRP* |
Ga0134123_107699062 | 3300010403 | Terrestrial Soil | VDTPEEGVDFLKQGLTKYHLGPERVRRVGEVVPEIAKTNP* |
Ga0126361_109724561 | 3300010876 | Boreal Forest Soil | FVDTPEDAFAFLRDGLTEYHLGGPPKKEKEREVLPEIAKTRP* |
Ga0137776_13304023 | 3300010937 | Sediment | AEDLQLFKIVDTPEEGFEYLKEGLTKYHLGPNRPHRVGEAVPEIAKTNP* |
Ga0137392_103455461 | 3300011269 | Vadose Zone Soil | VDSPEEGFEFLREGLTQYHLGTERPRHVVEVVPEIAKTNP* |
Ga0137391_113989422 | 3300011270 | Vadose Zone Soil | DSPEEGFEFLRDGLIKYHLAPQQVKRTGEAVPEIAKTNP* |
Ga0137393_103371903 | 3300011271 | Vadose Zone Soil | PEEGFEFLREGLTQYHLGTERPRHVVEVVPEIAKTNP* |
Ga0137389_104751833 | 3300012096 | Vadose Zone Soil | SPEEGFEFLRDGLTKYHLGPQQPKAPEVMPEIAKTNP* |
Ga0137383_107260341 | 3300012199 | Vadose Zone Soil | SPEEGFEFLREGLTRYHLDTERPRRVGEVAPEIAKTNP* |
Ga0137381_107090272 | 3300012207 | Vadose Zone Soil | LNQFKIVDTPEDAFEFLRDGLTKYHLGGTPKKEGEVLPEIAKTRP* |
Ga0137378_118624311 | 3300012210 | Vadose Zone Soil | AGTVSPQDIDQFKIVDDPDEAFDFLRDGLIKYHLGGTPKKQGEVLPEIAKTRP* |
Ga0137387_106365071 | 3300012349 | Vadose Zone Soil | VDSPEEGYEYLREGLTKYHLDAERPRGAGEKAPEIAKTNP* |
Ga0137384_106644172 | 3300012357 | Vadose Zone Soil | IVDSPEEGYEYLREGLTKYHLDAERPRGAGEKAPEIAKTNP* |
Ga0137385_112270731 | 3300012359 | Vadose Zone Soil | LFRFVDSPEEGFEALREGLIKYHLGAPRREAAPEIAKTL* |
Ga0137361_104394193 | 3300012362 | Vadose Zone Soil | DLFRIVDSPEEGFEYLRDGLTKYHLGPLQPKRVGEVVPEIAKTNP* |
Ga0137361_117913221 | 3300012362 | Vadose Zone Soil | SPEEGFEFLRDGLTKYHLGPRQPKAPEAMPEIAKTNP* |
Ga0157332_10522722 | 3300012511 | Soil | ADLDLFTIVDTPEEGFDFLKQGLTKYHLGPDRPRRVGEVVPEIAKTNP* |
Ga0137373_101790875 | 3300012532 | Vadose Zone Soil | GFEYLKEGLTKYHLGPDRPRRVGEVSPEIAKTNP* |
Ga0137398_101345831 | 3300012683 | Vadose Zone Soil | DSPKEAFEFLRDGLTKYHLVPKPKAEQLPEIARTRL* |
Ga0137395_110958392 | 3300012917 | Vadose Zone Soil | FTFLRDGLTEYHLGGPPKKQKEQEVLPEIAKTRP* |
Ga0137396_111580601 | 3300012918 | Vadose Zone Soil | NLLKIVDSPEEGFEFLKENLTKYHLGPQQPKRTGEAAAPEIAKTRP* |
Ga0137359_101533964 | 3300012923 | Vadose Zone Soil | EEGFEYLRDGLTKYHLGPLQPKRVGEAVPEIAKTNP* |
Ga0137404_105648851 | 3300012929 | Vadose Zone Soil | VDSPEEGFEYLRDGLTKYHLGALQPKRVGEVVPEIAKTNP* |
Ga0137407_103318383 | 3300012930 | Vadose Zone Soil | SPEEGFEFLRDGLMKYHLVPQQPKRTGEAVPEIAKTNP* |
Ga0153916_109058091 | 3300012964 | Freshwater Wetlands | DLQLFQKVDSPEEGFEYLRENLSRYHLAPQPQPKQQEKAPEIARTRP* |
Ga0126369_125465151 | 3300012971 | Tropical Forest Soil | DLDLFKIVDNPEEAFEFLRDGLSKYHLGATPKKQGEVTPEIAKTRP* |
Ga0134077_101055201 | 3300012972 | Grasslands Soil | EGFEYLRDGLTKYHLGPLQPKRVGEAVPEIAKTNP* |
Ga0164305_104103412 | 3300012989 | Soil | DTPEEGFEYLKQGLTEFHLGADRPRRSGETMPEIAKTNP* |
Ga0157373_102575713 | 3300013100 | Corn Rhizosphere | LDLIRVVDNPEEAFEFLRDGLIKYHLGAAPKKQGEVMPEIAKTRP* |
Ga0181530_105930092 | 3300014159 | Bog | VIDSPEEAFEYLRDGLTKHHRGPAPRKVGEIVPEIAKTRP* |
Ga0181532_101702103 | 3300014164 | Bog | SPEEGFEFLRDGLTKYHLVQETKHKGESAERVPEIAKTNP* |
Ga0182018_104781951 | 3300014489 | Palsa | DLDLFKMADTPEEGFEFLREGLTKYHLVDPRRAAETVPEIAKTNP* |
Ga0182024_118721211 | 3300014501 | Permafrost | LFKIVDSPEEGFEFLRDGLTKYHLGPEPKYKAETERAPEIAKTNP* |
Ga0181525_100255451 | 3300014654 | Bog | EEGFEYLRDSLTEHHLGPTPKRVGEAMPEIAKTNP* |
Ga0137418_110261301 | 3300015241 | Vadose Zone Soil | GFEFLRDGLAKYHLVPQQPKRTGEVTPEIAKTNP* |
Ga0134073_102898132 | 3300015356 | Grasslands Soil | GFVLAISAEDLELFKIVDTPVEGYEFLREGLTKYHLEERPRRVGEAVPEIAKTNP* |
Ga0187802_101126471 | 3300017822 | Freshwater Sediment | SPEEGFEFLRDGLTKYHLGPEPRRKGEAMPEIAKTNP |
Ga0187821_100565451 | 3300017936 | Freshwater Sediment | PEEGFEFLRDGLTQHHLGGVTRKEEGLPDIAKTRP |
Ga0187819_101413013 | 3300017943 | Freshwater Sediment | IVDNPEEAFEFLRDGLTKYHLGDTPKKKGEVLPEIAKTRP |
Ga0187847_105111812 | 3300017948 | Peatland | FAFLRDGLTEYHLGGGQPKKEKEQEVEPEIAKTRP |
Ga0187778_105324242 | 3300017961 | Tropical Peatland | ISPQDLHLFKMVDTPEQGFEFLREGLTKHHLAQEFKKVPEITKTNP |
Ga0187778_113397451 | 3300017961 | Tropical Peatland | IVDSPEEGFEFLRDGLTKYHLGPPPKRVGEVMPEIAKTNP |
Ga0187783_100159358 | 3300017970 | Tropical Peatland | SPEEGFEFLRDGLVRYHLRPDTERKAEAMPEIAKTNP |
Ga0187783_105587772 | 3300017970 | Tropical Peatland | VDSPEAAFEFLRDGLTKYHLGGTPKKEREVLPEIAKTRP |
Ga0187781_104086403 | 3300017972 | Tropical Peatland | TPEDAFAFLRDGLTEHHLGGTPKKQQEREVLPEIAKTRP |
Ga0187874_104343121 | 3300018019 | Peatland | TPEDAFTFLRDGLTEYHLGGPPRKEKEQEVLPEIAKTRP |
Ga0187875_105620542 | 3300018035 | Peatland | ELFKIVDSPEEGFEFLRDGLTKYHLVQETKHKGESAERVPEIAKTNP |
Ga0187883_107563691 | 3300018037 | Peatland | DTPEDAFEFLRDGLTQYHLGGAPKKEGEALPEIAKTRP |
Ga0187871_108603321 | 3300018042 | Peatland | VDSPEEGFEFLRDGLTKYHLVQETKHKGESAERVPEIAKTNP |
Ga0187871_108753391 | 3300018042 | Peatland | DSPEEGFEFLRDGLTKYHLVQETKHKGESAERVPEIAKTNP |
Ga0187887_101018304 | 3300018043 | Peatland | FEFLRDGLTKYHLVQETKHKGESAERVPEIAKTNP |
Ga0187766_108993422 | 3300018058 | Tropical Peatland | DLELFKIVDNPREAFEFLRDGLTKYHLGGTPPKKVGDILPEIAKTRP |
Ga0187772_107222341 | 3300018085 | Tropical Peatland | PEEAFEFLRDGLTKHHLGGVPKKTGEMLPEIAKTRP |
Ga0187772_111429422 | 3300018085 | Tropical Peatland | VVDSPEEGFEFLRDGLTKYHLGPEPKRKGEAMPEIAKTNP |
Ga0187771_117473572 | 3300018088 | Tropical Peatland | DAFEFLRDGLTKYHLGGPAPKKVGEILPEIAKTRP |
Ga0066662_100737594 | 3300018468 | Grasslands Soil | PQDLDLIKVVDNPEEAFESLRDGLTKFHLGPPPKKQGEVLPEIAKTRP |
Ga0193729_11443732 | 3300019887 | Soil | LDLFRMVDSPEEGFEFLRDGLVNYHLGPQQAKRPGEAMPEIAKTNP |
Ga0193735_11708191 | 3300020006 | Soil | GAISAEDLELFKIVDTPEEGYEFLREGLTKYHLEERPRRVGEALPEIAKTNP |
Ga0210403_104310512 | 3300020580 | Soil | PEAAFEYLRDGLTKYHLGGTPKKEGEVLPEIAKTRP |
Ga0210403_113592862 | 3300020580 | Soil | LELFKMVDSPEEGFEFLRDGLTQYHLGGVTKKEGEVLPDIAKTLP |
Ga0210403_114551882 | 3300020580 | Soil | LFKIADNPEEAFEFLRGGLTSYHLGDTPKKKGEVLPEIAKTRP |
Ga0210399_105110051 | 3300020581 | Soil | AEDLELFKIVDSPEEGFEFLRDGLTKYHLGPEPKHKGEQGERVPEIAKTNP |
Ga0210395_113912761 | 3300020582 | Soil | ELFKIVDSPEEGFEFLRDGLTKYHLVQETKHKGESTERVPEIAKTNP |
Ga0210401_107024242 | 3300020583 | Soil | VDAGTIAAEDLDLFKIVDSPEDAFAFLREGLTAYHLDQPKKPEVVPEIAKTRP |
Ga0210404_106160821 | 3300021088 | Soil | VDSPEEGFEFLRDGLTKYHLTPEPKHKGEPAERVPEIAKTNP |
Ga0210406_110065542 | 3300021168 | Soil | MADSPEEGFEFLRDGLTKYHLGPQQPKAPEAMPEIAKTNP |
Ga0210406_111397572 | 3300021168 | Soil | EDAFTFLRDGLTEYHLGGQPKKEKEQEVLPEIAKTRP |
Ga0210408_113740241 | 3300021178 | Soil | FKLVDSPEEGFEVLRDGLTEYHLGGIAKKEGEVLPDIARTRP |
Ga0210396_108585891 | 3300021180 | Soil | SPEEGFEFLRDGLTKYHLGPEPKHKGEQGERVPEIAKTNP |
Ga0210393_116475411 | 3300021401 | Soil | EAFEFLRDGLTKYHLGGVVKKEKEGEVTPEIAKTRP |
Ga0210387_115830971 | 3300021405 | Soil | KFVDTPEDAFTFLRDGLTEHHLGGQPKKEKEQEVLPEIAKTRP |
Ga0210383_111294771 | 3300021407 | Soil | KIVDDPHDAFELLRDGLTKHHLGGTPKKQGDVMPEIARTRP |
Ga0210394_106436721 | 3300021420 | Soil | TIAPEDLKQFKIVDSPEDAFEFLRDGLTKYHLGGAPKKEGEALPEIAKTRP |
Ga0210384_109735242 | 3300021432 | Soil | EEGFEFLRDGLTKYHLEHETKHKGERVPEIAKTNP |
Ga0210390_106656532 | 3300021474 | Soil | DTPEEAFEFLKDGLTKYHLGGEPKKEKEREVTPEIAKTRP |
Ga0210390_109941211 | 3300021474 | Soil | FKIVDSPEEGFEFLRDGLTKYHLGPEPKHKGEPGERVPEIAKTNP |
Ga0210398_110003021 | 3300021477 | Soil | FKFVDSPEEGFEFLRDGLTKYHLGPEPKRNATAMPEIAKTNP |
Ga0210398_110054572 | 3300021477 | Soil | IVDTPEDAFEYLRDGLTKYHLGGAPKKTGEVLPEIAKTRP |
Ga0210402_115963121 | 3300021478 | Soil | EGFEVLRDGLVRYHLGPQQAKHPGEATPEIAKTNP |
Ga0126371_126888951 | 3300021560 | Tropical Forest Soil | MVDSPEEGYEFLRDGLTKYHLEAPPPRRANEVVPEIAKTNP |
Ga0126371_127536881 | 3300021560 | Tropical Forest Soil | LFKIVDSPEEGFEFLRDGLIRYHLRPEGEHKTEAMPEIAKTNR |
Ga0212123_106001462 | 3300022557 | Iron-Sulfur Acid Spring | LHQFKIVDSPDDAFEFLRDGLTKYHLGGAPKKEGEVLPEIAKTRP |
Ga0242665_103613772 | 3300022724 | Soil | DSPEEGFEFLRDGLTKYHLVPEPKHKGERVPEIAKTNP |
Ga0224544_10295112 | 3300023250 | Soil | DAFAFLRDGLTEYHLGGGQPKKEKEQEVLPEIAKTRP |
Ga0224572_10049456 | 3300024225 | Rhizosphere | VETPEDAFTFLRDGLTEYHLGGTPKKEKEEVLPEIAKTRP |
Ga0137417_14664569 | 3300024330 | Vadose Zone Soil | MVDSPEEGFEFLRDGLAKYHLAPPQPKRTGEVVPEIAKTNP |
Ga0208035_10194191 | 3300025406 | Peatland | FKFVDSPEDAFAFLRDGLTEYHLGGPKKEKEKEQEVEPEIAKTRP |
Ga0208220_11695031 | 3300025627 | Arctic Peat Soil | EGFEFLRDGLTKYHLDFESPRRARETVPEIAKTNP |
Ga0207699_105412411 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VELFRIVDSPEEGFEFLRDGLVKYHLGAQPKRVVESLPEIAKTNP |
Ga0207684_101095434 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EEGFEVLRDGLTLYHLGEQPNKKKQGEVLPEIAKTRP |
Ga0207671_111470811 | 3300025914 | Corn Rhizosphere | EEGFEFLKEGLTKYHLGPDRPRRVGEVVPEIAKTNP |
Ga0207646_103056833 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DAGVISPQDLDLFKIADSPEESFEFLKAGLTKYHLGPPPKRAAEFAPEIAKTRP |
Ga0207694_103380543 | 3300025924 | Corn Rhizosphere | VDTPEEGFEYLRDGLTKYHLGPQPKTTGEAAPEIAKTRP |
Ga0207664_102753843 | 3300025929 | Agricultural Soil | LIRVVDNPEEAFEFLRDGLIKYHLGAAPKKQGEVMPEIAKTRP |
Ga0207665_106061962 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VDSPEEGFEVLRDGLTKYHLGGVVKKEGEVLPDIAKTRP |
Ga0207661_101296951 | 3300025944 | Corn Rhizosphere | DSPEEGFEYLRENLIKYHLAPQPKSPAQAVPEIAKTRP |
Ga0207667_100905261 | 3300025949 | Corn Rhizosphere | PEEGFDFLKEGLTKYHLGPDRPRRVGEVVPEIAKTNP |
Ga0207677_113549672 | 3300026023 | Miscanthus Rhizosphere | DSPEEGFEYLRENLIKYHLTPQPKSPAQAVPEIAKTRP |
Ga0207702_111453291 | 3300026078 | Corn Rhizosphere | EEGFEFLREGLVKYHLAPQQPKRPGEAVPEIAKTNP |
Ga0209239_10691433 | 3300026310 | Grasslands Soil | EGFEYLRDGLTKYHLGPLQPKRVGEAVPEIAKTNP |
Ga0209687_12468771 | 3300026322 | Soil | DLFKIVDSPEEGFEYLRENLVKYHLGPQPKSPAQAVPEIAKTRP |
Ga0209473_10378741 | 3300026330 | Soil | MVDSPEEGFEYLREGLTKYHLGPDRPKRVGEVVPEIAKTNP |
Ga0209161_103086791 | 3300026548 | Soil | DLDLFKIVDSPEEGFEYLRAGLTTYHLVGEPKRVGERVPEIAKTNP |
Ga0209161_104338872 | 3300026548 | Soil | SPVDLELFKMVDTPEEGFAYLKEGLTKYHLGPDRPRRVGEVVPEIAKTNP |
Ga0208602_10240642 | 3300027067 | Forest Soil | DAGSVSPEDMELFKIVDTPEAAFEFLRDGLTKYHLGGAVKKEGEVTPEIAKTRP |
Ga0209214_10310972 | 3300027071 | Forest Soil | DAGTVSPQDLDLFKIVDNPEEAFEFLRGGLTSYHLGDTPKKKGEVLPEIAKTRP |
Ga0209421_10087964 | 3300027432 | Forest Soil | RIVDTPEEGFEYLREGLTQHHLGQDRPRHVSEVAPEIAKTNP |
Ga0209218_10062574 | 3300027505 | Forest Soil | NLLKIVDSPEDAFEFLRDGLTNYHLGGTPKKEGEVLPEIAKTRG |
Ga0209219_11668491 | 3300027565 | Forest Soil | KIVDSPEEGFEFLRDGLTKHHLTPEPKHKGEPAERVPEIAKTNP |
Ga0208043_11440852 | 3300027570 | Peatlands Soil | EEGFEFLRDGLTKYHLGPEPKHKGEQVPEIAKTNP |
Ga0208696_10506091 | 3300027696 | Peatlands Soil | IVDSPEEGFEFLRDGLTKYHLGPEPKHKGEQGERVPEIAKTNP |
Ga0209178_12630441 | 3300027725 | Agricultural Soil | STEEGFEFLRDGLVKYHLGPQPKTPEAMPEIAKTNP |
Ga0209038_102035501 | 3300027737 | Bog Forest Soil | DLDLLKMVDTPEEAFEFLRDGLTKYHLGGAPKKEGEVLPEIAKTRG |
Ga0208989_102483242 | 3300027738 | Forest Soil | EGFEFLRDGLTRYHLAPEPKHKGEPAERVPEIAKTNP |
Ga0209772_102984352 | 3300027768 | Bog Forest Soil | IVDSPDEGFEFLREGLTKYHLGGAPKREGEAMPEIAKTNP |
Ga0209656_102597581 | 3300027812 | Bog Forest Soil | LDQFKFVDTPEEAFEFLRDGLTKYHLGGTPKKQGEVLPEIAKTRP |
Ga0209580_100635854 | 3300027842 | Surface Soil | PDEAFAFLRDGLTKYHLGGAPKKEREVLPEIAKTRP |
Ga0209580_104699741 | 3300027842 | Surface Soil | DVNQFKLVDSPVDAFEFLRDGLTKYHLGGTQKKEGEVLPEIAKTRP |
Ga0209167_100683924 | 3300027867 | Surface Soil | VDSPEEGFEFLRDGLTKYHLGPEPRRAATAMPEIAKTNP |
Ga0209169_101929832 | 3300027879 | Soil | IVDTPEAAFEYLRDGLTKYHLGGTPKKEGEVLPEIAKTRP |
Ga0209590_101047681 | 3300027882 | Vadose Zone Soil | DSPEEGFEYLRAGLTTYHLVGEPKRVGERVPEIAKTNP |
Ga0209590_105024822 | 3300027882 | Vadose Zone Soil | IVDSPEEGFEYLREGLTRHHLVPQPRHVEAVPEIAKTNP |
Ga0209380_104511051 | 3300027889 | Soil | FVDSPEDAFTFLRDGLTEYHLGGPPKKEKEEAIPEIAKTRP |
Ga0209380_105459911 | 3300027889 | Soil | ELFKIVDSPEEGFEFLRDGLTKYHLVQETKHKGEPAERVPEIAKTNP |
Ga0209624_108366381 | 3300027895 | Forest Soil | AFTFLRDGLTEYHLGGPPKKEKEQEVLPEIAKTRP |
Ga0209624_108977762 | 3300027895 | Forest Soil | PEDAFEVLRDGLTTYHLGGTPKKEGEALPEIAKTRP |
Ga0209067_100707861 | 3300027898 | Watersheds | LFSFVDTPEEAFEQLKNGLTKHHLGGIKRHGETLPEIAKTRL |
Ga0209698_106327141 | 3300027911 | Watersheds | FKIVNSPEEGFEFLRDGLTKYHLGPEPKRKGERVPEIAKTNP |
Ga0209698_106507722 | 3300027911 | Watersheds | IVNSPEEGFEFLREGLTRYHLGPEPKRKGERVPEIAKTNP |
Ga0137415_113763782 | 3300028536 | Vadose Zone Soil | EEGFEVLKNGLTQYHLGEQPKKKQGEVLPEIAKTRP |
Ga0308309_116516462 | 3300028906 | Soil | SPEDAFEVLRDGLTTYHLGGTPKREGEALPEIAKTRP |
Ga0308309_116671971 | 3300028906 | Soil | EEGFEFLRDGLTKYHLVQETKHKGESAERAPEIAKTNP |
Ga0311368_106863792 | 3300029882 | Palsa | LFHFANTPEEGFEFLRDGLTKYHLGGAMKKAEPQEVLPEIAKTRP |
Ga0311362_110559671 | 3300029913 | Bog | AFSFLREGLTEHHLGGPPKKEKEQEVLPEIAKTRP |
Ga0311359_102262994 | 3300029914 | Bog | NLFKFVDSPEAAFTFLREGLTEHHLGGSVKKEKELEVLPEIAKTRP |
Ga0311339_1001448711 | 3300029999 | Palsa | PEDAFEFLRDGLTKHHLGGAPKKEGEVLPEIAKTRG |
Ga0302286_106515901 | 3300030047 | Fen | LFKMVDSPEEGFEFLKENLTRYHLGPHQPKNAGEAATPEIAKTRP |
Ga0311356_105765833 | 3300030617 | Palsa | TVSQGDLDRLKVVDSPEDAFEFLRDGLTKHHLGGAPKKEGEVLPEIAKTRG |
Ga0311356_113084681 | 3300030617 | Palsa | VDSPEDAFSFLRDGLTEYHLGGSPKKEKEQEVLPEIAKTRP |
Ga0073994_100526211 | 3300030991 | Soil | LELFKIVDSPEEGFEFLRDGLTKYHMGPQPKPVGESVPEIAKTNP |
Ga0073994_124028931 | 3300030991 | Soil | LVQFVNSPEEGFEVLRDGLTQYHLGEQPKKKPGEVLPEIAKTRP |
Ga0302180_100028761 | 3300031028 | Palsa | DTPEDAFTFLRDGLTEYHLGGPPKKEKEQEVLPEIAKTRP |
Ga0265760_100637721 | 3300031090 | Soil | TPEEGFEFLRDGLTKYHLGGETKKTETREVVPDIARTRP |
Ga0302318_104153831 | 3300031258 | Bog | AEDIDLFKIVDTPEAGFEYLREGLTQHHLGSQPRNTGEIVPEIAKTNP |
Ga0310915_103923513 | 3300031573 | Soil | DTPEEGFEVLRNGLTAHHLGDAAKKKEIDVTPDIAKTRP |
Ga0307476_104011661 | 3300031715 | Hardwood Forest Soil | EDVNQFKVVDSPEDAFEFLRDGLTQYHLGGAPKKEGEVLPEIAKTRP |
Ga0307474_105720403 | 3300031718 | Hardwood Forest Soil | LELFKIVDSPEEGFEFLRDGLTKYHLGPEPKNKGEQGERVPEIAKTNP |
Ga0307468_1018352292 | 3300031740 | Hardwood Forest Soil | KMVDSPEEGFEYLKDGLSKYHLAGIPKKEAEVLPDIARTRP |
Ga0306926_111644072 | 3300031954 | Soil | QLFKIVDSPEDAFEFLRDGLTKYHLGGPPKKEKEREVTPEIAKTRP |
Ga0307479_104914023 | 3300031962 | Hardwood Forest Soil | MVDSPEEGFEFLRDGLIQYHLGPDKSKRAGEIVPEIAKTNP |
Ga0307479_105484911 | 3300031962 | Hardwood Forest Soil | AEDLDLFKIVDSPEDAFAFLREGLTAYHLDQPKKPEVVPEIAKTRP |
Ga0306922_107787403 | 3300032001 | Soil | TPEEGFEVLRNGLTAHHLGDAAKKKEIDVTPDIAKTRP |
Ga0318532_102684582 | 3300032051 | Soil | FKIVDNPEEAFEFLRDGLTKYHLGEQPKKKGEVLPEIAKTRP |
Ga0307470_100379111 | 3300032174 | Hardwood Forest Soil | DNPEEAFEFLRGGLTSYHLGDTPKKKGEVLPEIAKTRP |
Ga0307471_1019468131 | 3300032180 | Hardwood Forest Soil | DSPEEGFEYLRDGLTKYHLGALQPKRVGEVVPEIAKTNP |
Ga0307472_1004882832 | 3300032205 | Hardwood Forest Soil | ALADSGTISLQDLELFKMVDSPQEGFEFLRDSLTRYHLGPPPKRAGEFVPEIAKTNP |
Ga0335085_108208233 | 3300032770 | Soil | QFKIVDNPEEAFEFLRDGLTKHHLGGTPKKEREVLPEIAKTRP |
Ga0335079_109170272 | 3300032783 | Soil | SPEEGFEFLRDGLTKYHLQPEPKYKAEAMPEIAKTNP |
Ga0335079_117379012 | 3300032783 | Soil | LELFKVVDSPEEGFEFLREGLTRYHLGPEPKHKGHAVPEIAKTNP |
Ga0335078_103328301 | 3300032805 | Soil | DPEQAFEFLRDGLTKYHLGEAPKKKAEVLPEIAKTRP |
Ga0335080_102520254 | 3300032828 | Soil | EDAFEFLRDGLTKYHLGDAPKKKGEVLPEIAKTRP |
Ga0335070_101231145 | 3300032829 | Soil | NDVNLFKLVDSPEEGFEVLRAGLTEYHLGEPKKKEAEVLPEIAKTRP |
Ga0335069_109612312 | 3300032893 | Soil | LDLFKIVDSPEEGFEYLKEGLTRYHLGPQPKRPAEAAMPEIAKTRP |
Ga0335084_104490383 | 3300033004 | Soil | LDLFKVVDNPEEAFEFLRDGLTKYHLGEQPKKKGEVLPEIAKTRP |
Ga0335084_123376912 | 3300033004 | Soil | DPTEAFEYLRDGLTKYHLGEAPKKKGEVLPEIAKTRP |
Ga0335077_111352141 | 3300033158 | Soil | VDTPEEGFEFLREGLTQYHLGPEPKRVGERVPEIAKTNP |
Ga0334722_101496831 | 3300033233 | Sediment | DTPEEGFEFLRDGLTNYHLGQQPKKAEGETTMPEIAKTRP |
Ga0310914_109445261 | 3300033289 | Soil | DSPEDAFEFLRDGLTKYHLGGPPKKEKEREVTPEIAKTRP |
Ga0326728_104401482 | 3300033402 | Peat Soil | SPEEAFEYLRDGLTKHHLGPAPRKVGEIVPEIAKTRP |
Ga0310810_106966371 | 3300033412 | Soil | EEGFEYLRDGLTEHHLGVPQSKVGERVPEIAKTRP |
⦗Top⦘ |